spacer

EBI Dbfetch

ID   CH466619; SV 2; linear; genomic DNA; CON; MUS; 4842546 BP.
XX
AC   CH466619;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009739085 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4842546
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-4842546
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-4842546
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 664f33882e6c607debf53d5268a026be.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000225.
DR   Ensembl-Gn; ENSMUSG00000006818; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023828; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023832; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023861; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023868; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023873; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060475; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062327; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069899; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007005; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007007; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007012; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024595; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041463; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074667; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089015; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093169; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115720; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154553; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155364; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159697; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161747; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167152; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70976397.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4842546
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <900..28409
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /note="gene_id=mCG8584.3"
FT   mRNA            join(<900..956,1395..1483,1873..2010,4795..4875,7386..7445,
FT                   14105..14331,16278..16390,18447..18515,23332..23371,
FT                   24119..24215,26455..28409)
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /product="Fgfr1 oncogene partner, transcript variant
FT                   mCT168129"
FT                   /note="gene_id=mCG8584.3 transcript_id=mCT168129.1 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<900..956,1395..1483,1873..2010,4795..4875,7386..7445,
FT                   14105..14331,16278..16390,18447..18515,23332..23371,
FT                   26455..28409)
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /product="Fgfr1 oncogene partner, transcript variant
FT                   mCT185653"
FT                   /note="gene_id=mCG8584.3 transcript_id=mCT185653.0 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<900..956,1395..1483,1873..2010,4795..4875,
FT                   14105..14331,16278..16390,18447..18515,23332..23371,
FT                   24119..24215,26455..28409)
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /product="Fgfr1 oncogene partner, transcript variant
FT                   mCT7403"
FT                   /note="gene_id=mCG8584.3 transcript_id=mCT7403.3 created on
FT                   11-JUN-2003"
FT   mRNA            join(<900..956,1395..1483,1873..2010,4795..4875,7386..7943)
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /product="Fgfr1 oncogene partner, transcript variant
FT                   mCT168130"
FT                   /note="gene_id=mCG8584.3 transcript_id=mCT168130.0 created
FT                   on 11-JUN-2003"
FT   CDS             join(<902..956,1395..1483,1873..2010,4795..4875,7386..7445,
FT                   14105..14331,16278..16390,18447..18515,23332..23371,
FT                   24119..24215,26455..26529)
FT                   /codon_start=1
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /product="Fgfr1 oncogene partner, isoform CRA_a"
FT                   /note="gene_id=mCG8584.3 transcript_id=mCT168129.1
FT                   protein_id=mCP91103.1 isoform=CRA_a"
FT                   /protein_id="EDL02126.1"
FT                   /translation="NKTPLVNENLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPE
FT                   TSTIQGLEGRENLAQDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPASVEGALDLSDGHP
FT                   PSKSPEGKSSANSTPSKIPRYKGQGKKKTIGQKPGDKKTSSETSQSEPSVSLSESKSKS
FT                   SLHSLAHETRIASFLSSSAVDARDSSALCPDGDDVEGDSFFDDPIPKPEKTYGWRAEPR
FT                   KQVGGLASLSDKPHLRSGLSSLAGAPSLTDPESKRGSTVLKDLKLVGEKIGSLGLGTGE
FT                   DEDYADDFNSASHRSEKSELSIGEEIEEDLSMGVEDGNTSDKLDDLTQDLTVSQLSDVA
FT                   DYLEDVA"
FT   CDS             join(<902..956,1395..1483,1873..2010,4795..4875,
FT                   14105..14331,16278..16390,18447..18515,23332..23371,
FT                   24119..24215,26455..26529)
FT                   /codon_start=1
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /product="Fgfr1 oncogene partner, isoform CRA_b"
FT                   /note="gene_id=mCG8584.3 transcript_id=mCT7403.3
FT                   protein_id=mCP13663.3 isoform=CRA_b"
FT                   /protein_id="EDL02127.1"
FT                   /translation="NKTPLVNENLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPE
FT                   TSTIQGLEGRENLAQDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPASVEGALDLSDGHP
FT                   PSKSPEGKSSANSTPSKKTSSETSQSEPSVSLSESKSKSSLHSLAHETRIASFLSSSAV
FT                   DARDSSALCPDGDDVEGDSFFDDPIPKPEKTYGWRAEPRKQVGGLASLSDKPHLRSGLS
FT                   SLAGAPSLTDPESKRGSTVLKDLKLVGEKIGSLGLGTGEDEDYADDFNSASHRSEKSEL
FT                   SIGEEIEEDLSMGVEDGNTSDKLDDLTQDLTVSQLSDVADYLEDVA"
FT   CDS             join(<902..956,1395..1483,1873..2010,4795..4875,7386..7445,
FT                   14105..14331,16278..16390,18447..18515,23332..23371,
FT                   26455..26479)
FT                   /codon_start=1
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /product="Fgfr1 oncogene partner, isoform CRA_d"
FT                   /note="gene_id=mCG8584.3 transcript_id=mCT185653.0
FT                   protein_id=mCP106911.0 isoform=CRA_d"
FT                   /protein_id="EDL02129.1"
FT                   /translation="NKTPLVNENLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPE
FT                   TSTIQGLEGRENLAQDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPASVEGALDLSDGHP
FT                   PSKSPEGKSSANSTPSKIPRYKGQGKKKTIGQKPGDKKTSSETSQSEPSVSLSESKSKS
FT                   SLHSLAHETRIASFLSSSAVDARDSSALCPDGDDVEGDSFFDDPIPKPEKTYGWRAEPR
FT                   KQVGGLASLSDKPHLRSGLSSLAGAPSLTDPESKRGSTVLKDLKLVGEKIGSLGLGTGE
FT                   DEDYADDFNSSMTSHKT"
FT   CDS             join(<902..956,1395..1483,1873..2010,4795..4875,7386..7487)
FT                   /codon_start=1
FT                   /gene="Fgfr1op"
FT                   /locus_tag="mCG_8584"
FT                   /product="Fgfr1 oncogene partner, isoform CRA_c"
FT                   /note="gene_id=mCG8584.3 transcript_id=mCT168130.0
FT                   protein_id=mCP91100.0 isoform=CRA_c"
FT                   /protein_id="EDL02128.1"
FT                   /translation="NKTPLVNENLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPE
FT                   TSTIQGLEGRENLAQDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPASVEGALDLSDGHP
FT                   PSKSPEGKSSANSTPSKIPRYKGQGKKKTIGQKPGDKVTCMRAEEQSRLC"
FT   gene            69386..83973
FT                   /locus_tag="mCG_8581"
FT                   /note="gene_id=mCG8581.1"
FT   mRNA            join(69386..69507,82816..83973)
FT                   /locus_tag="mCG_8581"
FT                   /product="mCG8581"
FT                   /note="gene_id=mCG8581.1 transcript_id=mCT7409.0 created on
FT                   23-APR-2002"
FT   CDS             82818..83921
FT                   /codon_start=1
FT                   /locus_tag="mCG_8581"
FT                   /product="mCG8581"
FT                   /note="gene_id=mCG8581.1 transcript_id=mCT7409.0
FT                   protein_id=mCP13660.1"
FT                   /db_xref="GOA:Q542B6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/TrEMBL:Q542B6"
FT                   /protein_id="EDL02125.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAV
FT                   WFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFM
FT                   VFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCS
FT                   TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLC
FT                   ARVYSESYISRQTSETVENDNASSFTM"
FT   gene            87528..89111
FT                   /pseudo
FT                   /locus_tag="mCG_8580"
FT                   /note="gene_id=mCG8580.1"
FT   mRNA            join(87528..88138,88351..89111)
FT                   /pseudo
FT                   /locus_tag="mCG_8580"
FT                   /note="gene_id=mCG8580.1 transcript_id=mCT7408.1 created on
FT                   23-APR-2002"
FT   gene            109735..124525
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /note="gene_id=mCG8579.3"
FT   mRNA            join(109735..109851,110698..110793,120286..120289,
FT                   123401..123497,123690..123822,124004..124508)
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, transcript variant
FT                   mCT168134"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT168134.1 created
FT                   on 14-JAN-2003"
FT   mRNA            join(110628..110793,120286..120504)
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, transcript variant
FT                   mCT178627"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT178627.0 created
FT                   on 14-JAN-2003"
FT   mRNA            join(110651..110793,120286..120289,123401..123497,
FT                   123690..123822,124004..124523)
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, transcript variant
FT                   mCT178380"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT178380.0 created
FT                   on 14-JAN-2003"
FT   mRNA            join(110689..110793,120286..120366,123401..123497,
FT                   123690..123822,124004..124508)
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, transcript variant
FT                   mCT7406"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT7406.2 created on
FT                   14-JAN-2003"
FT   CDS             join(110723..110793,120286..120289,123401..123497,
FT                   123690..123822,124004..124028)
FT                   /codon_start=1
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, isoform CRA_e"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT168134.1
FT                   protein_id=mCP91099.1 isoform=CRA_e"
FT                   /db_xref="GOA:Q3UX28"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="MGI:MGI:1915240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UX28"
FT                   /protein_id="EDL02122.1"
FT                   /translation="MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMK
FT                   KSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMS
FT                   KRPSA"
FT   CDS             join(110723..110793,120286..120289,123401..123497,
FT                   123690..123822,124004..124028)
FT                   /codon_start=1
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, isoform CRA_e"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT178380.0
FT                   protein_id=mCP101302.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q3UX28"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="MGI:MGI:1915240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UX28"
FT                   /protein_id="EDL02123.1"
FT                   /translation="MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMK
FT                   KSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMS
FT                   KRPSA"
FT   CDS             join(110723..110793,120286..120304)
FT                   /codon_start=1
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, isoform CRA_d"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT7406.2
FT                   protein_id=mCP13658.2 isoform=CRA_d"
FT                   /protein_id="EDL02121.1"
FT                   /translation="MAGALVRKAADYVRSKDFRDYLMSTVRKL"
FT   CDS             join(110723..110793,120286..120304)
FT                   /codon_start=1
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, isoform CRA_d"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT178627.0
FT                   protein_id=mCP101548.0 isoform=CRA_d"
FT                   /protein_id="EDL02124.1"
FT                   /translation="MAGALVRKAADYVRSKDFRDYLMSTVRKL"
FT   mRNA            join(111289..111516,115667..115805,123401..123497,
FT                   123690..123822,124004..124508)
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, transcript variant
FT                   mCT168133"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT168133.1 created
FT                   on 14-JAN-2003"
FT   mRNA            join(111289..111516,115667..115805,120286..120289,
FT                   123401..123497,123690..123822,124004..124360)
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, transcript variant
FT                   mCT178626"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT178626.0 created
FT                   on 14-JAN-2003"
FT   CDS             join(111411..111516,115667..115805,120286..120289,
FT                   123401..123497,123690..123822,124004..124028)
FT                   /codon_start=1
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, isoform CRA_c"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT178626.0
FT                   protein_id=mCP101549.0 isoform=CRA_c"
FT                   /protein_id="EDL02120.1"
FT                   /translation="MPLRGLTWGHWVLPSPSSSPGPGLGGSGAGMCRDPVIFLDRMPKA
FT                   SSMKERTGGAAFIRLKCSTGHVAHTCRCHTQDAENSSTHFWGPVANWGLPIAAINDMKK
FT                   SPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSK
FT                   RPSA"
FT   gene            complement(120237..138166)
FT                   /locus_tag="mCG_1050928"
FT                   /note="gene_id=mCG1050928.0"
FT   mRNA            complement(join(120237..120606,120818..120941,
FT                   123895..124109,125346..125503,138130..138166))
FT                   /locus_tag="mCG_1050928"
FT                   /product="mCG1050928"
FT                   /note="gene_id=mCG1050928.0 transcript_id=mCT194717.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(120925..120941,123895..124109,
FT                   125346..125422))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050928"
FT                   /product="mCG1050928"
FT                   /note="gene_id=mCG1050928.0 transcript_id=mCT194717.0
FT                   protein_id=mCP115746.0"
FT                   /protein_id="EDL02116.1"
FT                   /translation="MYRTKLAGISSLRLWGQGSKGLQTWHTTTHADMICGCSSGWSTVS
FT                   FKSWSLYCYADGRLLILEIIGDNFNETQSLPPVPEALHGFRRQVSITRFCNNDLFHA"
FT   mRNA            join(123156..123497,123690..123822,124004..124422)
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, transcript variant
FT                   mCT178381"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT178381.0 created
FT                   on 14-JAN-2003"
FT   mRNA            join(123236..123296,123401..123497,123690..123822,
FT                   124004..124525)
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, transcript variant
FT                   mCT168132"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT168132.0 created
FT                   on 14-JAN-2003"
FT   CDS             join(123291..123296,123401..123497,123690..123822,
FT                   124004..124028)
FT                   /codon_start=1
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, isoform CRA_a"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT168132.0
FT                   protein_id=mCP91102.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z5S0"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="MGI:MGI:1915240"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z5S0"
FT                   /protein_id="EDL02117.1"
FT                   /translation="MRHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMR
FT                   FAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA"
FT   CDS             join(123455..123497,123690..123822,124004..124028)
FT                   /codon_start=1
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, isoform CRA_b"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT168133.1
FT                   protein_id=mCP91097.1 isoform=CRA_b"
FT                   /protein_id="EDL02118.1"
FT                   /translation="MKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNE
FT                   VAQLIQGGRLINYEMSKRPSA"
FT   CDS             join(123455..123497,123690..123822,124004..124028)
FT                   /codon_start=1
FT                   /gene="Brp44l"
FT                   /locus_tag="mCG_8579"
FT                   /product="brain protein 44-like, isoform CRA_b"
FT                   /note="gene_id=mCG8579.3 transcript_id=mCT178381.0
FT                   protein_id=mCP101303.0 isoform=CRA_b"
FT                   /protein_id="EDL02119.1"
FT                   /translation="MKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNE
FT                   VAQLIQGGRLINYEMSKRPSA"
FT   gene            138215..250792
FT                   /locus_tag="mCG_1050367"
FT                   /note="gene_id=mCG1050367.0"
FT   mRNA            join(138215..138398,199942..200050,217070..217144,
FT                   218637..218775,219922..220022,224476..224589,
FT                   239607..239690,240838..240944,244973..245033,
FT                   245786..246012,249666..249780,250173..250327,
FT                   250595..250792)
FT                   /locus_tag="mCG_1050367"
FT                   /product="mCG1050367"
FT                   /note="gene_id=mCG1050367.0 transcript_id=mCT168131.2
FT                   created on 26-APR-2004"
FT   gene            138215..154537
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /note="gene_id=mCG8582.3"
FT   mRNA            join(138215..138398,145955..146041,146530..146612,
FT                   147711..147792,148903..148938,150374..150432,
FT                   151517..151546,154050..154534)
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, transcript variant
FT                   mCT179624"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT179624.0 created
FT                   on 05-FEB-2003"
FT   mRNA            join(138215..138398,144961..144982,145955..146041,
FT                   146530..146612,147711..147792,148903..148938,
FT                   150374..150432,151517..151546,154050..154529)
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, transcript variant
FT                   mCT168126"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT168126.0 created
FT                   on 05-FEB-2003"
FT   mRNA            join(138215..138398,145955..146041,146530..146612,
FT                   147711..147792,148903..150432,151517..151546,
FT                   154050..154529)
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, transcript variant
FT                   mCT7410"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT7410.2 created on
FT                   05-FEB-2003"
FT   mRNA            join(138309..138398,147711..147792,148903..148938,
FT                   150374..150432,151517..151546,154050..154533)
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, transcript variant
FT                   mCT168128"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT168128.0 created
FT                   on 05-FEB-2003"
FT   CDS             join(138336..138398,145955..146041,146530..146612,
FT                   147711..147792,148903..148938,150374..150432,
FT                   151517..151546,154050..154089)
FT                   /codon_start=1
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, isoform CRA_c"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT179624.0
FT                   protein_id=mCP102547.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q5SSN7"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="MGI:MGI:1918689"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SSN7"
FT                   /protein_id="EDL02112.1"
FT                   /translation="MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGI
FT                   FFSFLGTGLLWLPNGMKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIM
FT                   LLCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSSLLG"
FT   CDS             join(138336..138398,145955..146041,146530..146612,
FT                   147711..147792,148903..148998)
FT                   /codon_start=1
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, isoform CRA_d"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT7410.2
FT                   protein_id=mCP13661.2 isoform=CRA_d"
FT                   /db_xref="GOA:A0A4V6"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A4V6"
FT                   /protein_id="EDL02113.1"
FT                   /translation="MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGI
FT                   FFSFLGTGLLWLPNGMKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIM
FT                   LLCLVFTLCAALWVSYISQSGYLLTVPTPPLS"
FT   gene            complement(138619..213848)
FT                   /locus_tag="mCG_1050927"
FT                   /note="gene_id=mCG1050927.0"
FT   mRNA            complement(join(138619..138658,155331..155485,
FT                   207584..208428,213657..213744,213790..213848))
FT                   /locus_tag="mCG_1050927"
FT                   /product="mCG1050927"
FT                   /note="gene_id=mCG1050927.0 transcript_id=mCT194716.0
FT                   created on 27-JAN-2005"
FT   mRNA            join(145840..146041,146530..146612,147711..147792,
FT                   148903..148938,150374..150432,151517..151546,
FT                   154050..154537)
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, transcript variant
FT                   mCT179625"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT179625.0 created
FT                   on 05-FEB-2003"
FT   CDS             join(146560..146612,147711..147792,148903..148938,
FT                   150374..150432,151517..151546,154050..154089)
FT                   /codon_start=1
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, isoform CRA_a"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT168126.0
FT                   protein_id=mCP91101.0 isoform=CRA_a"
FT                   /protein_id="EDL02110.1"
FT                   /translation="MKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIML
FT                   LCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSSLLG"
FT   CDS             join(146560..146612,147711..147792,148903..148938,
FT                   150374..150432,151517..151546,154050..154089)
FT                   /codon_start=1
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, isoform CRA_a"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT179625.0
FT                   protein_id=mCP102546.0 isoform=CRA_a"
FT                   /protein_id="EDL02115.1"
FT                   /translation="MKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIML
FT                   LCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCCSSLLG"
FT   CDS             join(147724..147792,148903..148938,150374..150432,
FT                   151517..151546,154050..154089)
FT                   /codon_start=1
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, isoform CRA_e"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT168128.0
FT                   protein_id=mCP91098.0 isoform=CRA_e"
FT                   /protein_id="EDL02114.1"
FT                   /translation="MGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRKKGLALLF
FT                   CILQFLSMTWYSLSYIPYARDAVLKCCSSLLG"
FT   mRNA            join(150222..150432,151517..151546,154184..154313)
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, transcript variant
FT                   mCT168127"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT168127.0 created
FT                   on 05-FEB-2003"
FT   CDS             join(150355..150432,151517..151546,154184..154240)
FT                   /codon_start=1
FT                   /gene="5630401J11Rik"
FT                   /locus_tag="mCG_8582"
FT                   /product="RIKEN cDNA 5630401J11, isoform CRA_b"
FT                   /note="gene_id=mCG8582.3 transcript_id=mCT168127.0
FT                   protein_id=mCP91106.0 isoform=CRA_b"
FT                   /protein_id="EDL02111.1"
FT                   /translation="MCCLLLVAEEGAGLTLLHIAVLVDDLVQSVLHPVCKAHAMDRCTS
FT                   LHGPPFPAR"
FT   CDS             complement(join(155433..155485,207584..207749))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050927"
FT                   /product="mCG1050927"
FT                   /note="gene_id=mCG1050927.0 transcript_id=mCT194716.0
FT                   protein_id=mCP115745.0"
FT                   /protein_id="EDL02106.1"
FT                   /translation="MRLAGLELTEICLPLPPSDRTKGVSHHCSAPFTFNCFGFWFGLFT
FT                   FLHFNGFFTIGFFFLKIYLFLLYVSTL"
FT   gene            161914..165046
FT                   /locus_tag="mCG_1050366"
FT                   /note="gene_id=mCG1050366.0"
FT   mRNA            161914..165046
FT                   /locus_tag="mCG_1050366"
FT                   /product="mCG1050366"
FT                   /note="gene_id=mCG1050366.0 transcript_id=mCT194372.0
FT                   created on 26-APR-2004"
FT   CDS             161921..162844
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050366"
FT                   /product="mCG1050366"
FT                   /note="gene_id=mCG1050366.0 transcript_id=mCT194372.0
FT                   protein_id=mCP115401.0"
FT                   /protein_id="EDL02109.1"
FT                   /translation="MLRLLGRVMSFLPMPPPPPPPPPPPRTPGGPAARQLSRRPCAPPA
FT                   PSPPAASAAGGEKKRRPPEMLLSSSWPSATLKRPPVRRGPGLGSGTPQPATSARVPPQP
FT                   SPGRGGTSTTCSAPRRVACSHIPAGSTASGTSAGAGAGPDDATRFSLNLTPEAILVIQR
FT                   RHLEKQLLARPRRPFPTPSADPRLPLVPCPRTRASTLRRGGPTSVPNASLAVAVSSRPP
FT                   RASLLPGGLQATLPSPCPSSLRPVLKVSLLNEKHKYDDEEYEEEVEVVDEGLVRKCTEW
FT                   LRGVESAAAARGRTGHLDSLPHLSTL"
FT   gene            complement(<168809..>172577)
FT                   /locus_tag="mCG_1025808"
FT                   /note="gene_id=mCG1025808.1"
FT   mRNA            complement(join(<168809..169924,171452..>172577))
FT                   /locus_tag="mCG_1025808"
FT                   /product="mCG1025808"
FT                   /note="gene_id=mCG1025808.1 transcript_id=mCT143512.1
FT                   created on 27-MAY-2002"
FT   CDS             complement(join(<168809..169924,171452..172577))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1025808"
FT                   /product="mCG1025808"
FT                   /note="gene_id=mCG1025808.1 transcript_id=mCT143512.1
FT                   protein_id=mCP85706.1"
FT                   /protein_id="EDL02108.1"
FT                   /translation="MKATTAVVERYQMASPAGNRPGQQHLPGGNFCGMGNAKVMGYRGL
FT                   HPGSRNLPSLGMGRRIGFPTGSPKRPLNPKSEQRPWDAGDAQTWYVHHGKLHTQRGDLK
FT                   GKARFAAGGELEGKAAVPKAAEPKAAVPKAAVPKAAEPKAAEPRRAEPKAAEPKAAVPK
FT                   AAEPKAAVPKAAVPKAAEPKAAVPKAAVPKAAEPKAAEPRRAEPKAAEPRRAEPKAAEP
FT                   KAAEPKAAEPKAAVPKAAEPKAAVPKAAEPKAAVPKAAEPKAAEPKAAEPRRAEPKAAE
FT                   SKAAVPKAAEPKAPEPRAAEPRAAVPKAAEPKAAVPKAAEPKAAVPKAAEPKAAEPKAA
FT                   EPKAPEPRAAEPRAAEPRAAEPRAATSKPRSCNTQSEPKAAVPKAAEPRRAEPKAAESK
FT                   AAEPKAAEPKAPEPRAPEPRAAEPRAAVPKAAEPKAAVPKAAEPKAAEPKAAVPKAAEP
FT                   KAAEPKAAVPKAAEPKAAVPKAAEPKAAEPRRAEPKAAEPKAAEPRAAEPKAAEPKAAV
FT                   PKAAEPKAAEPKAAESKAAEPKAAEPKAAEPKAAVPKAAEPKAAVPKAAEPKAAEPRRA
FT                   EPKAAESKAAMPKAAEPRAAEPKAAEPKAAMPKAAEPRAAVPKAAEPKAAVPKAAEPRA
FT                   AVPKAAEPKAAVPKAAEPKAAMPKAAEPKAAEPKAAEPKAPEPKAPEPRAATSKPRSCN
FT                   TQCLPSCMLVSYWPNPSLLCSRPSRLKQQYYSVSFMSGACNLFTSFYRGPKLR"
FT   gene            183809..250792
FT                   /locus_tag="mCG_8586"
FT                   /note="gene_id=mCG8586.4"
FT   mRNA            join(183809..183866,199942..200050,217070..217144,
FT                   218637..218775,219922..220022,224476..224589,
FT                   239607..239690,240838..240944,244973..245033,
FT                   245786..246012,249666..249780,250173..250327,
FT                   250595..250792)
FT                   /locus_tag="mCG_8586"
FT                   /product="mCG8586"
FT                   /note="gene_id=mCG8586.4 transcript_id=mCT7397.2 created on
FT                   26-APR-2004"
FT   gene            complement(189673..190011)
FT                   /pseudo
FT                   /locus_tag="mCG_51691"
FT                   /note="gene_id=mCG51691.1"
FT   mRNA            complement(189673..190011)
FT                   /pseudo
FT                   /locus_tag="mCG_51691"
FT                   /note="gene_id=mCG51691.1 transcript_id=mCT51874.1 created
FT                   on 24-APR-2002"
FT   CDS             join(199943..200050,217070..217144,218637..218775,
FT                   219922..220022,224476..224589,239607..239690,
FT                   240838..240944,244973..245033,245786..246012,
FT                   249666..249780,250173..250223)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050367"
FT                   /product="mCG1050367"
FT                   /note="gene_id=mCG1050367.0 transcript_id=mCT168131.2
FT                   protein_id=mCP91104.2"
FT                   /protein_id="EDL02104.1"
FT                   /translation="MAQILRDHFKTPKKHRGCHTQVEDKERAAQQTLPEQSQPEAWSAS
FT                   PPKASTRFPPRSNAYLIIGLQNELTKCGILKNMSDDEDFWKLIQEEALGVGTKEKLQKI
FT                   KLKLMNPRPWPPAASRRRETEMLVSSDQDSGARQGTQDHPGREQEVVEDGPEKERIKQG
FT                   PHQPGLDPPKHRGDTASLLARLTEWRKRCQQHGAAQRLHRGPEESKTMCKTRTDSQSKM
FT                   YLSRLYRMYSTSLANMEFSRKLLERDGRFADMDAEHRARSLLDYMVPRERTQADVPPRE
FT                   RTQADVPPRELEEEDSPTPEQQPQAGPALRFLKCQSPESPQRRPHLKTGRHQVTLCGTS
FT                   KLSEHERGTLAPARRTTDPRPTAPLTLAHVIQTHPVVEAKTASRYWVNNVDEE"
FT   CDS             join(199943..200050,217070..217144,218637..218775,
FT                   219922..220022,224476..224589,239607..239690,
FT                   240838..240944,244973..245033,245786..246012,
FT                   249666..249780,250173..250223)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8586"
FT                   /product="mCG8586"
FT                   /note="gene_id=mCG8586.4 transcript_id=mCT7397.2
FT                   protein_id=mCP13656.2"
FT                   /protein_id="EDL02105.1"
FT                   /translation="MAQILRDHFKTPKKHRGCHTQVEDKERAAQQTLPEQSQPEAWSAS
FT                   PPKASTRFPPRSNAYLIIGLQNELTKCGILKNMSDDEDFWKLIQEEALGVGTKEKLQKI
FT                   KLKLMNPRPWPPAASRRRETEMLVSSDQDSGARQGTQDHPGREQEVVEDGPEKERIKQG
FT                   PHQPGLDPPKHRGDTASLLARLTEWRKRCQQHGAAQRLHRGPEESKTMCKTRTDSQSKM
FT                   YLSRLYRMYSTSLANMEFSRKLLERDGRFADMDAEHRARSLLDYMVPRERTQADVPPRE
FT                   RTQADVPPRELEEEDSPTPEQQPQAGPALRFLKCQSPESPQRRPHLKTGRHQVTLCGTS
FT                   KLSEHERGTLAPARRTTDPRPTAPLTLAHVIQTHPVVEAKTASRYWVNNVDEE"
FT   gene            complement(211658..>212352)
FT                   /locus_tag="mCG_8578"
FT                   /note="gene_id=mCG8578.1"
FT   mRNA            complement(211658..>212352)
FT                   /locus_tag="mCG_8578"
FT                   /product="mCG8578"
FT                   /note="gene_id=mCG8578.1 transcript_id=mCT7405.1 created on
FT                   23-APR-2002"
FT   CDS             complement(211709..>212320)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8578"
FT                   /product="mCG8578"
FT                   /note="gene_id=mCG8578.1 transcript_id=mCT7405.1
FT                   protein_id=mCP13657.1"
FT                   /protein_id="EDL02107.1"
FT                   /translation="AKMGAYKYIQELWRKTVMCFLLRVRCWQYRQLSALHRAPRPTRPD
FT                   KARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEER
FT                   AGRHCGALRVLNSYWVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMREL
FT                   TSAGRKSRGLGKGHKFHHTIGGSHRAAWRRRNTLQFHRYR"
FT   gene            263642..271715
FT                   /gene="T"
FT                   /locus_tag="mCG_19345"
FT                   /note="gene_id=mCG19345.1"
FT   mRNA            join(263642..263955,264410..264674,265330..265464,
FT                   266197..266258,266369..266430,267832..268008,
FT                   269129..269258,270812..271715)
FT                   /gene="T"
FT                   /locus_tag="mCG_19345"
FT                   /product="brachyury, transcript variant mCT175004"
FT                   /note="gene_id=mCG19345.1 transcript_id=mCT175004.0 created
FT                   on 30-OCT-2002"
FT   mRNA            join(263642..263955,264410..264674,265330..265464,
FT                   266197..266258,266369..266430,267835..268008,
FT                   269129..269258,270812..271715)
FT                   /gene="T"
FT                   /locus_tag="mCG_19345"
FT                   /product="brachyury, transcript variant mCT18406"
FT                   /note="gene_id=mCG19345.1 transcript_id=mCT18406.1 created
FT                   on 30-OCT-2002"
FT   CDS             join(263750..263955,264410..264674,265330..265464,
FT                   266197..266258,266369..266430,267832..268008,
FT                   269129..269258,270812..271088)
FT                   /codon_start=1
FT                   /gene="T"
FT                   /locus_tag="mCG_19345"
FT                   /product="brachyury, isoform CRA_c"
FT                   /note="gene_id=mCG19345.1 transcript_id=mCT175004.0
FT                   protein_id=mCP97924.0 isoform=CRA_c"
FT                   /protein_id="EDL02103.1"
FT                   /translation="MSSPGTESAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVG
FT                   LEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVTADNHRWKY
FT                   VNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSL
FT                   HKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKE
FT                   RNDHKDVMEEPGDCQQPGYSQSGGWLVPGAGTLCPPASSHPQFGGSLSLPSTHGCERYP
FT                   ALRNHRSSPYPSPYAHRNSSPTYADNSSACLSMLQSHDNWSSLGVPGHTSMLPVSHNAS
FT                   PPTGSSQYPSLWSVSNGTITPGSQTAGVSNGLGAQFFRGSPAHYTPLTHTVSAATSSSS
FT                   GSPMYEGAATVTDISDSQYDTAQSLLIASWTPVSPPSM"
FT   CDS             join(263750..263955,264410..264674,265330..265464,
FT                   266197..266258,266369..266430,267835..268008,
FT                   269129..269258,270812..271088)
FT                   /codon_start=1
FT                   /gene="T"
FT                   /locus_tag="mCG_19345"
FT                   /product="brachyury, isoform CRA_a"
FT                   /note="gene_id=mCG19345.1 transcript_id=mCT18406.1
FT                   protein_id=mCP10328.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q78ZW9"
FT                   /db_xref="InterPro:IPR001699"
FT                   /db_xref="InterPro:IPR002070"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR018186"
FT                   /db_xref="MGI:MGI:98472"
FT                   /db_xref="UniProtKB/TrEMBL:Q78ZW9"
FT                   /protein_id="EDL02101.1"
FT                   /translation="MSSPGTESAGKSLQYRVDHLLSAVESELQAGSEKGDPTERELRVG
FT                   LEESELWLRFKELTNEMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVTADNHRWKY
FT                   VNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSL
FT                   HKYEPRIHIVRVGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKE
FT                   RNDHKDVMEEPGDCQQPGYSQWGWLVPGAGTLCPPASSHPQFGGSLSLPSTHGCERYPA
FT                   LRNHRSSPYPSPYAHRNSSPTYADNSSACLSMLQSHDNWSSLGVPGHTSMLPVSHNASP
FT                   PTGSSQYPSLWSVSNGTITPGSQTAGVSNGLGAQFFRGSPAHYTPLTHTVSAATSSSSG
FT                   SPMYEGAATVTDISDSQYDTAQSLLIASWTPVSPPSM"
FT   mRNA            join(264377..264674,265330..265464,266197..266258,
FT                   266369..266430,267835..268008,269129..269258,
FT                   270812..271714)
FT                   /gene="T"
FT                   /locus_tag="mCG_19345"
FT                   /product="brachyury, transcript variant mCT175005"
FT                   /note="gene_id=mCG19345.1 transcript_id=mCT175005.0 created
FT                   on 30-OCT-2002"
FT   CDS             join(264414..264674,265330..265464,266197..266258,
FT                   266369..266430,267835..268008,269129..269258,
FT                   270812..271088)
FT                   /codon_start=1
FT                   /gene="T"
FT                   /locus_tag="mCG_19345"
FT                   /product="brachyury, isoform CRA_b"
FT                   /note="gene_id=mCG19345.1 transcript_id=mCT175005.0
FT                   protein_id=mCP97923.0 isoform=CRA_b"
FT                   /protein_id="EDL02102.1"
FT                   /translation="MFPVLKVNVSGLDPNAMYSFLLDFVTADNHRWKYVNGEWVPGGKP
FT                   EPQAPSCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVR
FT                   VGGPQRMITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNDHKDVMEEP
FT                   GDCQQPGYSQWGWLVPGAGTLCPPASSHPQFGGSLSLPSTHGCERYPALRNHRSSPYPS
FT                   PYAHRNSSPTYADNSSACLSMLQSHDNWSSLGVPGHTSMLPVSHNASPPTGSSQYPSLW
FT                   SVSNGTITPGSQTAGVSNGLGAQFFRGSPAHYTPLTHTVSAATSSSSGSPMYEGAATVT
FT                   DISDSQYDTAQSLLIASWTPVSPPSM"
FT   gene            356363..810104
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /note="gene_id=mCG118831.1"
FT   mRNA            join(356363..356677,587292..587423,729754..729882,
FT                   748132..748160,756720..756840,758138..758187,
FT                   768734..768874,770465..770620,771963..772013,
FT                   772529..772587,774389..774440,776943..777085,
FT                   779090..779182,781330..781516,789453..789595,
FT                   790481..790564,792158..792308,795012..795167,
FT                   797121..797293,802316..802427,804729..804809,
FT                   806434..806522,809140..810007)
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /product="phosphodiesterase 10A, transcript variant
FT                   mCT174995"
FT                   /note="gene_id=mCG118831.1 transcript_id=mCT174995.0
FT                   created on 30-OCT-2002"
FT   CDS             join(356581..356677,587292..587423,729754..729882,
FT                   748132..748160,756720..756840,758138..758187,
FT                   768734..768874,770465..770620,771963..772013,
FT                   772529..772587,774389..774440,776943..777085,
FT                   779090..779182,781330..781516,789453..789595,
FT                   790481..790564,792158..792308,795012..795167,
FT                   797121..797293,802316..802427,804729..804809,
FT                   806434..806522,809140..809263)
FT                   /codon_start=1
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /product="phosphodiesterase 10A, isoform CRA_b"
FT                   /note="gene_id=mCG118831.1 transcript_id=mCT174995.0
FT                   protein_id=mCP97914.0 isoform=CRA_b"
FT                   /protein_id="EDL02098.1"
FT                   /translation="MSKKRKALEGGGEPQLPEEEPTAWFGGSSEEPGCLPFALKGGSKG
FT                   PALLALRNRTDSRGQMSNDSTEGTVGSCNATGLTDEKVKAYLSLHPQVLDEFVSESVSA
FT                   ETVEKWLKRKTNKAKDEPSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNHLLLYEL
FT                   SSIIRIATKADGFALYFLGECNNSLCVFIPPGMKEGQPRLIPAGPITQGTTISAYVAKS
FT                   RKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCL
FT                   SHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMI
FT                   YAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPIFKKTKEIRFSIEKGIAGQVA
FT                   RTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFS
FT                   KTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMRFN
FT                   LPARICRDIELFHFDIGPFENMWPGIFVYMIHRSCGTSCFELEKLCRFIMSVKKNYRRV
FT                   PYHNWKHAVTVAHCMYAILQNNNGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHP
FT                   LAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFG
FT                   NRKQLEEMYQTGSLNLHNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAE
FT                   GDEMKKLGIQPIPMMDRDKRDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDN
FT                   LNQWEKVIRGEETAMWISGPGPAPSKSTPEKLNVKVED"
FT   gene            complement(395390..396489)
FT                   /pseudo
FT                   /locus_tag="mCG_19347"
FT                   /note="gene_id=mCG19347.1"
FT   mRNA            complement(395390..396489)
FT                   /pseudo
FT                   /locus_tag="mCG_19347"
FT                   /note="gene_id=mCG19347.1 transcript_id=mCT18408.1 created
FT                   on 30-OCT-2002"
FT   mRNA            join(632338..632791,729754..729882,748132..748160,
FT                   756720..756840,758138..758187,768734..768874,
FT                   770465..770620,771963..772013,772529..772587,
FT                   774389..774440,776943..777085,779090..779182,
FT                   781330..781516,789453..789595,790481..790564,
FT                   792158..792308,795012..795167,797121..797293,
FT                   802316..802427,804729..804809,806434..806522,
FT                   809140..810104)
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /product="phosphodiesterase 10A, transcript variant
FT                   mCT174993"
FT                   /note="gene_id=mCG118831.1 transcript_id=mCT174993.0
FT                   created on 30-OCT-2002"
FT   CDS             join(632725..632791,729754..729882,748132..748160,
FT                   756720..756840,758138..758187,768734..768874,
FT                   770465..770620,771963..772013,772529..772587,
FT                   774389..774440,776943..777085,779090..779182,
FT                   781330..781516,789453..789595,790481..790564,
FT                   792158..792308,795012..795167,797121..797293,
FT                   802316..802427,804729..804809,806434..806522,
FT                   809140..809263)
FT                   /codon_start=1
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /product="phosphodiesterase 10A, isoform CRA_a"
FT                   /note="gene_id=mCG118831.1 transcript_id=mCT174993.0
FT                   protein_id=mCP97913.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8CA95"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:1345143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CA95"
FT                   /protein_id="EDL02097.1"
FT                   /translation="MEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVS
FT                   ESVSAETVEKWLKRKTNKAKDEPSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNHL
FT                   LLYELSSIIRIATKADGFALYFLGECNNSLCVFIPPGMKEGQPRLIPAGPITQGTTISA
FT                   YVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGK
FT                   EAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLL
FT                   EHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPIFKKTKEIRFSIEKGI
FT                   AGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKIS
FT                   GSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQG
FT                   LMRFNLPARICRDIELFHFDIGPFENMWPGIFVYMIHRSCGTSCFELEKLCRFIMSVKK
FT                   NYRRVPYHNWKHAVTVAHCMYAILQNNNGLFTDLERKGLLIACLCHDLDHRGFSNSYLQ
FT                   KFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDL
FT                   ALYFGNRKQLEEMYQTGSLNLHNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYA
FT                   EFWAEGDEMKKLGIQPIPMMDRDKRDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLK
FT                   ACRDNLNQWEKVIRGEETAMWISGPGPAPSKSTPEKLNVKVED"
FT   mRNA            join(680801..681064,729754..729882,748132..748160,
FT                   756720..756840,758138..758187,768734..768874,
FT                   770465..770620,771963..772013,772529..772587,
FT                   774389..774440,776943..777085,779090..779182,
FT                   781330..781516,789453..789595,790481..790564,
FT                   792158..792308,795012..795167,797121..797293,
FT                   802316..802427,804729..804809,806434..806522,
FT                   809140..810007)
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /product="phosphodiesterase 10A, transcript variant
FT                   mCT119992"
FT                   /note="gene_id=mCG118831.1 transcript_id=mCT119992.0
FT                   created on 30-OCT-2002"
FT   CDS             join(681049..681064,729754..729882,748132..748160,
FT                   756720..756840,758138..758187,768734..768874,
FT                   770465..770620,771963..772013,772529..772587,
FT                   774389..774440,776943..777085,779090..779182,
FT                   781330..781516,789453..789595,790481..790564,
FT                   792158..792308,795012..795167,797121..797293,
FT                   802316..802427,804729..804809,806434..806522,
FT                   809140..809263)
FT                   /codon_start=1
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /product="phosphodiesterase 10A, isoform CRA_c"
FT                   /note="gene_id=mCG118831.1 transcript_id=mCT119992.0
FT                   protein_id=mCP85691.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CA95"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:1345143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CA95"
FT                   /protein_id="EDL02099.1"
FT                   /translation="MEKLYGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKTN
FT                   KAKDEPSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNHLLLYELSSIIRIATKADG
FT                   FALYFLGECNNSLCVFIPPGMKEGQPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGD
FT                   ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAW
FT                   ASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCA
FT                   LFQVDHKNKELYSDLFDIGEEKEGKPIFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAY
FT                   ADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAV
FT                   FCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMRFNLPARICRDIELF
FT                   HFDIGPFENMWPGIFVYMIHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVA
FT                   HCMYAILQNNNGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQ
FT                   HHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTG
FT                   SLNLHNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPI
FT                   PMMDRDKRDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLNQWEKVIRGEE
FT                   TAMWISGPGPAPSKSTPEKLNVKVED"
FT   mRNA            join(724184..724342,729754..729882,748132..748160,
FT                   756720..756840,758138..758187,768734..768874,
FT                   770465..770620,771963..772013,772529..772587,
FT                   774389..774440,776943..777085,779090..779182,
FT                   781330..781516,789453..789595,790481..790564,
FT                   792158..792308,795012..795167,797121..797293,
FT                   802316..802427,804729..804809,806434..806522,
FT                   809140..810104)
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /product="phosphodiesterase 10A, transcript variant
FT                   mCT174994"
FT                   /note="gene_id=mCG118831.1 transcript_id=mCT174994.0
FT                   created on 30-OCT-2002"
FT   CDS             join(724273..724342,729754..729882,748132..748160,
FT                   756720..756840,758138..758187,768734..768874,
FT                   770465..770620,771963..772013,772529..772587,
FT                   774389..774440,776943..777085,779090..779182,
FT                   781330..781516,789453..789595,790481..790564,
FT                   792158..792308,795012..795167,797121..797293,
FT                   802316..802427,804729..804809,806434..806522,
FT                   809140..809263)
FT                   /codon_start=1
FT                   /gene="Pde10a"
FT                   /locus_tag="mCG_118831"
FT                   /product="phosphodiesterase 10A, isoform CRA_d"
FT                   /note="gene_id=mCG118831.1 transcript_id=mCT174994.0
FT                   protein_id=mCP97912.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q7TPG2"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:1345143"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TPG2"
FT                   /protein_id="EDL02100.1"
FT                   /translation="MELGGFQQAQLCFGFPSPSATTQGLTDEKVKAYLSLHPQVLDEFV
FT                   SESVSAETVEKWLKRKTNKAKDEPSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNH
FT                   LLLYELSSIIRIATKADGFALYFLGECNNSLCVFIPPGMKEGQPRLIPAGPITQGTTIS
FT                   AYVAKSRKTLLVEDILGDERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWG
FT                   KEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSL
FT                   LEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPIFKKTKEIRFSIEKG
FT                   IAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKI
FT                   SGSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQ
FT                   GLMRFNLPARICRDIELFHFDIGPFENMWPGIFVYMIHRSCGTSCFELEKLCRFIMSVK
FT                   KNYRRVPYHNWKHAVTVAHCMYAILQNNNGLFTDLERKGLLIACLCHDLDHRGFSNSYL
FT                   QKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATD
FT                   LALYFGNRKQLEEMYQTGSLNLHNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIY
FT                   AEFWAEGDEMKKLGIQPIPMMDRDKRDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLL
FT                   KACRDNLNQWEKVIRGEETAMWISGPGPAPSKSTPEKLNVKVED"
FT   gene            815941..836377
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /note="gene_id=mCG7324.3"
FT   mRNA            join(815941..816029,816137..816298,817609..817676,
FT                   819654..820360,821204..821326,822806..822865,
FT                   824591..824715,828740..828798,829382..829557,
FT                   832818..832871,833319..833380,835631..836377)
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /product="RIKEN cDNA 1700010I14, transcript variant
FT                   mCT168125"
FT                   /note="gene_id=mCG7324.3 transcript_id=mCT168125.1 created
FT                   on 06-JAN-2003"
FT   mRNA            join(815941..816029,816137..816298,817609..817676,
FT                   819654..820360,821204..821326,822806..822865,
FT                   824591..824715,828740..828798,829382..829557,
FT                   832818..833039)
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /product="RIKEN cDNA 1700010I14, transcript variant
FT                   mCT178377"
FT                   /note="gene_id=mCG7324.3 transcript_id=mCT178377.0 created
FT                   on 06-JAN-2003"
FT   mRNA            join(815969..816029,819654..820360,821204..821326,
FT                   822806..822865,824591..824715,828740..828798,
FT                   829382..829557,832818..832871,833319..833380,
FT                   835631..836377)
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /product="RIKEN cDNA 1700010I14, transcript variant
FT                   mCT6321"
FT                   /note="gene_id=mCG7324.3 transcript_id=mCT6321.2 created on
FT                   06-JAN-2003"
FT   mRNA            join(815969..816029,819654..820360,821204..821326,
FT                   822806..822865,824591..824715,828740..828798,
FT                   829382..829557,832818..832871,833319..833380,
FT                   835522..835942)
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /product="RIKEN cDNA 1700010I14, transcript variant
FT                   mCT178378"
FT                   /note="gene_id=mCG7324.3 transcript_id=mCT178378.0 created
FT                   on 06-JAN-2003"
FT   CDS             join(816005..816029,819654..820360,821204..821326,
FT                   822806..822865,824591..824715,828740..828798,
FT                   829382..829557,832818..832871,833319..833380,
FT                   835631..835838)
FT                   /codon_start=1
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /product="RIKEN cDNA 1700010I14, isoform CRA_c"
FT                   /note="gene_id=mCG7324.3 transcript_id=mCT6321.2
FT                   protein_id=mCP10320.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q7TPG0"
FT                   /db_xref="MGI:MGI:1914181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TPG0"
FT                   /protein_id="EDL02095.1"
FT                   /translation="MAEDQEPDFYLKWKHCEKPGVKTLSNLRKLLSQLQEDHRKDISVY
FT                   ISGHLNPRKLYKPPETIFQHWRNSNRTWEKPTHSTPTIPPASRNKEVSEMKDAWVHFTV
FT                   STALHPDDTHNTPLFRYLNPRVQASRALKDGASAALQEEEKELKERLAFSREKHMKEEL
FT                   RLPEMKVLRYPEVVSSRQCSRSAPGRDVYRYISPYLAGITKADSYKKFLSFQREVLAKE
FT                   ETLKYDFTGSKVAVAHENRLKEELQKICTCNPQQFNRLQVFGEIFEDICNSSLIFGDLL
FT                   KEIKDEYELYMAALLDSQPTAQYQRLLAEVRGLENSPRPSCDIDQAKEHLRKVQQAYLE
FT                   ALEHNDKLRNELEAESLLLQSAKEKAANGKMKDEKELTLVEKVEKRRCEIFEKLDEIKA
FT                   LEKHIKENMVHSGVFKIAESGLKSIEDEAIKLETSNRILKKKIKVIESQMKQLLLRSKI
FT                   SEEERQRTSGSAMEMLLLIICPTGASVWNVLHPRLVDRCVLQVTPSTLYVYTYTLYAVH
FT                   LLFCNFELDKTGLNI"
FT   CDS             join(816005..816029,819654..820360,821204..821326,
FT                   822806..822865,824591..824715,828740..828798,
FT                   829382..829557,832818..832871,833319..833380,
FT                   835522..835612)
FT                   /codon_start=1
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /product="RIKEN cDNA 1700010I14, isoform CRA_b"
FT                   /note="gene_id=mCG7324.3 transcript_id=mCT178378.0
FT                   protein_id=mCP101300.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TTN6"
FT                   /db_xref="MGI:MGI:1914181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TTN6"
FT                   /protein_id="EDL02094.1"
FT                   /translation="MAEDQEPDFYLKWKHCEKPGVKTLSNLRKLLSQLQEDHRKDISVY
FT                   ISGHLNPRKLYKPPETIFQHWRNSNRTWEKPTHSTPTIPPASRNKEVSEMKDAWVHFTV
FT                   STALHPDDTHNTPLFRYLNPRVQASRALKDGASAALQEEEKELKERLAFSREKHMKEEL
FT                   RLPEMKVLRYPEVVSSRQCSRSAPGRDVYRYISPYLAGITKADSYKKFLSFQREVLAKE
FT                   ETLKYDFTGSKVAVAHENRLKEELQKICTCNPQQFNRLQVFGEIFEDICNSSLIFGDLL
FT                   KEIKDEYELYMAALLDSQPTAQYQRLLAEVRGLENSPRPSCDIDQAKEHLRKVQQAYLE
FT                   ALEHNDKLRNELEAESLLLQSAKEKAANGKMKDEKELTLVEKVEKRRCEIFEKLDEIKA
FT                   LEKHIKENMVHSGVFKIAESGLKSIEDEAIKLETSNRILKKKIKVIESQMKQLLLRSKI
FT                   SEEERQALWDLIREYSDIEDVEDVEGDFEMLRKLT"
FT   CDS             join(819911..820360,821204..821326,822806..822865,
FT                   824591..824715,828740..828798,829382..829557,
FT                   832818..832871,833319..833380,835631..835838)
FT                   /codon_start=1
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /product="RIKEN cDNA 1700010I14, isoform CRA_a"
FT                   /note="gene_id=mCG7324.3 transcript_id=mCT168125.1
FT                   protein_id=mCP91105.0 isoform=CRA_a"
FT                   /protein_id="EDL02093.1"
FT                   /translation="MKDAWVHFTVSTALHPDDTHNTPLFRYLNPRVQASRALKDGASAA
FT                   LQEEEKELKERLAFSREKHMKEELRLPEMKVLRYPEVVSSRQCSRSAPGRDVYRYISPY
FT                   LAGITKADSYKKFLSFQREVLAKEETLKYDFTGSKVAVAHENRLKEELQKICTCNPQQF
FT                   NRLQVFGEIFEDICNSSLIFGDLLKEIKDEYELYMAALLDSQPTAQYQRLLAEVRGLEN
FT                   SPRPSCDIDQAKEHLRKVQQAYLEALEHNDKLRNELEAESLLLQSAKEKAANGKMKDEK
FT                   ELTLVEKVEKRRCEIFEKLDEIKALEKHIKENMVHSGVFKIAESGLKSIEDEAIKLETS
FT                   NRILKKKIKVIESQMKQLLLRSKISEEERQRTSGSAMEMLLLIICPTGASVWNVLHPRL
FT                   VDRCVLQVTPSTLYVYTYTLYAVHLLFCNFELDKTGLNI"
FT   CDS             join(819911..820360,821204..821326,822806..822865,
FT                   824591..824715,828740..828798,829382..829557,
FT                   832818..832976)
FT                   /codon_start=1
FT                   /gene="1700010I14Rik"
FT                   /locus_tag="mCG_7324"
FT                   /product="RIKEN cDNA 1700010I14, isoform CRA_d"
FT                   /note="gene_id=mCG7324.3 transcript_id=mCT178377.0
FT                   protein_id=mCP101299.0 isoform=CRA_d"
FT                   /protein_id="EDL02096.1"
FT                   /translation="MKDAWVHFTVSTALHPDDTHNTPLFRYLNPRVQASRALKDGASAA
FT                   LQEEEKELKERLAFSREKHMKEELRLPEMKVLRYPEVVSSRQCSRSAPGRDVYRYISPY
FT                   LAGITKADSYKKFLSFQREVLAKEETLKYDFTGSKVAVAHENRLKEELQKICTCNPQQF
FT                   NRLQVFGEIFEDICNSSLIFGDLLKEIKDEYELYMAALLDSQPTAQYQRLLAEVRGLEN
FT                   SPRPSCDIDQAKEHLRKVQQAYLEALEHNDKLRNELEAESLLLQSAKEKAANGKMKDEK
FT                   ELTLVEKVEKRRCEIFEKLDEIKALEKHIKENMVHSGVFKIAESGLKSIEDEAIKLETS
FT                   NRILKKKIKVRHFKICNPVFKQVFPKASACLCHQSHRKRMLSP"
FT   gene            933901..934413
FT                   /pseudo
FT                   /locus_tag="mCG_50178"
FT                   /note="gene_id=mCG50178.1"
FT   mRNA            933901..934413
FT                   /pseudo
FT                   /locus_tag="mCG_50178"
FT                   /note="gene_id=mCG50178.1 transcript_id=mCT50361.1 created
FT                   on 23-APR-2002"
FT   gene            complement(978974..>999093)
FT                   /locus_tag="mCG_144943"
FT                   /note="gene_id=mCG144943.0"
FT   mRNA            complement(join(978974..979331,980368..980492,
FT                   998542..>999093))
FT                   /locus_tag="mCG_144943"
FT                   /product="mCG144943"
FT                   /note="gene_id=mCG144943.0 transcript_id=mCT184367.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(998837..>999091)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144943"
FT                   /product="mCG144943"
FT                   /note="gene_id=mCG144943.0 transcript_id=mCT184367.0
FT                   protein_id=mCP105892.0"
FT                   /db_xref="MGI:MGI:1915041"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5I9"
FT                   /protein_id="EDL02092.1"
FT                   /translation="KERPQGSCGSQASEVKDSGLQMQRLRGERDSGLQMQQQHPMSAGE
FT                   RSGWSRTVKFINSARQSSLSPLFTLQVRDIASARYFTLS"
FT   gene            complement(1153113..1154099)
FT                   /pseudo
FT                   /locus_tag="mCG_7328"
FT                   /note="gene_id=mCG7328.2"
FT   mRNA            complement(1153113..1154099)
FT                   /pseudo
FT                   /locus_tag="mCG_7328"
FT                   /note="gene_id=mCG7328.2 transcript_id=mCT6319.2 created on
FT                   23-APR-2002"
FT   gene            complement(1154570..1156532)
FT                   /pseudo
FT                   /locus_tag="mCG_7327"
FT                   /note="gene_id=mCG7327.1"
FT   mRNA            complement(1154570..1156532)
FT                   /pseudo
FT                   /locus_tag="mCG_7327"
FT                   /note="gene_id=mCG7327.1 transcript_id=mCT6318.1 created on
FT                   23-APR-2002"
FT   gene            complement(1501005..1503140)
FT                   /gene="4932702K14Rik"
FT                   /locus_tag="mCG_7325"
FT                   /note="gene_id=mCG7325.2"
FT   mRNA            complement(1501005..1503140)
FT                   /gene="4932702K14Rik"
FT                   /locus_tag="mCG_7325"
FT                   /product="RIKEN cDNA 4932702K14"
FT                   /note="gene_id=mCG7325.2 transcript_id=mCT6316.2 created on
FT                   22-APR-2002"
FT   CDS             complement(1501096..1503024)
FT                   /codon_start=1
FT                   /gene="4932702K14Rik"
FT                   /locus_tag="mCG_7325"
FT                   /product="RIKEN cDNA 4932702K14"
FT                   /note="gene_id=mCG7325.2 transcript_id=mCT6316.2
FT                   protein_id=mCP10294.2"
FT                   /protein_id="EDL02091.1"
FT                   /translation="MNPSDPSYSLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVYRD
FT                   RITRRSLGYASVNFQQLEDAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVK
FT                   NLDRSIDSKTLYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEEAERAIEKMNGMFL
FT                   NDHKVFVGRFKSRRDRQAELGARAKEFTNVYIKNLGEDMDDERLQDLFGRFGPALSVKV
FT                   MTDESGKSKGFGFVSFERHEDARKAVEEMNGKDLNGKQIYVGRAQKKVERQTELKHKFG
FT                   QMKQDKHKIERVPQDRSVRCKGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVTMEGG
FT                   RSKGFGFVCFSSPEEATKAVTEMNGKIVATKPLYVALAQRKEERQAHLSNQYMQRMAST
FT                   SAGPNPVVSPFQPAQGPSGYCMTATPTQSRRAYCAPNQTTQQGPSARGSAHGTRAHPFQ
FT                   NMCSTIHPSHTMPSFSTSGPTTSQAIRHRTASTSTQMMGPHPAAAAAAAAPATRTITQY
FT                   KYTAGVRNPPQHPNTQPHVSTQRSAVPVQGKESLTASMLASAPPQAQKQMLGEWLFSLI
FT                   QAMHPALAGKITGMLLEIDNIELRHMLESPECLHTKVDEAIAVLQAHQAKETSQKAVSS
FT                   VAGVPNA"
FT   gene            complement(1587564..>1614909)
FT                   /locus_tag="mCG_144944"
FT                   /note="gene_id=mCG144944.0"
FT   mRNA            complement(join(1587564..1587727,1608424..1608617,
FT                   1613921..1614128,1614885..>1614909))
FT                   /locus_tag="mCG_144944"
FT                   /product="mCG144944"
FT                   /note="gene_id=mCG144944.0 transcript_id=mCT184368.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1608510..1608617,1613921..>1614079))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144944"
FT                   /product="mCG144944"
FT                   /note="gene_id=mCG144944.0 transcript_id=mCT184368.0
FT                   protein_id=mCP105891.0"
FT                   /protein_id="EDL02090.1"
FT                   /translation="KMDPSRRRQESSGEYGGAKHVTPVQLLPLRVFTHESHIQLPGRRR
FT                   TARPTEQYGYCPCSRPLGSKAVTWHQHWQSKMVHGDAVMIHMI"
FT   gene            1774389..1774835
FT                   /pseudo
FT                   /locus_tag="mCG_146397"
FT                   /note="gene_id=mCG146397.0"
FT   mRNA            1774389..1774835
FT                   /pseudo
FT                   /locus_tag="mCG_146397"
FT                   /note="gene_id=mCG146397.0 transcript_id=mCT186608.0
FT                   created on 21-JUL-2003"
FT   gene            complement(2039154..>2111634)
FT                   /gene="Qk"
FT                   /locus_tag="mCG_2605"
FT                   /note="gene_id=mCG2605.1"
FT   mRNA            complement(join(2039154..2043158,2045122..2045421,
FT                   2046681..2046768,2067721..2067864,2102596..2102712,
FT                   2111488..2111634))
FT                   /gene="Qk"
FT                   /locus_tag="mCG_2605"
FT                   /product="quaking, transcript variant mCT179593"
FT                   /note="gene_id=mCG2605.1 transcript_id=mCT179593.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(2039154..2044436,2045122..2045421,
FT                   2046681..2046768,2067721..2067864,2102596..2102712,
FT                   2111488..>2111634))
FT                   /gene="Qk"
FT                   /locus_tag="mCG_2605"
FT                   /product="quaking, transcript variant mCT2076"
FT                   /note="gene_id=mCG2605.1 transcript_id=mCT2076.1 created on
FT                   05-FEB-2003"
FT   mRNA            complement(join(2039154..2044436,2045122..2045421,
FT                   2046681..2046761,2067717..2067864,2102596..2102712,
FT                   2111488..2111634))
FT                   /gene="Qk"
FT                   /locus_tag="mCG_2605"
FT                   /product="quaking, transcript variant mCT179592"
FT                   /note="gene_id=mCG2605.1 transcript_id=mCT179592.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(2043133..2043158,2045122..2045421,
FT                   2046681..2046768,2067721..2067864,2102596..2102712,
FT                   2111488..2111607))
FT                   /codon_start=1
FT                   /gene="Qk"
FT                   /locus_tag="mCG_2605"
FT                   /product="quaking, isoform CRA_b"
FT                   /note="gene_id=mCG2605.1 transcript_id=mCT179593.0
FT                   protein_id=mCP102514.0 isoform=CRA_b"
FT                   /protein_id="EDL02088.1"
FT                   /translation="MYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVG
FT                   RILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVED
FT                   AQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSL
FT                   AATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPP
FT                   GPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGMAFPTKG"
FT   CDS             complement(join(2044393..2044436,2045122..2045421,
FT                   2046681..2046768,2067721..2067864,2102596..2102712,
FT                   2111488..>2111634))
FT                   /codon_start=1
FT                   /gene="Qk"
FT                   /locus_tag="mCG_2605"
FT                   /product="quaking, isoform CRA_c"
FT                   /note="gene_id=mCG2605.1 transcript_id=mCT2076.1
FT                   protein_id=mCP10308.0 isoform=CRA_c"
FT                   /protein_id="EDL02089.1"
FT                   /translation="TEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVK
FT                   EYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNED
FT                   LHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANI
FT                   KSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTP
FT                   HPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLEWIEMPVMPDISAH"
FT   CDS             complement(join(2044393..2044436,2045122..2045421,
FT                   2046681..2046761,2067717..2067864,2102596..2102712,
FT                   2111488..2111607))
FT                   /codon_start=1
FT                   /gene="Qk"
FT                   /locus_tag="mCG_2605"
FT                   /product="quaking, isoform CRA_a"
FT                   /note="gene_id=mCG2605.1 transcript_id=mCT179592.0
FT                   protein_id=mCP102515.0 isoform=CRA_a"
FT                   /protein_id="EDL02087.1"
FT                   /translation="MYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVG
FT                   RILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVED
FT                   AQNRAEIKLKRAVEEVKKLLVPAVSEDSLKKMQLMELAILNGTYRDANIKSPALAFSLA
FT                   ATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPG
FT                   PEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLEWIEMPVMPDISAH"
FT   gene            <2148861..2150083
FT                   /locus_tag="mCG_1050279"
FT                   /note="gene_id=mCG1050279.0"
FT   mRNA            <2148861..2150083
FT                   /locus_tag="mCG_1050279"
FT                   /product="mCG1050279"
FT                   /note="gene_id=mCG1050279.0 transcript_id=mCT194264.0
FT                   created on 02-APR-2004"
FT   CDS             <2148861..2149196
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050279"
FT                   /product="mCG1050279"
FT                   /note="gene_id=mCG1050279.0 transcript_id=mCT194264.0
FT                   protein_id=mCP115293.0"
FT                   /protein_id="EDL02086.1"
FT                   /translation="GGAGRRWPADGGAGPNRSGAAPTSRGGKPGRRIAWGARWRRTELA
FT                   WAPTPQVSPAVGTPVRFPLEPAPRVTGLALPWAARRPRTVGGDGTRVRTHGRAGGLCSM
FT                   RRDARFR"
FT   gene            <2153543..2158254
FT                   /locus_tag="mCG_144526"
FT                   /note="gene_id=mCG144526.0"
FT   mRNA            join(<2153543..2153732,2153999..2154138,2157867..2158254)
FT                   /locus_tag="mCG_144526"
FT                   /product="mCG144526"
FT                   /note="gene_id=mCG144526.0 transcript_id=mCT183950.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2154008..2154138,2157867..2158242)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144526"
FT                   /product="mCG144526"
FT                   /note="gene_id=mCG144526.0 transcript_id=mCT183950.0
FT                   protein_id=mCP105889.0"
FT                   /protein_id="EDL02085.1"
FT                   /translation="VNERRRLRPPLQIRPLSGEQSGSRSQPLLEVQEVSLPSLQGNRRS
FT                   LICPQKSTLYQQADPWHLPLQLPLCSHMSPPRLPSSNVTWPAKRIYHWSQSSPHWSTNV
FT                   EQIGFRIIRFLHQEGQAINRHLGHDSVCCNCNPEPEGACRELPSLAPFLHKRFTVTLLQ
FT                   CLHNK"
FT   gene            2179764..2181348
FT                   /locus_tag="mCG_147020"
FT                   /note="gene_id=mCG147020.0"
FT   mRNA            2179764..2181348
FT                   /locus_tag="mCG_147020"
FT                   /product="mCG147020"
FT                   /note="gene_id=mCG147020.0 transcript_id=mCT187283.0
FT                   created on 13-JAN-2004"
FT   CDS             2180370..2180531
FT                   /codon_start=1
FT                   /locus_tag="mCG_147020"
FT                   /product="mCG147020"
FT                   /note="gene_id=mCG147020.0 transcript_id=mCT187283.0
FT                   protein_id=mCP109420.0"
FT                   /protein_id="EDL02084.1"
FT                   /translation="MLCMCLHVCCSGAHMPQFTDGSQRTRLRASLCFLPSLRPPDVQCH
FT                   IYQAIWSM"
FT   gene            complement(2224951..2663868)
FT                   /gene="Pacrg"
FT                   /locus_tag="mCG_2606"
FT                   /note="gene_id=mCG2606.2"
FT   mRNA            complement(join(2224951..2225417,2399850..2399999,
FT                   2420489..2420660,2454348..2454509))
FT                   /gene="Pacrg"
FT                   /locus_tag="mCG_2606"
FT                   /product="Park2 co-regulated, transcript variant mCT2078"
FT                   /note="gene_id=mCG2606.2 transcript_id=mCT2078.2 created on
FT                   22-APR-2002"
FT   mRNA            complement(join(2225082..2225417,2399850..2399999,
FT                   2420489..2420660,2600568..2600702,2663441..2663868))
FT                   /gene="Pacrg"
FT                   /locus_tag="mCG_2606"
FT                   /product="Park2 co-regulated, transcript variant mCT2077"
FT                   /note="gene_id=mCG2606.2 transcript_id=mCT2077.2 created on
FT                   22-APR-2002"
FT   CDS             complement(join(2225257..2225417,2399850..2399999,
FT                   2420489..2420660,2600568..2600702,2663441..2663548))
FT                   /codon_start=1
FT                   /gene="Pacrg"
FT                   /locus_tag="mCG_2606"
FT                   /product="Park2 co-regulated, isoform CRA_a"
FT                   /note="gene_id=mCG2606.2 transcript_id=mCT2077.2
FT                   protein_id=mCP10312.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VB91"
FT                   /db_xref="InterPro:IPR019399"
FT                   /db_xref="MGI:MGI:1916560"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VB91"
FT                   /protein_id="EDL02079.1"
FT                   /translation="MPKRTKLLPQQTFQVHQPRSLVSEGFTVKAMMKNSVVRGPPVAGA
FT                   FKERPAKPTTFRKCYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLSEMT
FT                   FPYEFFARRGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQIICVTLKVLQHLVVSS
FT                   EMVGEALLPYYRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGE
FT                   DAFINIKYMVPTYESCLLN"
FT   CDS             complement(join(2225257..2225417,2399850..2399999,
FT                   2420489..2420597))
FT                   /codon_start=1
FT                   /gene="Pacrg"
FT                   /locus_tag="mCG_2606"
FT                   /product="Park2 co-regulated, isoform CRA_b"
FT                   /note="gene_id=mCG2606.2 transcript_id=mCT2078.2
FT                   protein_id=mCP10316.2 isoform=CRA_b"
FT                   /protein_id="EDL02080.1"
FT                   /translation="MTFPYEFFARRGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQ
FT                   IICVTLKVLQHLVVSSEMVGEALLPYYRQILPILNIFKNMNVNSGDGIDYSQQKRENIG
FT                   DLIQETLEAFERYGGEDAFINIKYMVPTYESCLLN"
FT   gene            2264316..2265912
FT                   /locus_tag="mCG_147023"
FT                   /note="gene_id=mCG147023.0"
FT   mRNA            2264316..2265912
FT                   /locus_tag="mCG_147023"
FT                   /product="mCG147023"
FT                   /note="gene_id=mCG147023.0 transcript_id=mCT187286.0
FT                   created on 13-JAN-2004"
FT   CDS             2264914..2265243
FT                   /codon_start=1
FT                   /locus_tag="mCG_147023"
FT                   /product="mCG147023"
FT                   /note="gene_id=mCG147023.0 transcript_id=mCT187286.0
FT                   protein_id=mCP109422.0"
FT                   /protein_id="EDL02083.1"
FT                   /translation="MLVLPEDPTIPLLGIHPDVPTGKKDTCSTMFIAALFIIARSWKEP
FT                   RCPSTEEWIQKMWYIYTMEYYSAIKKNEFMKFLGKWLDLEGIILREVTQSQKNSNDMYS
FT                   LISGY"
FT   gene            <2278140..2296262
FT                   /locus_tag="mCG_144945"
FT                   /note="gene_id=mCG144945.1"
FT   mRNA            join(<2278140..2278269,2295246..2296262)
FT                   /locus_tag="mCG_144945"
FT                   /product="mCG144945, transcript variant mCT189471"
FT                   /note="gene_id=mCG144945.1 transcript_id=mCT189471.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<2278148..2278269,2293591..2293713,2295246..2295898)
FT                   /locus_tag="mCG_144945"
FT                   /product="mCG144945, transcript variant mCT184369"
FT                   /note="gene_id=mCG144945.1 transcript_id=mCT184369.0
FT                   created on 05-JUN-2003"
FT   CDS             <2295255..2295623
FT                   /codon_start=1
FT                   /locus_tag="mCG_144945"
FT                   /product="mCG144945, isoform CRA_a"
FT                   /note="gene_id=mCG144945.1 transcript_id=mCT184369.0
FT                   protein_id=mCP105893.0 isoform=CRA_a"
FT                   /protein_id="EDL02081.1"
FT                   /translation="KVCIPPQVYSTKAGQIPHHVCMLCSSGSVCCLSDCSGIFNEILKL
FT                   HGRLSCDTNDLSEHGCRDGGPMGNICQQLSDSGLAAEPRSSNRHVGWMPEETSLRDMAH
FT                   FSWNGLLISTSHLSPANC"
FT   CDS             <2295255..2295623
FT                   /codon_start=1
FT                   /locus_tag="mCG_144945"
FT                   /product="mCG144945, isoform CRA_a"
FT                   /note="gene_id=mCG144945.1 transcript_id=mCT189471.0
FT                   protein_id=mCP110461.0 isoform=CRA_a"
FT                   /protein_id="EDL02082.1"
FT                   /translation="KVCIPPQVYSTKAGQIPHHVCMLCSSGSVCCLSDCSGIFNEILKL
FT                   HGRLSCDTNDLSEHGCRDGGPMGNICQQLSDSGLAAEPRSSNRHVGWMPEETSLRDMAH
FT                   FSWNGLLISTSHLSPANC"
FT   gene            2722777..2723385
FT                   /pseudo
FT                   /locus_tag="mCG_51750"
FT                   /note="gene_id=mCG51750.1"
FT   mRNA            2722777..2723385
FT                   /pseudo
FT                   /locus_tag="mCG_51750"
FT                   /note="gene_id=mCG51750.1 transcript_id=mCT51933.1 created
FT                   on 22-APR-2002"
FT   gene            <2887300..>3874515
FT                   /gene="Park2"
FT                   /locus_tag="mCG_7574"
FT                   /note="gene_id=mCG7574.2"
FT   mRNA            join(<2887300..2887464,3057510..3057750,3126416..3126537,
FT                   3257324..3257407,3319764..3319879,3455842..3455978,
FT                   3658344..3658405,3674678..3674827,3825638..3825721,
FT                   3863555..3863672,3874436..>3874515)
FT                   /gene="Park2"
FT                   /locus_tag="mCG_7574"
FT                   /product="parkin"
FT                   /note="gene_id=mCG7574.2 transcript_id=mCT6480.2 created on
FT                   03-MAY-2002"
FT   CDS             join(<2887300..2887464,3057510..3057750,3126416..3126537,
FT                   3257324..3257407,3319764..3319879,3455842..3455978,
FT                   3658344..3658405,3674678..3674827,3825638..3825721,
FT                   3863555..3863672,3874436..>3874515)
FT                   /codon_start=1
FT                   /gene="Park2"
FT                   /locus_tag="mCG_7574"
FT                   /product="parkin"
FT                   /note="gene_id=mCG7574.2 transcript_id=mCT6480.2
FT                   protein_id=mCP10303.2"
FT                   /protein_id="EDL02077.1"
FT                   /translation="VFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAG
FT                   KELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVD
FT                   LSSHTLPVDSVGLAVILDTDSKRDSEAARGPAVKPTYNSFFIYCKGPCHKVQPGKLRVQ
FT                   CGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSV
FT                   ALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQL
FT                   GYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLL
FT                   PEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQA
FT                   RWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNR"
FT   gene            complement(2902420..>2909642)
FT                   /locus_tag="mCG_144527"
FT                   /note="gene_id=mCG144527.0"
FT   mRNA            complement(join(2902420..2902603,2904234..2904488,
FT                   2908138..2908228,2909492..>2909642))
FT                   /locus_tag="mCG_144527"
FT                   /product="mCG144527"
FT                   /note="gene_id=mCG144527.0 transcript_id=mCT183951.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(2904420..2904488,2908138..2908228,
FT                   2909492..>2909640))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144527"
FT                   /product="mCG144527"
FT                   /note="gene_id=mCG144527.0 transcript_id=mCT183951.0
FT                   protein_id=mCP105890.0"
FT                   /protein_id="EDL02078.1"
FT                   /translation="ISPFLSQSQSRFPVHSKESHHSTAPGQRCYFHGLLFNEWIKLKII
FT                   VLPLRPNRPSPEKALPHRRTAGAERSRLLLRGAREKKSNSYGSMKSYDLSQIKMLQR"
FT   gene            3931318..4036051
FT                   /gene="Agpat4"
FT                   /locus_tag="mCG_16693"
FT                   /note="gene_id=mCG16693.1"
FT   mRNA            join(3931318..3931450,3966615..3966872,4015392..4015561,
FT                   4026821..4026982,4027249..4027402,4030056..4030158,
FT                   4031878..4031953,4033298..4033496,4035408..4036051)
FT                   /gene="Agpat4"
FT                   /locus_tag="mCG_16693"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 1
FT                   (lysophosphatidic acid acyltransferase, delta), transcript
FT                   variant mCT12553"
FT                   /note="gene_id=mCG16693.1 transcript_id=mCT12553.1 created
FT                   on 19-APR-2002"
FT   mRNA            join(3946270..3946352,3966615..3966872,4015392..4015561,
FT                   4026821..4026982,4027249..4027402,4030056..4030158,
FT                   4031878..4031953,4033298..4033496,4035408..4036050)
FT                   /gene="Agpat4"
FT                   /locus_tag="mCG_16693"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 1
FT                   (lysophosphatidic acid acyltransferase, delta), transcript
FT                   variant mCT167990"
FT                   /note="gene_id=mCG16693.1 transcript_id=mCT167990.0 created
FT                   on 19-APR-2002"
FT   CDS             join(3966695..3966872,4015392..4015561,4026821..4026982,
FT                   4027249..4027402,4030056..4030158,4031878..4031953,
FT                   4033298..4033496,4035408..4035502)
FT                   /codon_start=1
FT                   /gene="Agpat4"
FT                   /locus_tag="mCG_16693"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 1
FT                   (lysophosphatidic acid acyltransferase, delta), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16693.1 transcript_id=mCT12553.1
FT                   protein_id=mCP10298.1 isoform=CRA_a"
FT                   /protein_id="EDL02075.1"
FT                   /translation="MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQL
FT                   FRKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKACPHYGKENAIVVLNHKFEIDFLC
FT                   GWSLAERLGILGNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLR
FT                   DYPEKYLFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVV
FT                   PAVYDCTLNFRNNENPTLLGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEK
FT                   DAFQEEYYRTGVFPETPWVPPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLAS
FT                   LVLIFCMASMGVRWMIGVTEIDKGSAYGNIDNKRKRTD"
FT   CDS             join(3966695..3966872,4015392..4015561,4026821..4026982,
FT                   4027249..4027402,4030056..4030158,4031878..4031953,
FT                   4033298..4033496,4035408..4035502)
FT                   /codon_start=1
FT                   /gene="Agpat4"
FT                   /locus_tag="mCG_16693"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase 1
FT                   (lysophosphatidic acid acyltransferase, delta), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16693.1 transcript_id=mCT167990.0
FT                   protein_id=mCP90947.0 isoform=CRA_a"
FT                   /protein_id="EDL02076.1"
FT                   /translation="MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQL
FT                   FRKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKACPHYGKENAIVVLNHKFEIDFLC
FT                   GWSLAERLGILGNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLR
FT                   DYPEKYLFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVV
FT                   PAVYDCTLNFRNNENPTLLGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEK
FT                   DAFQEEYYRTGVFPETPWVPPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLAS
FT                   LVLIFCMASMGVRWMIGVTEIDKGSAYGNIDNKRKRTD"
FT   gene            complement(4044754..4130696)
FT                   /locus_tag="mCG_16678"
FT                   /note="gene_id=mCG16678.1"
FT   mRNA            complement(join(4044754..4045251,4046647..4046826,
FT                   4049552..4049658,4050056..4050178,4052507..4052666,
FT                   4053355..4053471,4054437..4054507,4055495..4055686,
FT                   4056833..4056913,4057424..4057524,4060943..4061039,
FT                   4064028..4064094,4064778..4064856,4065629..4065762,
FT                   4066227..4066388,4070866..4071015,4071781..4072047,
FT                   4073376..4073459,4073547..4073646,4074723..4074839,
FT                   4077261..4077418,4078054..4078200,4080710..4080952,
FT                   4096251..4097610,4130445..4130696))
FT                   /locus_tag="mCG_16678"
FT                   /product="mCG16678"
FT                   /note="gene_id=mCG16678.1 transcript_id=mCT13056.1 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4045231..4045251,4046647..4046826,
FT                   4049552..4049658,4050056..4050178,4052507..4052666,
FT                   4053355..4053471,4054437..4054507,4055495..4055686,
FT                   4056833..4056913,4057424..4057524,4060943..4061039,
FT                   4064028..4064094,4064778..4064856,4065629..4065762,
FT                   4066227..4066388,4070866..4071015,4071781..4072047,
FT                   4073376..4073459,4073547..4073646,4074723..4074839,
FT                   4077261..4077418,4078054..4078200,4080710..4080952,
FT                   4096251..4097603))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16678"
FT                   /product="mCG16678"
FT                   /note="gene_id=mCG16678.1 transcript_id=mCT13056.1
FT                   protein_id=mCP10324.2"
FT                   /protein_id="EDL02074.1"
FT                   /translation="MNTPSQSPHKDLGKGVETVEEYSYKQEKKIRATLRTTERDHKKNA
FT                   QCSFMLDSVAGSLPKKSIPDVDLNKPYLSLGCSNAKLPVSMPMPIARTARQTSRTDCPA
FT                   DRLKFFETLRLLLKLTSVSKKKDREQRGQENTAAFWFNRSNELIWLELQAWHAGRTIND
FT                   QDLFLYTARQAIPDIINEILTFKVNYGSIAFSSNGAGFNGPLVEGQCRTPQETNRVGCS
FT                   SYHEHLQRQRVSFEQVKRIMELLEYMEALYPSLQALQKDYERYAAKDFEDRVQALCLWL
FT                   NITKDLNQKLRIMGTVLGIKNLSDIGWPVFEIPSPRPSKGYEPEDEVEDTEVELRELES
FT                   GTEESDEEPTPSPRVPELRLSTDAILDSRSQGCVSRKLERLESEEDSIGWGTADCGPEA
FT                   SRHCLTSIYRPFVDKALKQMGLRKLILRLHKLMNGSLQRARVALVKDDRPVEFSDFPGP
FT                   MWGSDYVQLSGTPPSSEQKCSAVSWEELRAMDLPSFEPAFLVLCRVLLNVIHECLKLRL
FT                   EQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYYQFMLQEVLGGLEKTDCNMDAFEEDL
FT                   QKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCD
FT                   IAGMLLKSTGSFLESGLQESCAELWTSADDNGAADELRRSVIEISRALKELFHEARERA
FT                   SKALGFAKMLRKDLEIAAEFVLSASARELLDALKAKQYVKVQIPGLENLHVFVPDSLAE
FT                   EKKIILQLLNAATGKDCSKDPDDVFMDAFLLLTKHGDRARDSEDGWGTWEARAVKIVPQ
FT                   VETVDTLRSMQVDNLLLVVMESAHLVLQRKAFQQSIEGLMTVRHEQTSSQPIIAKGLQQ
FT                   LKNDALELCNRISDAIDRVDHMFTLEFDAEVEESESATLQQYYREAMIQGYNFGFEYHK
FT                   EVVRLMSGEFRQKIGDKYISFAQKWMNYVLTKCESGRGTRPRWATQGFDFLQAIEPAFI
FT                   SALPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRNSPRPVKVPRCHSDPPNPHLIIPT
FT                   PEGFRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRSDSSGSTRRSWELRT
FT                   LISQTKDSASKQGPIEAIQKSVRLFEERRYREMRRKNIIGQVCDTPKSYDNVMHVGLRK
FT                   VTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGI
FT                   KHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYTKQITVAINVLHE
FT                   HGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVIT
FT                   RAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEG
FT                   KAFLSHCLESDPKIRWTASQLLDHAFVKVCTDEE"
FT   gene            4130832..4139198
FT                   /locus_tag="mCG_147022"
FT                   /note="gene_id=mCG147022.0"
FT   mRNA            join(4130832..4131120,4136344..4139198)
FT                   /locus_tag="mCG_147022"
FT                   /product="mCG147022"
FT                   /note="gene_id=mCG147022.0 transcript_id=mCT187285.0
FT                   created on 13-JAN-2004"
FT   CDS             4137358..4137639
FT                   /codon_start=1
FT                   /locus_tag="mCG_147022"
FT                   /product="mCG147022"
FT                   /note="gene_id=mCG147022.0 transcript_id=mCT187285.0
FT                   protein_id=mCP109421.0"
FT                   /protein_id="EDL02073.1"
FT                   /translation="MLPHPSACIGSCPVSGDGCVYYVQPLTCLPWVHMQFTRTVQPKCH
FT                   NLGWLKSIDIHSFTVLKARRIKIKIGEGWLPSGGMLEHVLSSHPSPAF"
FT   gene            4168752..4169777
FT                   /pseudo
FT                   /locus_tag="mCG_50089"
FT                   /note="gene_id=mCG50089.2"
FT   mRNA            4168752..4169777
FT                   /pseudo
FT                   /locus_tag="mCG_50089"
FT                   /note="gene_id=mCG50089.2 transcript_id=mCT50272.2 created
FT                   on 19-APR-2002"
FT   gene            4192724..4233544
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /note="gene_id=mCG16690.2"
FT   mRNA            join(4192724..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4210693..4210835,
FT                   4212240..4212402,4217202..4217383,4218164..4218312,
FT                   4219323..4219340,4233272..4233516)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167988"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167988.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192728..4192831,4196202..4196337,4198531..4198539,
FT                   4210753..4210835,4212240..4212402,4217202..4217306,
FT                   4223234..4223271,4225047..4225095,4228369..4228443,
FT                   4232796..4232871)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167987"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167987.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192728..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4210693..4210835,
FT                   4212240..4212402,4217202..4217303,4223233..4223271,
FT                   4225047..4225095,4228373..4228443)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167985"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167985.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192728..4192819,4223168..4223271,4225047..4225124,
FT                   4225622..4225675)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167981"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167981.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192728..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4219312..4219416,
FT                   4223148..4223213)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167979"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167979.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192739..4192831,4196208..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207339,4233423..4233544)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167989"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167989.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192742..4192831,4196202..4196257,4228419..4228443,
FT                   4232796..4232941,4233125..4233364)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167982"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167982.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192753..4192831,4196202..4196346,4204364..4204491,
FT                   4205885..4206005,4207217..4207335,4209762..4209924,
FT                   4210693..4210835,4212240..4212402,4217202..4217383,
FT                   4218164..4218312,4219323..4219416,4223148..4223271,
FT                   4225047..4225124,4225622..4225762,4228337..4228443,
FT                   4232796..4232941,4233125..4233543)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167980"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167980.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192753..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4210693..4210835,
FT                   4212240..4212329,4232884..4232941,4233125..4233534)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167983"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167983.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192758..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4210693..4210835,
FT                   4212240..4212402,4217202..4217383,4218164..4218312,
FT                   4219323..4219416,4223148..4223271,4225047..4225124,
FT                   4225622..4225762,4228337..4228443,4232796..4232941,
FT                   4233125..4233543)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT12549"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT12549.1 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192761..4192831,4196202..4196337,4198531..4198539,
FT                   4204352..4204491,4205885..4206005,4207217..4207335,
FT                   4209762..4209924,4210693..4210835,4212240..4212402,
FT                   4217202..4217383,4218164..4218312,4219323..4219416,
FT                   4223148..4223271,4225047..4225124,4225622..4225762,
FT                   4228337..4228443,4232796..4232941,4233125..4233543)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167984"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167984.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4192776..4192831,4196202..4196337,4198531..4198539,
FT                   4210762..4210835,4212240..4212402,4217202..4217383,
FT                   4218164..4218312,4219323..4219416,4223148..4223271,
FT                   4225047..4225124,4225622..4225762,4228337..4228443,
FT                   4232796..4232941,4233125..4233543)
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, transcript variant mCT167986"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167986.0 created
FT                   on 19-APR-2002"
FT   CDS             join(4192783..4192831,4196208..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207339,4233423..4233510)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_h"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167989.0
FT                   protein_id=mCP90952.0 isoform=CRA_h"
FT                   /protein_id="EDL02068.1"
FT                   /translation="MDHKEVILLFLLLLKPGDSLDGYISTQGASLFSLTKKQLAAGGVA
FT                   DCLAKCEGETDFVCRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTG
FT                   IGNSYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPWCY
FT                   TTDPDKRYDYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKF
FT                   PSKNLKMNYCRNPDGEPRPWCFTTDPTKRWEYCDIPRCSNPSPFFVLLWVKFSCLWTSG
FT                   FCDNRPSLL"
FT   CDS             join(4192783..4192831,4196202..4196346,4204364..4204491,
FT                   4205885..4206005,4207217..4207335,4209762..4209924,
FT                   4210693..4210835,4212240..4212402,4217202..4217383,
FT                   4218164..4218312,4219323..4219416,4223148..4223271,
FT                   4225047..4225124,4225622..4225762,4228337..4228443,
FT                   4232796..4232941,4233125..4233286)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_i"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167980.0
FT                   protein_id=mCP90934.0 isoform=CRA_i"
FT                   /protein_id="EDL02069.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRYHGTHPNEGLEENYCRNPDNDEQGPWCYTTDPDKRYDYCNIP
FT                   ECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNLKMNYCRNPD
FT                   GEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGENYRGTVSVTVSGKTCQ
FT                   RWSEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCESSA
FT                   SPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQSWAAMFPHRHSKTPEN
FT                   FPDAGLEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRCSETGGSVVELPTVSQEPSGP
FT                   SDSETDCMYGNGKDYRGKTAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAGLEKNYCRN
FT                   PDGDVNGPWCYTTNPRKLYDYCDIPLCASASSFECGKPQVEPKKCPGRVVGGCVANPHS
FT                   WPWQISLRTRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFYKVILGAHEEYIRGSDV
FT                   QEISVAKLILEPNNRDIALLKLSRPATITDKVIPACLPSPNYMVADRTICYITGWGETQ
FT                   GTFGAGRLKEAQLPVIENKVCNRVEYLNNRVKSTELCAGQLAGGVDSCQGDSGGPLVCF
FT                   EKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVDWIEREMRNN"
FT   CDS             join(4192783..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4210693..4210835,
FT                   4212240..4212402,4217202..4217383,4218164..4218312,
FT                   4219323..4219416,4223148..4223271,4225047..4225124,
FT                   4225622..4225762,4228337..4228443,4232796..4232941,
FT                   4233125..4233286)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_a"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT12549.1
FT                   protein_id=mCP10314.2 isoform=CRA_a"
FT                   /protein_id="EDL02061.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECK
FT                   TGIGNSYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPW
FT                   CYTTDPDKRYDYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPA
FT                   KFPSKNLKMNYCRNPDGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGE
FT                   NYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDS
FT                   QLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQ
FT                   SWAAMFPHRHSKTPENFPDAGLEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRCSETG
FT                   GSVVELPTVSQEPSGPSDSETDCMYGNGKDYRGKTAVTAAGTPCQGWAAQEPHRHSIFT
FT                   PQTNPRAGLEKNYCRNPDGDVNGPWCYTTNPRKLYDYCDIPLCASASSFECGKPQVEPK
FT                   KCPGRVVGGCVANPHSWPWQISLRTRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFY
FT                   KVILGAHEEYIRGSDVQEISVAKLILEPNNRDIALLKLSRPATITDKVIPACLPSPNYM
FT                   VADRTICYITGWGETQGTFGAGRLKEAQLPVIENKVCNRVEYLNNRVKSTELCAGQLAG
FT                   GVDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVDWIEREMRNN
FT                   "
FT   CDS             join(4192783..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4210693..4210835,
FT                   4212240..4212402,4217202..4217383,4218164..4218312,
FT                   4219323..4219340,4233272..4233286)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_g"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167988.0
FT                   protein_id=mCP90941.0 isoform=CRA_g"
FT                   /protein_id="EDL02067.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECK
FT                   TGIGNSYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPW
FT                   CYTTDPDKRYDYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPA
FT                   KFPSKNLKMNYCRNPDGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGE
FT                   NYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDS
FT                   QLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQ
FT                   SWAAMFPHRHSKTPENFPDAGLEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRCSETG
FT                   GSVVELPTVSQEPSGPSDSETDCMYGNGKDYRGKTAVTAAGTPCQGWAAQEPHRHSIFT
FT                   PQTNPRAGLEKNYCRNPDMRNN"
FT   CDS             join(4192783..4192831,4196202..4196337,4198531..4198539,
FT                   4204352..4204491,4205885..4206005,4207217..4207335,
FT                   4209762..4209924,4210693..4210835,4212240..4212402,
FT                   4217202..4217383,4218164..4218312,4219323..4219416,
FT                   4223148..4223271,4225047..4225124,4225622..4225762,
FT                   4228337..4228443,4232796..4232941,4233125..4233286)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_e"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167984.0
FT                   protein_id=mCP90944.0 isoform=CRA_e"
FT                   /protein_id="EDL02065.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRSFHYSPSTHPNEGLEENYCRNPDNDEQGPWCYTTDPDKRYDY
FT                   CNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNLKMNYC
FT                   RNPDGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGENYRGTVSVTVSG
FT                   KTCQRWSEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSC
FT                   ESSASPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQSWAAMFPHRHSK
FT                   TPENFPDAGLEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRCSETGGSVVELPTVSQE
FT                   PSGPSDSETDCMYGNGKDYRGKTAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAGLEKN
FT                   YCRNPDGDVNGPWCYTTNPRKLYDYCDIPLCASASSFECGKPQVEPKKCPGRVVGGCVA
FT                   NPHSWPWQISLRTRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFYKVILGAHEEYIR
FT                   GSDVQEISVAKLILEPNNRDIALLKLSRPATITDKVIPACLPSPNYMVADRTICYITGW
FT                   GETQGTFGAGRLKEAQLPVIENKVCNRVEYLNNRVKSTELCAGQLAGGVDSCQGDSGGP
FT                   LVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVDWIEREMRNN"
FT   CDS             join(4192783..4192831,4196202..4196337,4198531..4198539,
FT                   4210762..4210835,4212240..4212402,4217202..4217383,
FT                   4218164..4218312,4219323..4219416,4223148..4223271,
FT                   4225047..4225124,4225622..4225762,4228337..4228443,
FT                   4232796..4232941,4233125..4233286)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_f"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167986.0
FT                   protein_id=mCP90946.0 isoform=CRA_f"
FT                   /protein_id="EDL02066.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRSFHQLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECYQ
FT                   SDGQSYRGTSSTTITGKKCQSWAAMFPHRHSKTPENFPDAGLEMNYCRNPDGDKGPWCY
FT                   TTDPSVRWEYCNLKRCSETGGSVVELPTVSQEPSGPSDSETDCMYGNGKDYRGKTAVTA
FT                   AGTPCQGWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDGDVNGPWCYTTNPRKLYDYCD
FT                   IPLCASASSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLRTRFTGQHFCGGTLIA
FT                   PEWVLTAAHCLEKSSRPEFYKVILGAHEEYIRGSDVQEISVAKLILEPNNRDIALLKLS
FT                   RPATITDKVIPACLPSPNYMVADRTICYITGWGETQGTFGAGRLKEAQLPVIENKVCNR
FT                   VEYLNNRVKSTELCAGQLAGGVDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKP
FT                   GVYVRVSRFVDWIEREMRNN"
FT   CDS             join(4192783..4192831,4196202..4196257,4228419..4228443,
FT                   4232796..4232941,4233125..4233286)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_j"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167982.0
FT                   protein_id=mCP90958.0 isoform=CRA_j"
FT                   /protein_id="EDL02070.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSITGWGETQGT
FT                   FGAGRLKEAQLPVIENKVCNRVEYLNNRVKSTELCAGQLAGGVDSCQGDSGGPLVCFEK
FT                   DKYILQGVTSWGLGCARPNKPGVYVRVSRFVDWIEREMRNN"
FT   CDS             join(4192783..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4210693..4210835,
FT                   4212240..4212329,4232884..4232941,4233125..4233275)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_d"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167983.0
FT                   protein_id=mCP90931.0 isoform=CRA_d"
FT                   /protein_id="EDL02064.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECK
FT                   TGIGNSYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPW
FT                   CYTTDPDKRYDYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPA
FT                   KFPSKNLKMNYCRNPDGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGE
FT                   NYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDS
FT                   QLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITESNPR
FT                   SSVPGNWLVASTAARATVEDLWFASRRTSTFYKESLLGVLAVLAPISLVSTFVSHGLLI
FT                   GLKGR"
FT   CDS             join(4192783..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4210693..4210835,
FT                   4212240..4212402,4217202..4217303,4223233..4223271,
FT                   4225047..4225095,4228373..4228402)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_k"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167985.0
FT                   protein_id=mCP90933.0 isoform=CRA_k"
FT                   /protein_id="EDL02071.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECK
FT                   TGIGNSYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPW
FT                   CYTTDPDKRYDYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPA
FT                   KFPSKNLKMNYCRNPDGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGE
FT                   NYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDS
FT                   QLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQ
FT                   SWAAMFPHRHSKTPENFPDAGLEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRPHSWP
FT                   WQISLRTRFTGQHFCGGTLIAPEWSAISKLHGC"
FT   CDS             join(4192783..4192831,4196202..4196337,4198531..4198539,
FT                   4210753..4210835,4212240..4212402,4217202..4217306,
FT                   4223234..4223271,4225047..4225081)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_l"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167987.0
FT                   protein_id=mCP90956.0 isoform=CRA_l"
FT                   /protein_id="EDL02072.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRSFHTDSQLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQE
FT                   CYQSDGQSYRGTSSTTITGKKCQSWAAMFPHRHSKTPENFPDAGLEMNYCRNPDGDKGP
FT                   WCYTTDPSVRWEYCNLKRCLTPGPGKSALEQDLPDSTSVAVL"
FT   CDS             join(4192783..4192819,4223168..4223265)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_c"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167981.0
FT                   protein_id=mCP90948.0 isoform=CRA_c"
FT                   /protein_id="EDL02063.1"
FT                   /translation="MDHKEVILLFLLLRETSGGTEEMPWEGGGWLRGQPSLLALANQP"
FT   CDS             join(4192783..4192831,4196202..4196337,4198531..4198637,
FT                   4202626..4202740,4204352..4204491,4205885..4206005,
FT                   4207217..4207335,4209762..4209924,4219312..4219393)
FT                   /codon_start=1
FT                   /gene="Plg"
FT                   /locus_tag="mCG_16690"
FT                   /product="plasminogen, isoform CRA_b"
FT                   /note="gene_id=mCG16690.2 transcript_id=mCT167979.0
FT                   protein_id=mCP90932.0 isoform=CRA_b"
FT                   /protein_id="EDL02062.1"
FT                   /translation="MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFSLTKKQLAAGG
FT                   VADCLAKCEGETDFVCRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECK
FT                   TGIGNSYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEENYCRNPDNDEQGPW
FT                   CYTTDPDKRYDYCNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPA
FT                   KFPSKNLKMNYCRNPDGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGE
FT                   NYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFPCNLLSVLPKPRWGCEWSLVLYNKPQ
FT                   KTL"
FT   gene            complement(4234131..4322502)
FT                   /gene="Slc22a3"
FT                   /locus_tag="mCG_16686"
FT                   /note="gene_id=mCG16686.1"
FT   mRNA            complement(join(4234131..4235656,4237893..4237992,
FT                   4239761..4239873,4240830..4240938,4247883..4248097,
FT                   4248218..4248315,4271943..4272060,4272836..4273004,
FT                   4274161..4274315,4278855..4278958,4321709..4322502))
FT                   /gene="Slc22a3"
FT                   /locus_tag="mCG_16686"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 3"
FT                   /note="gene_id=mCG16686.1 transcript_id=mCT12545.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4235596..4235656,4237893..4237992,
FT                   4239761..4239873,4240830..4240938,4247883..4248097,
FT                   4248218..4248315,4271943..4272060,4272836..4273004,
FT                   4274161..4274315,4278855..4278958,4321709..4322122))
FT                   /codon_start=1
FT                   /gene="Slc22a3"
FT                   /locus_tag="mCG_16686"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 3"
FT                   /note="gene_id=mCG16686.1 transcript_id=mCT12545.0
FT                   protein_id=mCP10310.1"
FT                   /db_xref="GOA:Q547K2"
FT                   /db_xref="InterPro:IPR004749"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1333817"
FT                   /db_xref="UniProtKB/TrEMBL:Q547K2"
FT                   /protein_id="EDL02059.1"
FT                   /translation="MPTFDQALRKAGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGSQ
FT                   PDYYWCRGPRATALAERCAWSPEEEWNLTTPELHVPAERRGQGHCHRYLLEATNTSSEL
FT                   SCDPLTAFPNRSAPLVSCSGDWRYVETHSTIVSQFDLVCSNAWMLDLTQAILNLGFLAG
FT                   AFTLGYAADRYGRLIIYLISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCF
FT                   VIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYW
FT                   VVPESPRWLITRKQGEKALQILRRVAKCNGKHLSSNYSEITVTDEEVSNPSCLDLVRTP
FT                   QMRKCTLILMFAWFTSAVVYQGLVMRLGLIGGNLYIDFFISGLVELPGALLILLTIERL
FT                   GRRLPFAASNIVAGVSCLVTAFLPEGIPWLRTTVATLGRLGITMAFEIVYLVNSELYPT
FT                   TLRNFGVSLCSGLCDFGGIIAPFLLFRLAAIWLELPLIIFGILASVCGGLVMLLPETKG
FT                   IALPETVEDVEKLGSSQLHQCGRKKKTQVSTSDV"
FT   gene            complement(4245245..4245702)
FT                   /pseudo
FT                   /locus_tag="mCG_16688"
FT                   /note="gene_id=mCG16688.0"
FT   mRNA            complement(4245245..4245702)
FT                   /pseudo
FT                   /locus_tag="mCG_16688"
FT                   /note="gene_id=mCG16688.0 transcript_id=mCT12547.0 created
FT                   on 19-APR-2002"
FT   gene            4281241..4293775
FT                   /locus_tag="mCG_147021"
FT                   /note="gene_id=mCG147021.0"
FT   mRNA            join(4281241..4281420,4293189..4293775)
FT                   /locus_tag="mCG_147021"
FT                   /product="mCG147021"
FT                   /note="gene_id=mCG147021.0 transcript_id=mCT187284.0
FT                   created on 13-JAN-2004"
FT   CDS             4293242..4293493
FT                   /codon_start=1
FT                   /locus_tag="mCG_147021"
FT                   /product="mCG147021"
FT                   /note="gene_id=mCG147021.0 transcript_id=mCT187284.0
FT                   protein_id=mCP109419.0"
FT                   /protein_id="EDL02060.1"
FT                   /translation="MQFAVSPEDVSSAFRLVSLESCHCEEPRSLPSHSTEKVPQTGAQD
FT                   PVHTATRLQFLSSKTTSSFFLCLESIILSEAGSKHHIF"
FT   gene            <4398180..4444056
FT                   /gene="Slc22a2"
FT                   /locus_tag="mCG_16677"
FT                   /note="gene_id=mCG16677.1"
FT   mRNA            join(<4398180..4398686,4400770..4400873,4412585..4412739,
FT                   4419486..4419654,4421866..4421980,4423527..4423633,
FT                   4425950..4426164,4428271..4428379,4428792..4428904,
FT                   4433356..4433455,4443613..4444056)
FT                   /gene="Slc22a2"
FT                   /locus_tag="mCG_16677"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 2, transcript variant mCT13055"
FT                   /note="gene_id=mCG16677.1 transcript_id=mCT13055.1 created
FT                   on 19-APR-2002"
FT   mRNA            join(<4398183..4398686,4400770..4400873,4412585..4412739,
FT                   4419486..4419654,4421866..4421980,4423527..4423633,
FT                   4425950..4426164,4428271..4428379,4428792..4428904,
FT                   4433356..4433455,4438828..4439109)
FT                   /gene="Slc22a2"
FT                   /locus_tag="mCG_16677"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 2, transcript variant mCT189472"
FT                   /note="gene_id=mCG16677.1 transcript_id=mCT189472.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4398224..4398455,4419620..4419654,4423527..4423633,
FT                   4425950..4426164,4428271..4428379,4428792..4428904,
FT                   4433356..4433455,4443613..4444056)
FT                   /gene="Slc22a2"
FT                   /locus_tag="mCG_16677"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 2, transcript variant mCT167963"
FT                   /note="gene_id=mCG16677.1 transcript_id=mCT167963.0 created
FT                   on 19-APR-2002"
FT   CDS             join(4398272..4398455,4419620..4419654,4423527..4423633,
FT                   4425950..4426164,4428271..4428379,4428792..4428904,
FT                   4433356..4433455,4443613..4443673)
FT                   /codon_start=1
FT                   /gene="Slc22a2"
FT                   /locus_tag="mCG_16677"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 2, isoform CRA_b"
FT                   /note="gene_id=mCG16677.1 transcript_id=mCT167963.0
FT                   protein_id=mCP90937.0 isoform=CRA_b"
FT                   /protein_id="EDL02057.1"
FT                   /translation="MPTVDDILEHIGEFHLFQKQTFFLLALLSGAFTPIYVGIVFLGFT
FT                   PNHHCRSPGVAELSQRYSAQLLLPALFLSLTADEDTGMKLNPSFLDLVRTPQIRKHTLI
FT                   LMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFIIILTIDRIGRRYPWAV
FT                   SNMVAGAACLASVFIPDDLQWLKITVACLGRMGITIAYEMVCLVNAELYPTYIRNLAVL
FT                   VCSSMCDIGGIVTPFLVYRLTDIWLEFPLVVFAVVGLVAGGLVLLLPETKGKALPETIE
FT                   DAEKMQRPRKKKEKRIYLQVKKAELS"
FT   CDS             join(<4398483..4398686,4400770..4400873,4412585..4412739,
FT                   4419486..4419654,4421866..4421980,4423527..4423633,
FT                   4425950..4426164,4428271..4428379,4428792..4428904,
FT                   4433356..4433455,4443613..4443673)
FT                   /codon_start=1
FT                   /gene="Slc22a2"
FT                   /locus_tag="mCG_16677"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 2, isoform CRA_a"
FT                   /note="gene_id=mCG16677.1 transcript_id=mCT13055.1
FT                   protein_id=mCP10307.1 isoform=CRA_a"
FT                   /protein_id="EDL02056.1"
FT                   /translation="TTPVPGLGSAGEVSFLSQCMRYEVDWNQSTLDCVDPLSSLAANRS
FT                   HLPLSPCEHGWVYDTPGSSIVTEFNLVCAHSWMLDLFQSLVNVGFFIGAVGIGYLADRF
FT                   GRKFCLLVTILINAISGVLMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVGLGY
FT                   RRTVGICYQIAFTVGLLILAGVAYALPNWRWLQFAVTLPNFCFLLYFWCIPESPRWLIS
FT                   QNKNAKAMKIIKHIAKKNGKSVPVSLQSLTADEDTGMKLNPSFLDLVRTPQIRKHTLIL
FT                   MYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFIIILTIDRIGRRYPWAVS
FT                   NMVAGAACLASVFIPDDLQWLKITVACLGRMGITIAYEMVCLVNAELYPTYIRNLAVLV
FT                   CSSMCDIGGIVTPFLVYRLTDIWLEFPLVVFAVVGLVAGGLVLLLPETKGKALPETIED
FT                   AEKMQRPRKKKEKRIYLQVKKAELS"
FT   CDS             join(<4398483..4398686,4400770..4400873,4412585..4412739,
FT                   4419486..4419654,4421866..4421980,4423527..4423633,
FT                   4425950..4426164,4428271..4428379,4428792..4428904,
FT                   4433356..4433455,4438828..4438861)
FT                   /codon_start=1
FT                   /gene="Slc22a2"
FT                   /locus_tag="mCG_16677"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 2, isoform CRA_c"
FT                   /note="gene_id=mCG16677.1 transcript_id=mCT189472.0
FT                   protein_id=mCP110462.0 isoform=CRA_c"
FT                   /protein_id="EDL02058.1"
FT                   /translation="TTPVPGLGSAGEVSFLSQCMRYEVDWNQSTLDCVDPLSSLAANRS
FT                   HLPLSPCEHGWVYDTPGSSIVTEFNLVCAHSWMLDLFQSLVNVGFFIGAVGIGYLADRF
FT                   GRKFCLLVTILINAISGVLMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVGLGY
FT                   RRTVGICYQIAFTVGLLILAGVAYALPNWRWLQFAVTLPNFCFLLYFWCIPESPRWLIS
FT                   QNKNAKAMKIIKHIAKKNGKSVPVSLQSLTADEDTGMKLNPSFLDLVRTPQIRKHTLIL
FT                   MYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFIIILTIDRIGRRYPWAVS
FT                   NMVAGAACLASVFIPDDLQWLKITVACLGRMGITIAYEMVCLVNAELYPTYIRNLAVLV
FT                   CSSMCDIGGIVTPFLVYRLTDIWLEFPLVVFAVVGLVAGGLVLLLPETKGKALPETIED
FT                   AEKMQSLGRLVQTVCH"
FT   gene            complement(4463987..4491249)
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /note="gene_id=mCG16684.2"
FT   mRNA            complement(join(4463987..4464194,4465979..4466081,
FT                   4467439..4467551,4472005..4472113,4474614..4474755,
FT                   4479478..4479626,4481951..4482105,4482553..4482656,
FT                   4490669..4491249))
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 1, transcript variant mCT167967"
FT                   /note="gene_id=mCG16684.2 transcript_id=mCT167967.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4463987..4464194,4465979..4466065,
FT                   4482606..4482656,4490669..4491197))
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 1, transcript variant mCT167968"
FT                   /note="gene_id=mCG16684.2 transcript_id=mCT167968.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4463987..4464194,4465979..4466081,
FT                   4467439..4467551,4472005..4472113,4474614..4474828,
FT                   4477605..4477711,4477832..4477946,4479458..4479626,
FT                   4481951..4482105,4482553..4482656,4490669..4491116))
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 1, transcript variant mCT12543"
FT                   /note="gene_id=mCG16684.2 transcript_id=mCT12543.1 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4463993..4464194,4465979..4466081,
FT                   4467439..4467551,4477635..4477711,4477832..4477946,
FT                   4479458..4479626,4481951..4482105,4482553..4482656,
FT                   4490669..4491249))
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 1, transcript variant mCT167969"
FT                   /note="gene_id=mCG16684.2 transcript_id=mCT167969.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4464128..4464194,4465979..4466081,
FT                   4467439..4467551,4472005..4472113,4474614..4474755,
FT                   4479478..4479626,4481951..4482105,4482553..4482656,
FT                   4490669..4491082))
FT                   /codon_start=1
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 1, isoform CRA_b"
FT                   /note="gene_id=mCG16684.2 transcript_id=mCT167967.0
FT                   protein_id=mCP90930.0 isoform=CRA_b"
FT                   /protein_id="EDL02053.1"
FT                   /translation="MPTVDDVLEHVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFT
FT                   PDHHCRSPGVAELSQRCGWSPAEELNYTVPGLGSAGEASFLSQCMKYEVDWNQSTLDCV
FT                   DPLSSLAANRSHLPLSPCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCVNLGFFLG
FT                   SLVVGYIADRFGRKLCLLVTTLVTSLSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGY
FT                   TLITEFVGSGYRRTTAILYQVAFTVGLVGLAGVAYAIPDWRWLQLAVSLPTFFFYSSLV
FT                   EFPAAFIILVTIDRIGRIYPIAASNLVAGAACLLMIFIPHELHWLNVTLACLGRMGATI
FT                   VLQMVCLVNAELYPTFIRNLGMMVCSALCDLGGIFTPFMVFRLMEVWQALPLILFGVLG
FT                   LSAGAVTLLLPETKGVALPETIEEAENLGRRKSKAKENTIYLQVQTGKSPHT"
FT   CDS             complement(join(4464128..4464194,4465979..4466081,
FT                   4467439..4467551,4477635..4477711,4477832..4477946,
FT                   4479458..4479626,4481951..4482105,4482553..4482656,
FT                   4490669..4491082))
FT                   /codon_start=1
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 1, isoform CRA_d"
FT                   /note="gene_id=mCG16684.2 transcript_id=mCT167969.0
FT                   protein_id=mCP90953.0 isoform=CRA_d"
FT                   /protein_id="EDL02055.1"
FT                   /translation="MPTVDDVLEHVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFT
FT                   PDHHCRSPGVAELSQRCGWSPAEELNYTVPGLGSAGEASFLSQCMKYEVDWNQSTLDCV
FT                   DPLSSLAANRSHLPLSPCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCVNLGFFLG
FT                   SLVVGYIADRFGRKLCLLVTTLVTSLSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGY
FT                   TLITEFVGSGYRRTTAILYQVAFTVGLVGLAGVAYAIPDWRWLQLAVSLPTFLFLLYYW
FT                   FVPESPRWLLSQKRTTQAVRIMEQIAQKNRKVPPADLKMMCLEEDASERRSPSFADLFR
FT                   TPSLRNLGMMVCSALCDLGGIFTPFMVFRLMEVWQALPLILFGVLGLSAGAVTLLLPET
FT                   KGVALPETIEEAENLGRRKSKAKENTIYLQVQTGKSPHT"
FT   CDS             complement(join(4464128..4464194,4465979..4466081,
FT                   4467439..4467551,4472005..4472113,4474614..4474828,
FT                   4477605..4477711,4477832..4477946,4479458..4479626,
FT                   4481951..4482105,4482553..4482656,4490669..4491082))
FT                   /codon_start=1
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG16684.2 transcript_id=mCT12543.1
FT                   protein_id=mCP10297.1 isoform=CRA_a"
FT                   /protein_id="EDL02052.1"
FT                   /translation="MPTVDDVLEHVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFT
FT                   PDHHCRSPGVAELSQRCGWSPAEELNYTVPGLGSAGEASFLSQCMKYEVDWNQSTLDCV
FT                   DPLSSLAANRSHLPLSPCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCVNLGFFLG
FT                   SLVVGYIADRFGRKLCLLVTTLVTSLSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGY
FT                   TLITEFVGSGYRRTTAILYQVAFTVGLVGLAGVAYAIPDWRWLQLAVSLPTFLFLLYYW
FT                   FVPESPRWLLSQKRTTQAVRIMEQIAQKNRKVPPADLKMMCLEEDASERRSPSFADLFR
FT                   TPSLRKHTLILMYLWFSCAVLYQGLIMHVGATGANLYLDFFYSSLVEFPAAFIILVTID
FT                   RIGRIYPIAASNLVAGAACLLMIFIPHELHWLNVTLACLGRMGATIVLQMVCLVNAELY
FT                   PTFIRNLGMMVCSALCDLGGIFTPFMVFRLMEVWQALPLILFGVLGLSAGAVTLLLPET
FT                   KGVALPETIEEAENLGRRKSKAKENTIYLQVQTGKSPHT"
FT   CDS             complement(join(4466012..4466065,4482606..4482656,
FT                   4490669..4491082))
FT                   /codon_start=1
FT                   /gene="Slc22a1"
FT                   /locus_tag="mCG_16684"
FT                   /product="solute carrier family 22 (organic cation
FT                   transporter), member 1, isoform CRA_c"
FT                   /note="gene_id=mCG16684.2 transcript_id=mCT167968.0
FT                   protein_id=mCP90939.0 isoform=CRA_c"
FT                   /protein_id="EDL02054.1"
FT                   /translation="MPTVDDVLEHVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFT
FT                   PDHHCRSPGVAELSQRCGWSPAEELNYTVPGLGSAGEASFLSQCMKYEVDWNQSTLDCV
FT                   DPLSSLAANRSHLPLSPCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCCWGCDPST
FT                   SGDQGRGSA"
FT   gene            complement(4497816..4585849)
FT                   /gene="Igf2r"
FT                   /locus_tag="mCG_16680"
FT                   /note="gene_id=mCG16680.2"
FT   mRNA            complement(join(4497816..4499529,4500541..4500610,
FT                   4500994..4501137,4502025..4502211,4503719..4503906,
FT                   4504393..4504539,4505535..4505649,4506560..4506696,
FT                   4508042..4508188,4508477..4508684,4509406..4509567,
FT                   4510689..4510838,4512728..4512946,4513489..4513745,
FT                   4513928..4514047,4514583..4514709,4515745..4515935,
FT                   4516623..4516759,4517336..4517433,4517600..4517730,
FT                   4518764..4518979,4519675..4519762,4520036..4520211,
FT                   4520300..4520443,4521091..4521255,4524782..4524977,
FT                   4526041..4526145,4527423..4527524,4529367..4529546,
FT                   4530279..4530447,4530784..4530899,4531279..4531453,
FT                   4531975..4532122,4532679..4532816,4534059..4534202,
FT                   4535219..4535356,4537534..4537698,4540721..4540824,
FT                   4541596..4541761,4542077..4542239,4546773..4546878,
FT                   4549160..4549289,4551330..4551462,4554650..4554748,
FT                   4555645..4555769,4564090..4564229,4584844..4585849))
FT                   /gene="Igf2r"
FT                   /locus_tag="mCG_16680"
FT                   /product="insulin-like growth factor 2 receptor, transcript
FT                   variant mCT13059"
FT                   /note="gene_id=mCG16680.2 transcript_id=mCT13059.3 created
FT                   on 31-JAN-2003"
FT   mRNA            complement(join(4497816..4499529,4500541..4500610,
FT                   4500994..4501137,4502025..4502211,4503719..4503906,
FT                   4504393..4504539,4505535..4505649,4506560..4506696,
FT                   4507286..4507520,4508042..4508188,4508477..4508684,
FT                   4509406..4509567,4510689..4510838,4512728..4512946,
FT                   4513489..4513745,4513928..4514047,4514583..4514709,
FT                   4515745..4515935,4516623..4516759,4517336..4517433,
FT                   4517600..4517730,4518764..4518979,4519675..4519762,
FT                   4520036..4520211,4520300..4520443,4521091..4521255,
FT                   4524782..4524977,4526041..4526145,4527423..4527524,
FT                   4529367..4529546,4530279..4530447,4530784..4530899,
FT                   4531279..4531453,4531975..4532122,4532679..4532816,
FT                   4534059..4534202,4535219..4535356,4537534..4537698,
FT                   4540721..4540824,4541596..4541761,4542077..4542239,
FT                   4546773..4546878,4549160..4549289,4551330..4551462,
FT                   4554650..4554748,4555645..4555769,4564090..4564229,
FT                   4584844..>4585109))
FT                   /gene="Igf2r"
FT                   /locus_tag="mCG_16680"
FT                   /product="insulin-like growth factor 2 receptor, transcript
FT                   variant mCT189473"
FT                   /note="gene_id=mCG16680.2 transcript_id=mCT189473.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4497832..4498111,4513717..4513745,
FT                   4513928..4514047,4514583..4514709,4515745..4515935,
FT                   4516623..4516759,4517336..4517433,4517600..4517730,
FT                   4518764..4518979,4519675..4519762,4520036..4520211,
FT                   4520300..4520443,4521091..4521255,4524782..4524977,
FT                   4526041..4526145,4527423..4527524,4529367..4529546,
FT                   4530279..4530447,4530784..4530899,4531279..4531453,
FT                   4531975..4532122,4532679..4532816,4534059..4534202,
FT                   4535219..4535356,4537534..4537698,4540721..4540824,
FT                   4541596..4541761,4542077..4542239,4546773..4546878,
FT                   4549160..4549289,4551330..4551462,4554650..4554748,
FT                   4555645..4555769,4564090..4564229,4584844..4585109))
FT                   /gene="Igf2r"
FT                   /locus_tag="mCG_16680"
FT                   /product="insulin-like growth factor 2 receptor, transcript
FT                   variant mCT179181"
FT                   /note="gene_id=mCG16680.2 transcript_id=mCT179181.0 created
FT                   on 31-JAN-2003"
FT   CDS             complement(join(4497866..4498111,4513717..4513745,
FT                   4513928..4514047,4514583..4514709,4515745..4515935,
FT                   4516623..4516759,4517336..4517433,4517600..4517730,
FT                   4518764..4518979,4519675..4519762,4520036..4520211,
FT                   4520300..4520443,4521091..4521255,4524782..4524977,
FT                   4526041..4526145,4527423..4527524,4529367..4529546,
FT                   4530279..4530447,4530784..4530899,4531279..4531453,
FT                   4531975..4532122,4532679..4532816,4534059..4534202,
FT                   4535219..4535356,4537534..4537698,4540721..4540824,
FT                   4541596..4541761,4542077..4542239,4546773..4546878,
FT                   4549160..4549289,4551330..4551462,4554650..4554748,
FT                   4555645..4555769,4564090..4564229,4584844..4584977))
FT                   /codon_start=1
FT                   /gene="Igf2r"
FT                   /locus_tag="mCG_16680"
FT                   /product="insulin-like growth factor 2 receptor, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG16680.2 transcript_id=mCT179181.0
FT                   protein_id=mCP102103.0 isoform=CRA_c"
FT                   /protein_id="EDL02051.1"
FT                   /translation="MRAVQLGPVPSGPRVALLPPLLLLLLLAAAGSAQAQAVDLDALCS
FT                   YTWEAVDSKNNAVYKINVCGNVGISSCGPTSAICMCDLKTENCRSVGDSLLRSSARSLL
FT                   EFNTTMGCQPSDSQHRIQTSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKDIFKA
FT                   DKEVPCYAFDDKLQKHDLNPLIKLNGGYLVDDSDPDTSLFINVCRDIDSLRDPSTQLRV
FT                   CPAGTAACLLKGNQAFDVGRPKEGLKLLSKDRLVLTYVKEEGEKPDFCNGHSPAVTVTF
FT                   VCPSERREGTIPKLTAKSNCRYEVEWITEYACHRDYLQSESCSLSSEQHDITIDLSPLA
FT                   QYGGSPYVSDGREYTFFINVCGDTKVSLCNNKEAAVCQEKKADSTQVKIAGRHQNQTLR
FT                   YSDGDLTLIYSGGDECSSGFQRMSVINFECNKTAGKDGRGEPVFTGEVDCTYFFTWDTK
FT                   YACIKEKEDLLCGAINGKKRYDLSVLARHSESEQNWEAVDGSQAESEKYFFINVCHRVL
FT                   QEGKARNCPEDAAVCAVDKNGSKNLGKFVSSPTKEKGHIQLSYTDGDDCGSDKKISTNI
FT                   TLVCKPGDLESAPVLRAARSDGCFYEFEWHTAAACVLSKTEGENCTVLDAQAGFSFDLS
FT                   LLTKKNGAYKVETEKYDFYINVCGPVSMDPCQSNSGACQVAKSGKSWNLGLSSTKLTYY
FT                   DGMIQLSYRNGTPYNNEKHTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYAC
FT                   PEEPLECMVTDPSMMEQYDLSSLVKSEGGSGGNWYAMENSREHVTRRKYYLNVCRPLNP
FT                   VPGCDRYASACQMKYENHEGSLAETVSISNLGVAKIGPVVEESGSLLLEYVNGSACTTS
FT                   DGQLTTYSTRIHLVCGRGFMNSHPIFTFNWECVVSFLWNTEAACPIQTITETDQACSIR
FT                   DPSSGFVFNLSPLNDSAQGHVVLGIGKTFVFNICGAMPACGTVAGKPAYGCEAETQIED
FT                   IKDLRPQRPVGMERSLQLSAEGFLTLTYKGSSPSDRGTAFIIRFICNDDIYPGAPKFLH
FT                   QDIDSTRGIRNTYFEFETALACTPSLVDCQVTDPAGNEYDLSALSMVRKPWTAVDTSAY
FT                   GKRRHFYLSVCNPLPYIPGCHGIALGSCMVSEDNSFNLGVVQISPQATGNGSLSILYVN
FT                   GDRCGDQRFSTRIVFECAQTSGSPMFQFVNNCEYVFVWRTVEACPVIREEGDNCQVKDP
FT                   RHGNLYDLKPLGLNDTIVSVGEYTYYLRVCGKLSSDVCSAHDGSKAVSSCQEKKGPQGF
FT                   QKVAGLLSQKLTFENGLLKMNYTGGDTCHKVYQRSTTIYFYCDRTTQKPVFLKETSDCS
FT                   YMFEWRTQYACPPFNVTECSVQDAAGNSIDLSSLSRYSDNWEAVTRTGATEHYLINVCK
FT                   SLSPHAGTEPCPPEAAVCLLNGSKPVNLGKVRDGPQWTDGVTVLQYVDGDLCPDKIRRR
FT                   STIIRFTCSDNQVNSRPLFISAVQDCEYTFSWPTPSACPVKSNTHDDCQVTNPSTGHLF
FT                   DLSSLSGRAGINASYSEKGLVFMSICEENENCGPGVGACFGQTRISCWCRGCARAVSQD
FT                   GRAGPVHWLWILFLMCSVTCHIIELYIGGIYIPKSKVPRRISWFMPDFASLFDFTLSVF
FT                   LKIDFSLHF"
FT   CDS             complement(join(4499113..4499529,4500541..4500610,
FT                   4500994..4501137,4502025..4502211,4503719..4503906,
FT                   4504393..4504539,4505535..4505649,4506560..4506696,
FT                   4507286..4507520,4508042..4508188,4508477..4508684,
FT                   4509406..4509567,4510689..4510838,4512728..4512946,
FT                   4513489..4513745,4513928..4514047,4514583..4514709,
FT                   4515745..4515935,4516623..4516759,4517336..4517433,
FT                   4517600..4517730,4518764..4518979,4519675..4519762,
FT                   4520036..4520211,4520300..4520443,4521091..4521255,
FT                   4524782..4524977,4526041..4526145,4527423..4527524,
FT                   4529367..4529546,4530279..4530447,4530784..4530899,
FT                   4531279..4531453,4531975..4532122,4532679..4532816,
FT                   4534059..4534202,4535219..4535356,4537534..4537698,
FT                   4540721..4540824,4541596..4541761,4542077..4542239,
FT                   4546773..4546878,4549160..4549289,4551330..4551462,
FT                   4554650..4554748,4555645..4555769,4564090..4564229,
FT                   4584844..>4585109))
FT                   /codon_start=1
FT                   /gene="Igf2r"
FT                   /locus_tag="mCG_16680"
FT                   /product="insulin-like growth factor 2 receptor, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16680.2 transcript_id=mCT189473.0
FT                   protein_id=mCP110463.0 isoform=CRA_b"
FT                   /protein_id="EDL02050.1"
FT                   /translation="PLAPVLSPLSPSSSRCSFDSAVVARPCPRRGSKRPAAVSPTPHAM
FT                   RAVQLGPVPSGPRVALLPPLLLLLLLAAAGSAQAQAVDLDALCSYTWEAVDSKNNAVYK
FT                   INVCGNVGISSCGPTSAICMCDLKTENCRSVGDSLLRSSARSLLEFNTTMGCQPSDSQH
FT                   RIQTSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKDIFKADKEVPCYAFDDKLQK
FT                   HDLNPLIKLNGGYLVDDSDPDTSLFINVCRDIDSLRDPSTQLRVCPAGTAACLLKGNQA
FT                   FDVGRPKEGLKLLSKDRLVLTYVKEEGEKPDFCNGHSPAVTVTFVCPSERREGTIPKLT
FT                   AKSNCRYEVEWITEYACHRDYLQSESCSLSSEQHDITIDLSPLAQYGGSPYVSDGREYT
FT                   FFINVCGDTKVSLCNNKEAAVCQEKKADSTQVKIAGRHQNQTLRYSDGDLTLIYSGGDE
FT                   CSSGFQRMSVINFECNKTAGKDGRGEPVFTGEVDCTYFFTWDTKYACIKEKEDLLCGAI
FT                   NGKKRYDLSVLARHSESEQNWEAVDGSQAESEKYFFINVCHRVLQEGKARNCPEDAAVC
FT                   AVDKNGSKNLGKFVSSPTKEKGHIQLSYTDGDDCGSDKKISTNITLVCKPGDLESAPVL
FT                   RAARSDGCFYEFEWHTAAACVLSKTEGENCTVLDAQAGFSFDLSLLTKKNGAYKVETEK
FT                   YDFYINVCGPVSMDPCQSNSGACQVAKSGKSWNLGLSSTKLTYYDGMIQLSYRNGTPYN
FT                   NEKHTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECMVTDPSMM
FT                   EQYDLSSLVKSEGGSGGNWYAMENSREHVTRRKYYLNVCRPLNPVPGCDRYASACQMKY
FT                   ENHEGSLAETVSISNLGVAKIGPVVEESGSLLLEYVNGSACTTSDGQLTTYSTRIHLVC
FT                   GRGFMNSHPIFTFNWECVVSFLWNTEAACPIQTITETDQACSIRDPSSGFVFNLSPLND
FT                   SAQGHVVLGIGKTFVFNICGAMPACGTVAGKPAYGCEAETQIEDIKDLRPQRPVGMERS
FT                   LQLSAEGFLTLTYKGSSPSDRGTAFIIRFICNDDIYPGAPKFLHQDIDSTRGIRNTYFE
FT                   FETALACTPSLVDCQVTDPAGNEYDLSALSMVRKPWTAVDTSAYGKRRHFYLSVCNPLP
FT                   YIPGCHGIALGSCMVSEDNSFNLGVVQISPQATGNGSLSILYVNGDRCGDQRFSTRIVF
FT                   ECAQTSGSPMFQFVNNCEYVFVWRTVEACPVIREEGDNCQVKDPRHGNLYDLKPLGLND
FT                   TIVSVGEYTYYLRVCGKLSSDVCSAHDGSKAVSSCQEKKGPQGFQKVAGLLSQKLTFEN
FT                   GLLKMNYTGGDTCHKVYQRSTTIYFYCDRTTQKPVFLKETSDCSYMFEWRTQYACPPFN
FT                   VTECSVQDAAGNSIDLSSLSRYSDNWEAVTRTGATEHYLINVCKSLSPHAGTEPCPPEA
FT                   AVCLLNGSKPVNLGKVRDGPQWTDGVTVLQYVDGDLCPDKIRRRSTIIRFTCSDNQVNS
FT                   RPLFISAVQDCEYTFSWPTPSACPVKSNTHDDCQVTNPSTGHLFDLSSLSGRAGINASY
FT                   SEKGLVFMSICEENENCGPGVGACFGQTRISVGKASKRLSYKDQVLQLVYENGSPCPSL
FT                   SDLRYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQATECTVRNGSSI
FT                   IDLSPLIHRTGGYEAYDESEDDTSDTTPDFYINICQPLNPMHGVPCPAGASVCKVPVDG
FT                   PPIDIGRVTGPPIFNPVANEVYLNFESSTHCLADRYMNYTSLITFHCKRGVSMGTPKLI
FT                   RTNDCDFVFEWETPIVCPDEVKTQGCAVTDEQLLYSFNLTSLSTSTFKVTRDARTYSIG
FT                   VCTAAAGLGQEGCKDGGVCLLSGNKGASFGRLASMQLDYRHQDEAVILSYVNGDPCPPE
FT                   TDDGEPCVFPFIYKGKSYDECVLEGRAKLWCSKTANYDRDHEWGFCRQTNSYRMSAIIF
FT                   TCDESEDIGRPQVFSEDRGCEVTFEWKTKVVCPPKKMECKFVQKHKTYDLRLLSSLTGS
FT                   WDFVHEGNSYFINLCQRVYKGPLDCSERASICKKSATGQVQVLGLVHTQKLEVIDETVI
FT                   VTYSKGYPCGGNKTASSVIELTCAKTVGRPAFKRFDSVSCTYYFYWYSRAACAVRPQEV
FT                   TMVNGTLTNPVTGKSFSLGEIYFKLFSASGDMRTNGDNYLYEIQLSSITSSSYPACAGA
FT                   NICQVKPNDQHFSRKVGTSDMTKYYVQDGDLDVVFTSSSKCGKDKTKSVSSTIFFHCDP
FT                   LVKDGIPEFSHETADCQYLFSWYTSAVCPLGVDFEDESAGPEYKGLSERSQAVGAVLSL
FT                   LLVALTGCLLALLLHKKERRETVINKLTSCCRRSSGVSYKYSKVSKEEETDENETEWLM
FT                   EEIQVPAPRLGKDGQENGHITTKAVKAEALSSLHGDDQDSEDEVLTVPEVKVHSGRGAE
FT                   VESSQPLRNPQRKVLKEREGERLGLVRGEKARKGKFRPGQRKPTAPAKLVSFHDDSDED
FT                   LLHI"
FT   CDS             complement(join(4506560..4506696,4508042..4508188,
FT                   4508477..4508684,4509406..4509567,4510689..4510838,
FT                   4512728..4512946,4513489..4513745,4513928..4514047,
FT                   4514583..4514709,4515745..4515935,4516623..4516759,
FT                   4517336..4517433,4517600..4517730,4518764..4518979,
FT                   4519675..4519762,4520036..4520211,4520300..4520443,
FT                   4521091..4521255,4524782..4524977,4526041..4526145,
FT                   4527423..4527524,4529367..4529546,4530279..4530447,
FT                   4530784..4530899,4531279..4531453,4531975..4532122,
FT                   4532679..4532816,4534059..4534202,4535219..4535356,
FT                   4537534..4537698,4540721..4540824,4541596..4541761,
FT                   4542077..4542239,4546773..4546878,4549160..4549289,
FT                   4551330..4551462,4554650..4554748,4555645..4555769,
FT                   4564090..4564229,4584844..4584977))
FT                   /codon_start=1
FT                   /gene="Igf2r"
FT                   /locus_tag="mCG_16680"
FT                   /product="insulin-like growth factor 2 receptor, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16680.2 transcript_id=mCT13059.3
FT                   protein_id=mCP10326.3 isoform=CRA_a"
FT                   /protein_id="EDL02049.1"
FT                   /translation="MRAVQLGPVPSGPRVALLPPLLLLLLLAAAGSAQAQAVDLDALCS
FT                   YTWEAVDSKNNAVYKINVCGNVGISSCGPTSAICMCDLKTENCRSVGDSLLRSSARSLL
FT                   EFNTTMGCQPSDSQHRIQTSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKDIFKA
FT                   DKEVPCYAFDDKLQKHDLNPLIKLNGGYLVDDSDPDTSLFINVCRDIDSLRDPSTQLRV
FT                   CPAGTAACLLKGNQAFDVGRPKEGLKLLSKDRLVLTYVKEEGEKPDFCNGHSPAVTVTF
FT                   VCPSERREGTIPKLTAKSNCRYEVEWITEYACHRDYLQSESCSLSSEQHDITIDLSPLA
FT                   QYGGSPYVSDGREYTFFINVCGDTKVSLCNNKEAAVCQEKKADSTQVKIAGRHQNQTLR
FT                   YSDGDLTLIYSGGDECSSGFQRMSVINFECNKTAGKDGRGEPVFTGEVDCTYFFTWDTK
FT                   YACIKEKEDLLCGAINGKKRYDLSVLARHSESEQNWEAVDGSQAESEKYFFINVCHRVL
FT                   QEGKARNCPEDAAVCAVDKNGSKNLGKFVSSPTKEKGHIQLSYTDGDDCGSDKKISTNI
FT                   TLVCKPGDLESAPVLRAARSDGCFYEFEWHTAAACVLSKTEGENCTVLDAQAGFSFDLS
FT                   LLTKKNGAYKVETEKYDFYINVCGPVSMDPCQSNSGACQVAKSGKSWNLGLSSTKLTYY
FT                   DGMIQLSYRNGTPYNNEKHTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYAC
FT                   PEEPLECMVTDPSMMEQYDLSSLVKSEGGSGGNWYAMENSREHVTRRKYYLNVCRPLNP
FT                   VPGCDRYASACQMKYENHEGSLAETVSISNLGVAKIGPVVEESGSLLLEYVNGSACTTS
FT                   DGQLTTYSTRIHLVCGRGFMNSHPIFTFNWECVVSFLWNTEAACPIQTITETDQACSIR
FT                   DPSSGFVFNLSPLNDSAQGHVVLGIGKTFVFNICGAMPACGTVAGKPAYGCEAETQIED
FT                   IKDLRPQRPVGMERSLQLSAEGFLTLTYKGSSPSDRGTAFIIRFICNDDIYPGAPKFLH
FT                   QDIDSTRGIRNTYFEFETALACTPSLVDCQVTDPAGNEYDLSALSMVRKPWTAVDTSAY
FT                   GKRRHFYLSVCNPLPYIPGCHGIALGSCMVSEDNSFNLGVVQISPQATGNGSLSILYVN
FT                   GDRCGDQRFSTRIVFECAQTSGSPMFQFVNNCEYVFVWRTVEACPVIREEGDNCQVKDP
FT                   RHGNLYDLKPLGLNDTIVSVGEYTYYLRVCGKLSSDVCSAHDGSKAVSSCQEKKGPQGF
FT                   QKVAGLLSQKLTFENGLLKMNYTGGDTCHKVYQRSTTIYFYCDRTTQKPVFLKETSDCS
FT                   YMFEWRTQYACPPFNVTECSVQDAAGNSIDLSSLSRYSDNWEAVTRTGATEHYLINVCK
FT                   SLSPHAGTEPCPPEAAVCLLNGSKPVNLGKVRDGPQWTDGVTVLQYVDGDLCPDKIRRR
FT                   STIIRFTCSDNQVNSRPLFISAVQDCEYTFSWPTPSACPVKSNTHDDCQVTNPSTGHLF
FT                   DLSSLSGRAGINASYSEKGLVFMSICEENENCGPGVGACFGQTRISVGKASKRLSYKDQ
FT                   VLQLVYENGSPCPSLSDLRYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLA
FT                   CEQATECTVRNGSSIIDLSPLIHRTGGYEAYDESEDDTSDTTPDFYINICQPLNPMHGV
FT                   PCPAGASVCKVPVDGPPIDIGRVTGPPIFNPVANEVYLNFESSTHCLADRYMNYTSLIT
FT                   FHCKRGVSMGTPKLIRTNDCDFVFEWETPIVCPDEVKTQGCAVTDEQLLYSFNLTSLST
FT                   STFKVTRDARTYSIGVCTAAAGLGQEGCKDGGVCLLSGNKGASFGRLASMQLDYRHQDE
FT                   AVILSYVNGDPCPPETDDGEPCVFPFIYKGKSYDECVLEGRAKLWCSKTANYDRDHEWG
FT                   FCRQSTLSICAKEYTKVPWTALKEPAFARRVPLVKSRFWGLFIHKNWKS"
FT   gene            4556734..4675494
FT                   /locus_tag="mCG_142215"
FT                   /note="gene_id=mCG142215.1"
FT   mRNA            join(4556734..4556787,4674479..4674624,4674913..4675494)
FT                   /locus_tag="mCG_142215"
FT                   /product="mCG142215, transcript variant mCT185715"
FT                   /note="gene_id=mCG142215.1 transcript_id=mCT185715.0
FT                   created on 12-JUN-2003"
FT   mRNA            join(4556734..4556787,4629874..4630935)
FT                   /locus_tag="mCG_142215"
FT                   /product="mCG142215, transcript variant mCT179422"
FT                   /note="gene_id=mCG142215.1 transcript_id=mCT179422.0
FT                   created on 12-JUN-2003"
FT   mRNA            join(4556748..4556787,4594737..4594959,4629874..4630289)
FT                   /locus_tag="mCG_142215"
FT                   /product="mCG142215, transcript variant mCT185714"
FT                   /note="gene_id=mCG142215.1 transcript_id=mCT185714.0
FT                   created on 12-JUN-2003"
FT   mRNA            join(4556761..4556787,4613797..4613877,4645203..4645529)
FT                   /locus_tag="mCG_142215"
FT                   /product="mCG142215, transcript variant mCT185716"
FT                   /note="gene_id=mCG142215.1 transcript_id=mCT185716.0
FT                   created on 12-JUN-2003"
FT   CDS             4629910..4630248
FT                   /codon_start=1
FT                   /locus_tag="mCG_142215"
FT                   /product="mCG142215, isoform CRA_a"
FT                   /note="gene_id=mCG142215.1 transcript_id=mCT179422.0
FT                   protein_id=mCP102344.0 isoform=CRA_a"
FT                   /protein_id="EDL02045.1"
FT                   /translation="MGEVDLFRSGSLKQLSSVLSGNRQFGLQVSNSSLIHLQTLHRYTS
FT                   SPVRESPKSKHESAVVPSPNRDIQASARSAQVSRRDQNQQGHQEFFAVPLSVKQRSSKM
FT                   RDQEVLQS"
FT   CDS             4629910..4630248
FT                   /codon_start=1
FT                   /locus_tag="mCG_142215"
FT                   /product="mCG142215, isoform CRA_a"
FT                   /note="gene_id=mCG142215.1 transcript_id=mCT185714.0
FT                   protein_id=mCP106974.0 isoform=CRA_a"
FT                   /protein_id="EDL02046.1"
FT                   /translation="MGEVDLFRSGSLKQLSSVLSGNRQFGLQVSNSSLIHLQTLHRYTS
FT                   SPVRESPKSKHESAVVPSPNRDIQASARSAQVSRRDQNQQGHQEFFAVPLSVKQRSSKM
FT                   RDQEVLQS"
FT   gene            4634172..4634988
FT                   /pseudo
FT                   /locus_tag="mCG_1025753"
FT                   /note="gene_id=mCG1025753.1"
FT   mRNA            4634172..4634988
FT                   /pseudo
FT                   /locus_tag="mCG_1025753"
FT                   /note="gene_id=mCG1025753.1 transcript_id=mCT143457.1
FT                   created on 19-APR-2002"
FT   gene            complement(4635130..4636543)
FT                   /pseudo
FT                   /locus_tag="mCG_16683"
FT                   /note="gene_id=mCG16683.2"
FT   mRNA            complement(4635130..4636543)
FT                   /pseudo
FT                   /locus_tag="mCG_16683"
FT                   /note="gene_id=mCG16683.2 transcript_id=mCT12542.2 created
FT                   on 19-APR-2002"
FT   CDS             4645321..4645482
FT                   /codon_start=1
FT                   /locus_tag="mCG_142215"
FT                   /product="mCG142215, isoform CRA_c"
FT                   /note="gene_id=mCG142215.1 transcript_id=mCT185716.0
FT                   protein_id=mCP106972.0 isoform=CRA_c"
FT                   /protein_id="EDL02048.1"
FT                   /translation="MIHRSGKEANHLFVTRYFFLWEESFLLIHSTFIERCKPSKKWPLQ
FT                   KLDTTDQG"
FT   gene            complement(4653185..4653519)
FT                   /pseudo
FT                   /locus_tag="mCG_16681"
FT                   /note="gene_id=mCG16681.1"
FT   mRNA            complement(4653185..4653519)
FT                   /pseudo
FT                   /locus_tag="mCG_16681"
FT                   /note="gene_id=mCG16681.1 transcript_id=mCT13058.1 created
FT                   on 19-APR-2002"
FT   gene            complement(4656454..4683439)
FT                   /gene="Mas1"
FT                   /locus_tag="mCG_16696"
FT                   /note="gene_id=mCG16696.2"
FT   mRNA            complement(join(4656454..4657947,4661610..4661784,
FT                   4663447..4663490,4669673..4669704,4669808..4670008,
FT                   4670353..4670479,4678304..4678473,4681039..4681153,
FT                   4683394..4683439))
FT                   /gene="Mas1"
FT                   /locus_tag="mCG_16696"
FT                   /product="MAS1 oncogene, transcript variant mCT12555"
FT                   /note="gene_id=mCG16696.2 transcript_id=mCT12555.2 created
FT                   on 29-NOV-2004"
FT   mRNA            complement(join(4656454..4657947,4661610..4661784,
FT                   4663447..4663490,4667086..4667278))
FT                   /gene="Mas1"
FT                   /locus_tag="mCG_16696"
FT                   /product="MAS1 oncogene, transcript variant mCT167992"
FT                   /note="gene_id=mCG16696.2 transcript_id=mCT167992.1 created
FT                   on 29-NOV-2004"
FT   CDS             complement(4656937..4657911)
FT                   /codon_start=1
FT                   /gene="Mas1"
FT                   /locus_tag="mCG_16696"
FT                   /product="MAS1 oncogene, isoform CRA_a"
FT                   /note="gene_id=mCG16696.2 transcript_id=mCT167992.1
FT                   protein_id=mCP90955.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VB49"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000820"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:96918"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VB49"
FT                   /protein_id="EDL02043.1"
FT                   /translation="MDQSNMTSLAEEKAMNTSSRNASLGSSHPPIPIVHWVIMSISPLG
FT                   FVENGILLWFLCFRMRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHHYTI
FT                   VTLSVTFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVT
FT                   TMEYVMCIDSGEESHSRSDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHS
FT                   SKLYIVIMVTIIIFLIFAMPMRVLYLLYYEYWSAFGNLHNISLLFSTINSSANPFIYFF
FT                   VGSSKKKRFRESLKVVLTRAFKDEMQPRRQEGNGNTVSIETVV"
FT   CDS             complement(4656937..4657911)
FT                   /codon_start=1
FT                   /gene="Mas1"
FT                   /locus_tag="mCG_16696"
FT                   /product="MAS1 oncogene, isoform CRA_a"
FT                   /note="gene_id=mCG16696.2 transcript_id=mCT12555.2
FT                   protein_id=mCP10323.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VB49"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000820"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:96918"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VB49"
FT                   /protein_id="EDL02044.1"
FT                   /translation="MDQSNMTSLAEEKAMNTSSRNASLGSSHPPIPIVHWVIMSISPLG
FT                   FVENGILLWFLCFRMRRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHHYTI
FT                   VTLSVTFLFGYNTGLYLLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVT
FT                   TMEYVMCIDSGEESHSRSDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHS
FT                   SKLYIVIMVTIIIFLIFAMPMRVLYLLYYEYWSAFGNLHNISLLFSTINSSANPFIYFF
FT                   VGSSKKKRFRESLKVVLTRAFKDEMQPRRQEGNGNTVSIETVV"
FT   CDS             4674973..4675077
FT                   /codon_start=1
FT                   /locus_tag="mCG_142215"
FT                   /product="mCG142215, isoform CRA_b"
FT                   /note="gene_id=mCG142215.1 transcript_id=mCT185715.0
FT                   protein_id=mCP106973.0 isoform=CRA_b"
FT                   /protein_id="EDL02047.1"
FT                   /translation="MGTTSHNTHWLCMETLDLQSDTQFCHMDTGLVIN"
FT   gene            4691327..4693135
FT                   /gene="Mrgprh"
FT                   /locus_tag="mCG_16694"
FT                   /note="gene_id=mCG16694.1"
FT   mRNA            4691327..4693135
FT                   /gene="Mrgprh"
FT                   /locus_tag="mCG_16694"
FT                   /product="MAS-related GPR, member H"
FT                   /note="gene_id=mCG16694.1 transcript_id=mCT12551.1 created
FT                   on 19-APR-2002"
FT   CDS             4692168..4693133
FT                   /codon_start=1
FT                   /gene="Mrgprh"
FT                   /locus_tag="mCG_16694"
FT                   /product="MAS-related GPR, member H"
FT                   /note="gene_id=mCG16694.1 transcript_id=mCT12551.1
FT                   protein_id=mCP10322.1"
FT                   /db_xref="GOA:W8W3M0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026221"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="UniProtKB/TrEMBL:W8W3M0"
FT                   /protein_id="EDL02042.1"
FT                   /translation="MEPLAMTLYPLESTQPTRNKTPNETTWSSEHTDDHTYFLVSLVIC
FT                   SLGLAGNGLLIWFLIFCIKRKPFTIYILHLAIADFMVLLCSSIMKLVNTFHIYNMTLES
FT                   YAILFMIFGYNTGLHLLTAISVERCLSVLYPIWYQCQRPKHQSAVACMLLWALSVLVSG
FT                   LENFFCILEVKPQFPECRYVYIFSCILTFLVFVPLMIFSNLILFIQVCCNLKPRQPTKL
FT                   YVIIMTTVILFLVFAMPMKVLLIIGYYSSSLDDSVWDSLPYLNMLSTINCSINPIVYFV
FT                   VGSLRRKRSRKSLKEALQKVFEEKPVVASRENVTQFSLPS"
FT   gene            complement(4704023..4710889)
FT                   /pseudo
FT                   /locus_tag="mCG_16691"
FT                   /note="gene_id=mCG16691.1"
FT   mRNA            complement(join(4704023..4704261,4705368..4705466,
FT                   4705571..4705746,4706013..4706112,4707428..4707470,
FT                   4707612..4707665,4708051..4708115,4709652..4709707,
FT                   4710804..4710889))
FT                   /pseudo
FT                   /locus_tag="mCG_16691"
FT                   /note="gene_id=mCG16691.1 transcript_id=mCT12550.2 created
FT                   on 19-APR-2002"
FT   gene            complement(4714417..>4724856)
FT                   /locus_tag="mCG_121400"
FT                   /note="gene_id=mCG121400.1"
FT   mRNA            complement(join(4714417..4714621,4714786..4714862,
FT                   4718153..4718253,4720451..4720539,4720707..4720830,
FT                   4721443..4721482,4723998..4724071,4724407..4724464,
FT                   4724781..>4724856))
FT                   /locus_tag="mCG_121400"
FT                   /product="mCG121400, transcript variant mCT122602"
FT                   /note="gene_id=mCG121400.1 transcript_id=mCT122602.1
FT                   created on 19-APR-2002"
FT   CDS             complement(join(4714418..4714621,4714786..4714862,
FT                   4718153..4718253,4720451..4720539,4720707..4720830,
FT                   4721443..4721482,4723998..4724071,4724407..4724464,
FT                   4724781..4724856))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121400"
FT                   /product="mCG121400, isoform CRA_a"
FT                   /note="gene_id=mCG121400.1 transcript_id=mCT122602.1
FT                   protein_id=mCP85681.1 isoform=CRA_a"
FT                   /protein_id="EDL02040.1"
FT                   /translation="MDVGADEFEQSLPLLQELVAGADFVGLDIEFTGLRSNLSRPQQIS
FT                   LFDLPSEWYLKTRQSVQQFTICQIGLSMFSSIEGESNKYVAHSCNFFLFPTTFGILDSE
FT                   FSFQASSVQFLNQYGFDYNKFLKNGIPYMNEEQEKKIKHSILRGNWRVRSSLDKDQIKV
FT                   VIDKVTQWLDLAEEGDQMTLPGIAGFQAFEVQLVLRQALPNIWTVLKEEWVIVKKVSQP
FT                   QRWYLEHASCDQVSCWKEQILLSARGFSVFFQMLVKAQKVGNSPSLVSAWPFHHLLYF"
FT   mRNA            complement(join(<4715072..4715147,4718153..4718253,
FT                   4720451..4720539,4720707..4720830,4721443..4721482,
FT                   4723998..4724071,4724407..4724464,4724781..>4724838))
FT                   /locus_tag="mCG_121400"
FT                   /product="mCG121400, transcript variant mCT189474"
FT                   /note="gene_id=mCG121400.1 transcript_id=mCT189474.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<4715072..4715147,4718153..4718253,
FT                   4720451..4720539,4720707..4720830,4721443..4721482,
FT                   4723998..4724071,4724407..4724464,4724781..>4724838))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121400"
FT                   /product="mCG121400, isoform CRA_b"
FT                   /note="gene_id=mCG121400.1 transcript_id=mCT189474.0
FT                   protein_id=mCP110460.0 isoform=CRA_b"
FT                   /protein_id="EDL02041.1"
FT                   /translation="EFEQSLPLLQELVAGADFVGLDIEFTGLRSNLSRPQQISLFDLPS
FT                   EWYLKTRQSVQQFTICQIGLSMFSSIEGESNKYVAHSCNFFLFPTTFGILDSEFSFQAS
FT                   SVQFLNQYGFDYNKFLKNGIPYMNEEQEKKIKHSILRGNWRVRSSLDKDQIKVVIDKVT
FT                   QWLDLAEEGDQMTLPGIAVPNRVNIISRKLQKQPHECPQLKSIL"
FT   gene            complement(4726300..4731171)
FT                   /gene="Mrpl18"
FT                   /locus_tag="mCG_16682"
FT                   /note="gene_id=mCG16682.2"
FT   mRNA            complement(join(4726300..4726694,4728715..4728946,
FT                   4730583..4730769,4730892..4731171))
FT                   /gene="Mrpl18"
FT                   /locus_tag="mCG_16682"
FT                   /product="mitochondrial ribosomal protein L18"
FT                   /note="gene_id=mCG16682.2 transcript_id=mCT13060.1 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4726623..4726694,4728715..4728946,
FT                   4730583..4730769,4730892..4730943))
FT                   /codon_start=1
FT                   /gene="Mrpl18"
FT                   /locus_tag="mCG_16682"
FT                   /product="mitochondrial ribosomal protein L18"
FT                   /note="gene_id=mCG16682.2 transcript_id=mCT13060.1
FT                   protein_id=mCP10317.1"
FT                   /protein_id="EDL02039.1"
FT                   /translation="MALRPRFWKCLSVCRKLECGFAALSTSSVPAVQPDVESKENEAVA
FT                   PEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVS
FT                   ASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQN
FT                   AMTESGVMLREPRRIYE"
FT   gene            4731381..4739511
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /note="gene_id=mCG16679.1"
FT   mRNA            join(4731381..4731574,4732989..4733117,4734297..4734394,
FT                   4734761..4734871,4735222..4735403,4735686..4735812,
FT                   4737049..4737224,4737555..4737678,4738164..4738356,
FT                   4738476..4738639,4739206..4739493)
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /product="t-complex protein 1, transcript variant
FT                   mCT167964"
FT                   /note="gene_id=mCG16679.1 transcript_id=mCT167964.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4731406..4731574,4732744..4732829,4732989..4733117,
FT                   4734297..4734394,4734761..4734850,4735308..4735403,
FT                   4735686..4735791)
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /product="t-complex protein 1, transcript variant
FT                   mCT167965"
FT                   /note="gene_id=mCG16679.1 transcript_id=mCT167965.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4731446..4731574,4732744..4732829,4732989..4733117,
FT                   4734297..4734394,4734761..4734868,4735287..4735352)
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /product="t-complex protein 1, transcript variant
FT                   mCT167966"
FT                   /note="gene_id=mCG16679.1 transcript_id=mCT167966.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4731459..4731574,4732744..4732829,4732989..4733117,
FT                   4734297..4734394,4734761..4734871,4735222..4735403,
FT                   4735686..4735812,4737049..4737224,4737555..4737678,
FT                   4738164..4738356,4738476..4738639,4739206..4739511)
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /product="t-complex protein 1, transcript variant mCT13057"
FT                   /note="gene_id=mCG16679.1 transcript_id=mCT13057.0 created
FT                   on 19-APR-2002"
FT   CDS             join(4731511..4731574,4732744..4732829,4732989..4733117,
FT                   4734297..4734394,4734761..4734871,4735222..4735403,
FT                   4735686..4735812,4737049..4737224,4737555..4737678,
FT                   4738164..4738356,4738476..4738639,4739206..4739422)
FT                   /codon_start=1
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /product="t-complex protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16679.1 transcript_id=mCT13057.0
FT                   protein_id=mCP10315.1 isoform=CRA_a"
FT                   /protein_id="EDL02035.1"
FT                   /translation="MEGPLSVFGDRSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKML
FT                   VDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNA
FT                   DELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAKTSMSSKIIGI
FT                   NGDYFANMVVDAVLAVKYTDARGQPRYPVNSVNILKAHGRSQIESMLINGYALNCVVGS
FT                   QGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILAT
FT                   GANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILSTLANLEGEETF
FT                   EVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVV
FT                   KRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQ
FT                   DSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFA
FT                   TEAAITILRIDDLIKLHPESKDDKHGSYENAVHSGALDD"
FT   CDS             join(4731511..4731574,4732744..4732829,4732989..4733117,
FT                   4734297..4734394,4734761..4734868,4735287..4735320)
FT                   /codon_start=1
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /product="t-complex protein 1, isoform CRA_d"
FT                   /note="gene_id=mCG16679.1 transcript_id=mCT167966.0
FT                   protein_id=mCP90951.0 isoform=CRA_d"
FT                   /protein_id="EDL02038.1"
FT                   /translation="MEGPLSVFGDRSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKML
FT                   VDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNA
FT                   DELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAKTSMSSKIIGR
FT                   PASLSSQFC"
FT   CDS             join(4731511..4731574,4732744..4732829,4732989..4733117,
FT                   4734297..4734394,4734761..4734850,4735308..4735320)
FT                   /codon_start=1
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /product="t-complex protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG16679.1 transcript_id=mCT167965.0
FT                   protein_id=mCP90959.0 isoform=CRA_c"
FT                   /protein_id="EDL02037.1"
FT                   /translation="MEGPLSVFGDRSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKML
FT                   VDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNA
FT                   DELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAKTSIQFC"
FT   CDS             join(4731572..4731574,4732989..4733117,4734297..4734394,
FT                   4734761..4734871,4735222..4735403,4735686..4735812,
FT                   4737049..4737224,4737555..4737678,4738164..4738356,
FT                   4738476..4738639,4739206..4739422)
FT                   /codon_start=1
FT                   /gene="Tcp1"
FT                   /locus_tag="mCG_16679"
FT                   /product="t-complex protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG16679.1 transcript_id=mCT167964.0
FT                   protein_id=mCP90949.0 isoform=CRA_b"
FT                   /protein_id="EDL02036.1"
FT                   /translation="MDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVV
FT                   IIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAK
FT                   TSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNSVNILKAHGRSQIESMLIN
FT                   GYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDIT
FT                   KERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILST
FT                   LANLEGEETFEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEME
FT                   RSLHDALCVVKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVI
FT                   PNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPT
FT                   IVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYENAVHSGALDD"
FT   gene            complement(4738988..4755308)
FT                   /locus_tag="mCG_16687"
FT                   /note="gene_id=mCG16687.2"
FT   mRNA            complement(join(4738988..4739180,4742297..4742406,
FT                   4743441..4743584,4744500..4744617,4749762..4749943,
FT                   4754815..4754949,4755187..4755295))
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, transcript variant mCT167976"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167976.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4739178..4739180,4742297..4742406,
FT                   4743441..4743584,4744500..4744617,4749762..4749943,
FT                   4754815..4754949,4755187..4755241))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, isoform CRA_c"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167976.0
FT                   protein_id=mCP90954.0 isoform=CRA_c"
FT                   /protein_id="EDL02031.1"
FT                   /translation="MNTRSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRA
FT                   KVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQ
FT                   SIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRVGEVPLADSILCDGLTDAFHNYHMGIT
FT                   AENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFP
FT                   RHGSNLEAMGKLKPYFLTDGTGTVTT"
FT   mRNA            complement(join(4739202..4739776,4740214..4740324,
FT                   4741324..4741478,4742284..4742406,4743441..4743584,
FT                   4744500..4744617,4749762..4749943,4754815..4754949,
FT                   4755187..4755308))
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, transcript variant mCT12546"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT12546.1 created
FT                   on 18-APR-2002"
FT   mRNA            complement(join(4739202..4739776,4740214..4740324,
FT                   4741324..4741478,4742284..4742406,4743441..4743593,
FT                   4749809..4749943,4754815..4754949,4755187..4755295))
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, transcript variant mCT167977"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167977.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4739202..4739776,4740214..4740324,
FT                   4741324..4741478,4742284..4742406,4744500..4744617,
FT                   4749762..4749943,4754815..4754949,4755187..4755295))
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, transcript variant mCT167978"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167978.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4739379..4739776,4740214..4740324,
FT                   4741324..4741478,4742284..4742628))
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, transcript variant mCT167974"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167974.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4739606..4739776,4740214..4740324,
FT                   4741324..4741478,4742284..4742406,4743441..4743593,
FT                   4749809..4749943,4754815..4754949,4755187..4755241))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, isoform CRA_d"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167977.0
FT                   protein_id=mCP90936.0 isoform=CRA_d"
FT                   /protein_id="EDL02032.1"
FT                   /translation="MNTRSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRA
FT                   KVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQ
FT                   SIAMVFSAENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTE
FT                   VKIDEFPRHGSNLEAMGKLKPYFLTDGTGTVTTANATGMNDGAAAVVLMKKTEAERRML
FT                   KPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAYAALSVAIAK
FT                   ELGLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGGMGVAM
FT                   CVQRG"
FT   CDS             complement(join(4739606..4739776,4740214..4740324,
FT                   4741324..4741478,4742284..4742406,4744500..4744617,
FT                   4749762..4749943,4754815..4754949,4755187..4755241))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, isoform CRA_e"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167978.0
FT                   protein_id=mCP90945.0 isoform=CRA_e"
FT                   /protein_id="EDL02033.1"
FT                   /translation="MNTRSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRA
FT                   KVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQ
FT                   SIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRVGEVPLADSILCDGLTDAFHNYHMGIT
FT                   GLTEVKIDEFPRHGSNLEAMGKLKPYFLTDGTGTVTTANATGMNDGAAAVVLMKKTEAE
FT                   RRMLKPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAYAALSV
FT                   AIAKELGLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGGM
FT                   GVAMCVQRG"
FT   CDS             complement(join(4739606..4739776,4740214..4740324,
FT                   4741324..4741478,4742284..4742406,4743441..4743584,
FT                   4744500..4744617,4749762..4749943,4754815..4754949,
FT                   4755187..4755241))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, isoform CRA_f"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT12546.1
FT                   protein_id=mCP10325.2 isoform=CRA_f"
FT                   /protein_id="EDL02034.1"
FT                   /translation="MNTRSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRA
FT                   KVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQ
FT                   SIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRVGEVPLADSILCDGLTDAFHNYHMGIT
FT                   AENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFP
FT                   RHGSNLEAMGKLKPYFLTDGTGTVTTANATGMNDGAAAVVLMKKTEAERRMLKPLARIV
FT                   SWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAYAALSVAIAKELGLNPE
FT                   KVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGGMGVAMCVQRG"
FT   CDS             complement(join(4739606..4739776,4740214..4740324,
FT                   4741324..4741478,4742284..4742350))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, isoform CRA_a"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167974.0
FT                   protein_id=mCP90938.0 isoform=CRA_a"
FT                   /protein_id="EDL02029.1"
FT                   /translation="MGKLKPYFLTDGTGTVTTANATGMNDGAAAVVLMKKTEAERRMLK
FT                   PLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAYAALSVAIAKE
FT                   LGLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGGMGVAMC
FT                   VQRG"
FT   mRNA            complement(join(4743510..4743591,4749805..4749943,
FT                   4754815..4754958))
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, transcript variant mCT167975"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167975.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4743573..4743591,4749805..4749943,
FT                   4754815..4754908))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16687"
FT                   /product="mCG16687, isoform CRA_b"
FT                   /note="gene_id=mCG16687.2 transcript_id=mCT167975.0
FT                   protein_id=mCP90940.0 isoform=CRA_b"
FT                   /protein_id="EDL02030.1"
FT                   /translation="MGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGA
FT                   GIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSQLKT"
FT   gene            complement(4757821..4775658)
FT                   /locus_tag="mCG_16689"
FT                   /note="gene_id=mCG16689.1"
FT   mRNA            complement(join(4757821..4758959,4759327..4759437,
FT                   4761188..4761342,4762284..4762406,4763441..4763584,
FT                   4767179..4767296,4771146..4771327,4774926..4775060,
FT                   4775540..4775658))
FT                   /locus_tag="mCG_16689"
FT                   /product="mCG16689, transcript variant mCT12548"
FT                   /note="gene_id=mCG16689.1 transcript_id=mCT12548.2 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(4757968..4758959,4759327..4759437,
FT                   4761188..4761342,4762284..4762406,4763441..4763584,
FT                   4767179..4767296,4771146..4771327,4774926..4775248))
FT                   /locus_tag="mCG_16689"
FT                   /product="mCG16689, transcript variant mCT175001"
FT                   /note="gene_id=mCG16689.1 transcript_id=mCT175001.0 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(4758789..4758959,4759327..4759437,
FT                   4761188..4761342,4762284..4762406,4763441..4763584,
FT                   4767179..4767296,4771146..4771327,4774926..4775019))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16689"
FT                   /product="mCG16689, isoform CRA_a"
FT                   /note="gene_id=mCG16689.1 transcript_id=mCT12548.2
FT                   protein_id=mCP10327.2 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA25"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="MGI:MGI:87871"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA25"
FT                   /protein_id="EDL02025.1"
FT                   /translation="MGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGA
FT                   GIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLTHLRTGVR
FT                   MGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVLSQNRAEHAQKA
FT                   GHFDKEIVPVLVSSRKGLTEVKIDEFPRHGSNLEAMGKLKPYFLTDGTGTVTPANASGM
FT                   NDGAAAVVLMKKTEAERRMLKPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLE
FT                   DVDLFEINEAFAAVSAAIAKELGLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLER
FT                   VGGTRGVAALCIGGGMGVAMCVQRG"
FT   CDS             complement(join(4758789..4758959,4759327..4759437,
FT                   4761188..4761342,4762284..4762406,4763441..4763584,
FT                   4767179..4767296,4771146..4771327,4774926..4775019))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16689"
FT                   /product="mCG16689, isoform CRA_a"
FT                   /note="gene_id=mCG16689.1 transcript_id=mCT175001.0
FT                   protein_id=mCP97920.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA25"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="MGI:MGI:87871"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA25"
FT                   /protein_id="EDL02028.1"
FT                   /translation="MGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGA
FT                   GIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLTHLRTGVR
FT                   MGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVLSQNRAEHAQKA
FT                   GHFDKEIVPVLVSSRKGLTEVKIDEFPRHGSNLEAMGKLKPYFLTDGTGTVTPANASGM
FT                   NDGAAAVVLMKKTEAERRMLKPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLE
FT                   DVDLFEINEAFAAVSAAIAKELGLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLER
FT                   VGGTRGVAALCIGGGMGVAMCVQRG"
FT   mRNA            complement(join(4759330..4759437,4761188..4761342,
FT                   4761743..4761794,4762284..4762406,4763441..4763584,
FT                   4767179..4767296,4771146..4771327,4774926..4775060,
FT                   4775540..4775629))
FT                   /locus_tag="mCG_16689"
FT                   /product="mCG16689, transcript variant mCT175002"
FT                   /note="gene_id=mCG16689.1 transcript_id=mCT175002.0 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(4761696..4762406,4763441..4763584,
FT                   4767179..4767296,4771146..4771327,4774926..4775211))
FT                   /locus_tag="mCG_16689"
FT                   /product="mCG16689, transcript variant mCT175003"
FT                   /note="gene_id=mCG16689.1 transcript_id=mCT175003.0 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(4761757..4761794,4762284..4762406,
FT                   4763441..4763584,4767179..4767296,4771146..4771327,
FT                   4774926..4775060,4775540..4775594))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16689"
FT                   /product="mCG16689, isoform CRA_b"
FT                   /note="gene_id=mCG16689.1 transcript_id=mCT175002.0
FT                   protein_id=mCP97922.0 isoform=CRA_b"
FT                   /protein_id="EDL02026.1"
FT                   /translation="MNAGSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRA
FT                   KVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQ
FT                   SIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRMGEVPLADSILCDGLTDAFHNYHMGIT
FT                   AENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFP
FT                   RHGSNLEAMGKLKPYFLTDGTGTVTPANASGLHREERKKKSP"
FT   CDS             complement(join(4762171..4762406,4763441..4763584,
FT                   4767179..4767296,4771146..4771327,4774926..4775019))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16689"
FT                   /product="mCG16689, isoform CRA_c"
FT                   /note="gene_id=mCG16689.1 transcript_id=mCT175003.0
FT                   protein_id=mCP97921.0 isoform=CRA_c"
FT                   /protein_id="EDL02027.1"
FT                   /translation="MGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGA
FT                   GIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLTHLRTGVR
FT                   MGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVLSQNRAEHAQKA
FT                   GHFDKEIVPVLVSSRKGLTEVKIDEFPRHGSNLEAMGKLKPYFLTDGTGTVTPANASGL
FT                   SSEGHWGKYQLCGGLPSEYVFLHNMIPKTGFREHL"
FT   gene            complement(4781730..4810566)
FT                   /locus_tag="mCG_16685"
FT                   /note="gene_id=mCG16685.1"
FT   mRNA            complement(join(4781730..4782982,4784336..4784490,
FT                   4790257..4790435,4797225..4797352,4798150..4798208,
FT                   4799857..4799912,4801178..4801251,4802316..4802333))
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, transcript variant mCT167973"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT167973.0 created
FT                   on 27-MAY-2002"
FT   mRNA            complement(join(4781777..4782982,4784336..4784490,
FT                   4790257..4790435,4797225..4797352,4798150..4798208,
FT                   4799857..4799912,4802316..4802641))
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, transcript variant mCT167972"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT167972.0 created
FT                   on 27-MAY-2002"
FT   mRNA            complement(join(4781930..4782982,4784336..4784490,
FT                   4790257..4790435,4797225..4797352,4798150..4798208,
FT                   4799857..4799912,4802316..4802353,4808709..4809512,
FT                   4810463..4810566))
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, transcript variant mCT12544"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT12544.2 created
FT                   on 27-MAY-2002"
FT   CDS             complement(join(4782399..4782982,4784336..4784490,
FT                   4790257..4790435,4797225..4797352,4798150..4798208,
FT                   4799857..4799912,4802316..4802353,4808709..4809135))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, isoform CRA_a"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT12544.2
FT                   protein_id=mCP10319.2 isoform=CRA_a"
FT                   /protein_id="EDL02020.1"
FT                   /translation="MKPLSPRSGTMRGSILSCETAWKSQSRACRLGFLRPGRAAAAGGP
FT                   AELVRQRPSSRDASRVTSDLAGPPFSPAASLPSPAELAEPRRGRCGLPRTVSVRRRRSA
FT                   AASPRPEVPSGAEPAAPRPFSPEAPGAVTEEAPERRVSGCKMTNEEPLPKKVRLSETDF
FT                   KVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILV
FT                   MRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLE
FT                   QAQNELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSE
FT                   ELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQQQQSQASAPSTSRT
FT                   TSSEPVDQAEVTSKDCSRLANGPSNGSSSRQRTSGSGFHREGSTPEDDFPSSSGNGNKA
FT                   SNSSEERTGRGGSSYINPLSAGYESVDSPTGSENSLTHHSNDTDSSHDPQEEKAVSGKG
FT                   NRTVGSRHVQNGLDSNVNVQGAVL"
FT   CDS             complement(join(4782399..4782982,4784336..4784490,
FT                   4790257..4790435,4797225..4797352,4798150..4798208,
FT                   4799857..4799912,4802316..4802345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, isoform CRA_d"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT167972.0
FT                   protein_id=mCP90957.0 isoform=CRA_d"
FT                   /db_xref="GOA:E0CYH0"
FT                   /db_xref="MGI:MGI:1926395"
FT                   /db_xref="UniProtKB/TrEMBL:E0CYH0"
FT                   /protein_id="EDL02023.1"
FT                   /translation="MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYT
FT                   DLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPS
FT                   VAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRM
FT                   LIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTI
FT                   LVLQQQLKETRQQLAQYQQQQSQASAPSTSRTTSSEPVDQAEVTSKDCSRLANGPSNGS
FT                   SSRQRTSGSGFHREGSTPEDDFPSSSGNGNKASNSSEERTGRGGSSYINPLSAGYESVD
FT                   SPTGSENSLTHHSNDTDSSHDPQEEKAVSGKGNRTVGSRHVQNGLDSNVNVQGAVL"
FT   CDS             complement(join(4782399..4782982,4784336..4784490,
FT                   4790257..4790435,4797225..4797352,4798150..4798208,
FT                   4799857..4799912,4801178..4801201))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, isoform CRA_e"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT167973.0
FT                   protein_id=mCP90935.0 isoform=CRA_e"
FT                   /protein_id="EDL02024.1"
FT                   /translation="MGSDAPLQVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDL
FT                   NSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVA
FT                   QLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRMLI
FT                   QENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILV
FT                   LQQQLKETRQQLAQYQQQQSQASAPSTSRTTSSEPVDQAEVTSKDCSRLANGPSNGSSS
FT                   RQRTSGSGFHREGSTPEDDFPSSSGNGNKASNSSEERTGRGGSSYINPLSAGYESVDSP
FT                   TGSENSLTHHSNDTDSSHDPQEEKAVSGKGNRTVGSRHVQNGLDSNVNVQGAVL"
FT   mRNA            complement(join(4784058..4790435,4797225..4797352,
FT                   4798150..4798208,4799857..4799912,4802316..4802353,
FT                   4808477..4808600))
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, transcript variant mCT167970"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT167970.0 created
FT                   on 27-MAY-2002"
FT   mRNA            complement(join(4789202..4790435,4797225..4797352,
FT                   4798150..4798208,4799857..4799912,4802316..4802353,
FT                   4808709..4809483))
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, transcript variant mCT167971"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT167971.0 created
FT                   on 27-MAY-2002"
FT   CDS             complement(join(4790253..4790435,4797225..4797352,
FT                   4798150..4798208,4799857..4799912,4802316..4802353,
FT                   4808709..4809135))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, isoform CRA_c"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT167971.0
FT                   protein_id=mCP90950.0 isoform=CRA_c partial"
FT                   /protein_id="EDL02022.1"
FT                   /translation="MKPLSPRSGTMRGSILSCETAWKSQSRACRLGFLRPGRAAAAGGP
FT                   AELVRQRPSSRDASRVTSDLAGPPFSPAASLPSPAELAEPRRGRCGLPRTVSVRRRRSA
FT                   AASPRPEVPSGAEPAAPRPFSPEAPGAVTEEAPERRVSGCKMTNEEPLPKKVRLSETDF
FT                   KVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILV
FT                   MRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLE
FT                   QAQNELSAWKFTPDR"
FT   CDS             complement(join(4790253..4790435,4797225..4797352,
FT                   4798150..4798208,4799857..4799912,4802316..4802345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16685"
FT                   /product="mCG16685, isoform CRA_b"
FT                   /note="gene_id=mCG16685.1 transcript_id=mCT167970.0
FT                   protein_id=mCP90943.0 isoform=CRA_b partial"
FT                   /protein_id="EDL02021.1"
FT                   /translation="MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYT
FT                   DLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPS
FT                   VAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR"
FT   gene            4824279..4831984
FT                   /gene="Sod2"
FT                   /locus_tag="mCG_16695"
FT                   /note="gene_id=mCG16695.2"
FT   mRNA            join(4824279..4824448,4824564..4824766,4826900..4827016,
FT                   4829812..4829991,4831405..4831984)
FT                   /gene="Sod2"
FT                   /locus_tag="mCG_16695"
FT                   /product="superoxide dismutase 2, mitochondrial, transcript
FT                   variant mCT12554"
FT                   /note="gene_id=mCG16695.2 transcript_id=mCT12554.1 created
FT                   on 19-APR-2002"
FT   mRNA            join(4824279..4824448,4824564..4824766,4826900..4827234)
FT                   /gene="Sod2"
FT                   /locus_tag="mCG_16695"
FT                   /product="superoxide dismutase 2, mitochondrial, transcript
FT                   variant mCT167991"
FT                   /note="gene_id=mCG16695.2 transcript_id=mCT167991.0 created
FT                   on 19-APR-2002"
FT   CDS             join(4824426..4824448,4824564..4824766,4826900..4827016,
FT                   4829812..4829991,4831405..4831550)
FT                   /codon_start=1
FT                   /gene="Sod2"
FT                   /locus_tag="mCG_16695"
FT                   /product="superoxide dismutase 2, mitochondrial, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16695.2 transcript_id=mCT12554.1
FT                   protein_id=mCP10311.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FJX9"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="MGI:MGI:98352"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJX9"
FT                   /protein_id="EDL02018.1"
FT                   /translation="MLCRAACSTGRRLGPVAGAAGSRHKHSLPDLPYDYGALEPHINAQ
FT                   IMQLHHSKHHAAYVNNLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTN
FT                   LSPKGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAA
FT                   CSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYTACKK
FT                   "
FT   CDS             join(4824426..4824448,4824564..4824766,4826900..4827135)
FT                   /codon_start=1
FT                   /gene="Sod2"
FT                   /locus_tag="mCG_16695"
FT                   /product="superoxide dismutase 2, mitochondrial, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16695.2 transcript_id=mCT167991.0
FT                   protein_id=mCP90942.0 isoform=CRA_b"
FT                   /protein_id="EDL02019.1"
FT                   /translation="MLCRAACSTGRRLGPVAGAAGSRHKHSLPDLPYDYGALEPHINAQ
FT                   IMQLHHSKHHAAYVNNLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTN
FT                   LSPKGGGEPKGWYKLLQLHIWWTVGMIDVFSFFKIYLFIICTLLYATTL"
FT   assembly_gap    17034..17186
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    40092..40805
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    52052..52071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    61228..61273
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    70114..71101
FT                   /estimated_length=988
FT                   /gap_type="unknown"
FT   assembly_gap    81569..81680
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    85387..85864
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    89174..90106
FT                   /estimated_length=933
FT                   /gap_type="unknown"
FT   assembly_gap    91148..91315
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    115295..115314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    133765..135114
FT                   /estimated_length=1350
FT                   /gap_type="unknown"
FT   assembly_gap    161024..161884
FT                   /estimated_length=861
FT                   /gap_type="unknown"
FT   assembly_gap    167690..167709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    168789..168808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    170072..170091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    171320..171339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    172642..172661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    174349..174881
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    177122..177563
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    179137..179156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    180213..181942
FT                   /estimated_length=1730
FT                   /gap_type="unknown"
FT   assembly_gap    191839..192094
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    202952..203796
FT                   /estimated_length=845
FT                   /gap_type="unknown"
FT   assembly_gap    213288..213307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    225672..225691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    227639..228342
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    229515..229958
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    247844..248130
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    251670..251911
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    255326..257430
FT                   /estimated_length=2105
FT                   /gap_type="unknown"
FT   assembly_gap    275659..275678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    287005..287075
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    292231..295632
FT                   /estimated_length=3402
FT                   /gap_type="unknown"
FT   assembly_gap    322828..323071
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    342702..342721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    348876..349374
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    356142..356161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    403770..403789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    404829..404848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    405913..405932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    419263..419356
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    420728..420747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    452065..452084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    458791..458810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    461340..461359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    492579..493161
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    498144..498163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    522354..527666
FT                   /estimated_length=5313
FT                   /gap_type="unknown"
FT   assembly_gap    528087..528109
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    549823..549842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    581417..581635
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    583200..584096
FT                   /estimated_length=897
FT                   /gap_type="unknown"
FT   assembly_gap    585252..587202
FT                   /estimated_length=1951
FT                   /gap_type="unknown"
FT   assembly_gap    589031..589437
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    590859..591128
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    616579..616674
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    619219..619238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    620508..620527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    627755..628219
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   assembly_gap    640480..640499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    657037..657252
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    708977..708996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    713268..713287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    736291..737195
FT                   /estimated_length=905
FT                   /gap_type="unknown"
FT   assembly_gap    739481..739682
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    741801..741820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    743125..743498
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    744379..747029
FT                   /estimated_length=2651
FT                   /gap_type="unknown"
FT   assembly_gap    763647..764067
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    805935..805954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    807091..807178
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    845463..845482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    849082..849101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    850430..850449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    853993..854012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    858791..859093
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    861542..861908
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    879560..879579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    881485..881504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    886904..886923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    898246..898289
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    928327..928678
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    935880..935899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    945641..946060
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    964403..964422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    967920..968025
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    970016..970193
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    975070..975089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    991005..991024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1020811..1020912
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1034999..1035435
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    1060008..1060053
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1093254..1093273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1111078..1111097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1119377..1119527
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1134255..1134471
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    1139024..1139043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1163596..1164111
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    1178704..1178966
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    1184970..1185005
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    1192535..1193643
FT                   /estimated_length=1109
FT                   /gap_type="unknown"
FT   assembly_gap    1196744..1201228
FT                   /estimated_length=4485
FT                   /gap_type="unknown"
FT   assembly_gap    1202704..1203076
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    1242979..1243085
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    1244749..1244783
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    1245947..1245966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1283906..1283925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1303544..1303563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1305561..1305580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1324254..1329121
FT                   /estimated_length=4868
FT                   /gap_type="unknown"
FT   assembly_gap    1349143..1349287
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1351110..1351275
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    1357134..1357153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1408007..1408026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1412273..1412564
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    1428465..1428772
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    1464053..1464184
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    1465083..1465158
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    1496809..1496993
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    1510169..1510190
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    1528743..1528981
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    1530349..1530368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1531624..1531643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1532827..1533219
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    1580762..1582074
FT                   /estimated_length=1313
FT                   /gap_type="unknown"
FT   assembly_gap    1596346..1596365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1604488..1607366
FT                   /estimated_length=2879
FT                   /gap_type="unknown"
FT   assembly_gap    1615313..1615697
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    1653349..1653368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1673781..1673815
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    1685618..1686165
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    1689695..1689772
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    1696416..1696435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1710016..1710035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1727801..1727820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1741063..1741402
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    1808079..1808098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1823222..1823539
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    1824474..1824501
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1832880..1833030
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1837433..1837534
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1846863..1847042
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    1855692..1855711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1857210..1857229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1893045..1893064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1912486..1913007
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    1915064..1915272
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    1953552..1953887
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    1954911..1954930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1956168..1956187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1976014..1976139
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    1979724..1979766
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    1980394..1980580
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    2032940..2033906
FT                   /estimated_length=967
FT                   /gap_type="unknown"
FT   assembly_gap    2055856..2055875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2056942..2057255
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    2063120..2063217
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    2071328..2071353
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    2097630..2097649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2147211..2148854
FT                   /estimated_length=1644
FT                   /gap_type="unknown"
FT   assembly_gap    2159829..2159848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2173183..2173511
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    2198932..2202454
FT                   /estimated_length=3523
FT                   /gap_type="unknown"
FT   assembly_gap    2213135..2213154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2286544..2286563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2288214..2288335
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    2330617..2330636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2398476..2398495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2419749..2419771
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    2556054..2556127
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    2571649..2571837
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    2668511..2668530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2723512..2723677
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    2775636..2788951
FT                   /estimated_length=13316
FT                   /gap_type="unknown"
FT   assembly_gap    2791540..2796607
FT                   /estimated_length=5068
FT                   /gap_type="unknown"
FT   assembly_gap    2811454..2829261
FT                   /estimated_length=17808
FT                   /gap_type="unknown"
FT   assembly_gap    2871696..2871715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2918952..2920622
FT                   /estimated_length=1671
FT                   /gap_type="unknown"
FT   assembly_gap    3112666..3119819
FT                   /estimated_length=7154
FT                   /gap_type="unknown"
FT   assembly_gap    3121783..3121802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3123207..3123226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3124318..3124337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3140440..3140564
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    3149643..3150223
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    3153543..3153562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3195897..3196385
FT                   /estimated_length=489
FT                   /gap_type="unknown"
FT   assembly_gap    3202286..3206746
FT                   /estimated_length=4461
FT                   /gap_type="unknown"
FT   assembly_gap    3207942..3207961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3272429..3272611
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    3287004..3287023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3316517..3316536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3334364..3334383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3345422..3346666
FT                   /estimated_length=1245
FT                   /gap_type="unknown"
FT   assembly_gap    3385059..3385078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3398988..3399007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3420176..3420195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3448628..3448877
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    3474089..3474789
FT                   /estimated_length=701
FT                   /gap_type="unknown"
FT   assembly_gap    3476901..3477032
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    3485655..3485674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3492214..3494706
FT                   /estimated_length=2493
FT                   /gap_type="unknown"
FT   assembly_gap    3508833..3508852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3515984..3516003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3523598..3524023
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    3529558..3529577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3579890..3579909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3589785..3590472
FT                   /estimated_length=688
FT                   /gap_type="unknown"
FT   assembly_gap    3591617..3591636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3592823..3592842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3598265..3598284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3599509..3599528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3600579..3600598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3611424..3611443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3630290..3630343
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    3633048..3633067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3648205..3648278
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    3659045..3659064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3660319..3661280
FT                   /estimated_length=962
FT                   /gap_type="unknown"
FT   assembly_gap    3706651..3706670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3709866..3709885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3740283..3740307
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    3790088..3790800
FT                   /estimated_length=713
FT                   /gap_type="unknown"
FT   assembly_gap    3818347..3818366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3843410..3843704
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    3850714..3850950
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    3856947..3856966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3891061..3891252
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    3900932..3900951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3910345..3910364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3926164..3926301
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    3929118..3929137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3939489..3939508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3945696..3945715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3948525..3948544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3997754..3998216
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    4001295..4001314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4003095..4003114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4017226..4017278
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    4018576..4019770
FT                   /estimated_length=1195
FT                   /gap_type="unknown"
FT   assembly_gap    4040363..4040382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4040894..4040913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4052153..4052172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4085799..4091882
FT                   /estimated_length=6084
FT                   /gap_type="unknown"
FT   assembly_gap    4093844..4093863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4099703..4100527
FT                   /estimated_length=825
FT                   /gap_type="unknown"
FT   assembly_gap    4102402..4102421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4173064..4173083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4174519..4175912
FT                   /estimated_length=1394
FT                   /gap_type="unknown"
FT   assembly_gap    4243335..4243491
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    4245102..4245121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4299650..4301133
FT                   /estimated_length=1484
FT                   /gap_type="unknown"
FT   assembly_gap    4324975..4324994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4326758..4326923
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4331634..4331664
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    4343462..4343481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4364579..4364684
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    4373814..4374240
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    4375836..4375855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4403738..4403882
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    4412045..4412144
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    4413569..4413588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4430078..4430097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4436191..4438219
FT                   /estimated_length=2029
FT                   /gap_type="unknown"
FT   assembly_gap    4439525..4440926
FT                   /estimated_length=1402
FT                   /gap_type="unknown"
FT   assembly_gap    4443088..4443107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4444743..4444762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4466634..4466668
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    4481765..4481784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4487346..4487365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4492780..4492822
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    4542575..4542634
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    4789764..4789783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01130880.1:1..17033),gap(153),
CO   complement(AAHY01130881.1:1..22905),gap(714),
CO   complement(AAHY01130882.1:1..11246),gap(20),AAHY01130883.1:1..9156,gap(46),
CO   complement(AAHY01130884.1:1..8840),gap(988),
CO   complement(AAHY01130885.1:1..10467),gap(112),
CO   complement(AAHY01130886.1:1..3706),gap(478),
CO   complement(AAHY01130887.1:1..3309),gap(933),
CO   complement(AAHY01130888.1:1..1041),gap(168),
CO   complement(AAHY01130889.1:1..23979),gap(20),
CO   complement(AAHY01130890.1:1..18450),gap(1350),
CO   complement(AAHY01130891.1:1..25909),gap(861),AAHY01130892.1:1..5805,
CO   gap(20),AAHY01130893.1:1..1079,gap(20),complement(AAHY01130894.1:1..1263),
CO   gap(20),AAHY01130895.1:1..1228,gap(20),AAHY01130896.1:1..1302,gap(20),
CO   AAHY01130897.1:1..1687,gap(533),complement(AAHY01130898.1:1..2240),
CO   gap(442),AAHY01130899.1:1..1573,gap(20),AAHY01130900.1:1..1056,gap(1730),
CO   complement(AAHY01130901.1:1..9896),gap(256),
CO   complement(AAHY01130902.1:1..10857),gap(845),
CO   complement(AAHY01130903.1:1..9491),gap(20),
CO   complement(AAHY01130904.1:1..12364),gap(20),
CO   complement(AAHY01130905.1:1..1947),gap(704),
CO   complement(AAHY01130906.1:1..1172),gap(444),
CO   complement(AAHY01130907.1:1..17885),gap(287),
CO   complement(AAHY01130908.1:1..3539),gap(242),
CO   complement(AAHY01130909.1:1..3414),gap(2105),AAHY01130910.1:1..18228,
CO   gap(20),complement(AAHY01130911.1:1..11326),gap(71),
CO   complement(AAHY01130912.1:1..5155),gap(3402),AAHY01130913.1:1..27195,
CO   gap(244),AAHY01130914.1:1..19630,gap(20),AAHY01130915.1:1..6154,gap(499),
CO   AAHY01130916.1:1..6767,gap(20),complement(AAHY01130917.1:1..47608),gap(20),
CO   AAHY01130918.1:1..1039,gap(20),complement(AAHY01130919.1:1..1064),gap(20),
CO   complement(AAHY01130920.1:1..13330),gap(94),
CO   complement(AAHY01130921.1:1..1371),gap(20),AAHY01130922.1:1..31317,gap(20),
CO   complement(AAHY01130923.1:1..6706),gap(20),
CO   complement(AAHY01130924.1:1..2529),gap(20),
CO   complement(AAHY01130925.1:1..31219),gap(583),
CO   complement(AAHY01130926.1:1..4982),gap(20),
CO   complement(AAHY01130927.1:1..24190),gap(5313),AAHY01130928.1:1..420,
CO   gap(23),complement(AAHY01130929.1:1..21713),gap(20),
CO   AAHY01130930.1:1..31574,gap(219),complement(AAHY01130931.1:1..1564),
CO   gap(897),AAHY01130932.1:1..1155,gap(1951),AAHY01130933.1:1..1828,gap(407),
CO   complement(AAHY01130934.1:1..1421),gap(270),
CO   complement(AAHY01130935.1:1..25450),gap(96),AAHY01130936.1:1..2544,gap(20),
CO   AAHY01130937.1:1..1269,gap(20),AAHY01130938.1:1..7227,gap(465),
CO   AAHY01130939.1:1..12260,gap(20),complement(AAHY01130940.1:1..16537),
CO   gap(216),complement(AAHY01130941.1:1..51724),gap(20),
CO   AAHY01130942.1:1..4271,gap(20),AAHY01130943.1:1..23003,gap(905),
CO   AAHY01130944.1:1..2285,gap(202),AAHY01130945.1:1..2118,gap(20),
CO   complement(AAHY01130946.1:1..1304),gap(374),
CO   complement(AAHY01130947.1:1..880),gap(2651),
CO   complement(AAHY01130948.1:1..16617),gap(421),
CO   complement(AAHY01130949.1:1..41867),gap(20),AAHY01130950.1:1..1136,gap(88),
CO   complement(AAHY01130951.1:1..38284),gap(20),
CO   complement(AAHY01130952.1:1..3599),gap(20),
CO   complement(AAHY01130953.1:1..1328),gap(20),
CO   complement(AAHY01130954.1:1..3543),gap(20),
CO   complement(AAHY01130955.1:1..4778),gap(303),AAHY01130956.1:1..2448,
CO   gap(367),complement(AAHY01130957.1:1..17651),gap(20),
CO   AAHY01130958.1:1..1905,gap(20),complement(AAHY01130959.1:1..5399),gap(20),
CO   AAHY01130960.1:1..11322,gap(44),AAHY01130961.1:1..30037,gap(352),
CO   AAHY01130962.1:1..7201,gap(20),complement(AAHY01130963.1:1..9741),gap(420),
CO   AAHY01130964.1:1..18342,gap(20),complement(AAHY01130965.1:1..3497),
CO   gap(106),AAHY01130966.1:1..1990,gap(178),AAHY01130967.1:1..4876,gap(20),
CO   AAHY01130968.1:1..15915,gap(20),complement(AAHY01130969.1:1..29786),
CO   gap(102),complement(AAHY01130970.1:1..14086),gap(437),
CO   AAHY01130971.1:1..24572,gap(46),complement(AAHY01130972.1:1..33200),
CO   gap(20),AAHY01130973.1:1..17804,gap(20),AAHY01130974.1:1..8279,gap(151),
CO   complement(AAHY01130975.1:1..14727),gap(217),AAHY01130976.1:1..4552,
CO   gap(20),complement(AAHY01130977.1:1..24552),gap(516),
CO   complement(AAHY01130978.1:1..14592),gap(263),
CO   complement(AAHY01130979.1:1..6003),gap(36),
CO   complement(AAHY01130980.1:1..7529),gap(1109),
CO   complement(AAHY01130981.1:1..3100),gap(4485),
CO   complement(AAHY01130982.1:1..1475),gap(373),
CO   complement(AAHY01130983.1:1..39902),gap(107),
CO   complement(AAHY01130984.1:1..1663),gap(35),
CO   complement(AAHY01130985.1:1..1163),gap(20),
CO   complement(AAHY01130986.1:1..37939),gap(20),
CO   complement(AAHY01130987.1:1..19618),gap(20),AAHY01130988.1:1..1997,gap(20),
CO   complement(AAHY01130989.1:1..18673),gap(4868),
CO   complement(AAHY01130990.1:1..20021),gap(145),
CO   complement(AAHY01130991.1:1..1822),gap(166),
CO   complement(AAHY01130992.1:1..5858),gap(20),
CO   complement(AAHY01130993.1:1..50853),gap(20),AAHY01130994.1:1..4246,
CO   gap(292),complement(AAHY01130995.1:1..15900),gap(308),
CO   complement(AAHY01130996.1:1..35280),gap(132),
CO   complement(AAHY01130997.1:1..898),gap(76),
CO   complement(AAHY01130998.1:1..31650),gap(185),
CO   complement(AAHY01130999.1:1..13175),gap(22),
CO   complement(AAHY01131000.1:1..18552),gap(239),
CO   complement(AAHY01131001.1:1..1367),gap(20),AAHY01131002.1:1..1255,gap(20),
CO   complement(AAHY01131003.1:1..1183),gap(393),
CO   complement(AAHY01131004.1:1..47542),gap(1313),AAHY01131005.1:1..14271,
CO   gap(20),AAHY01131006.1:1..8122,gap(2879),
CO   complement(AAHY01131007.1:1..7946),gap(385),
CO   complement(AAHY01131008.1:1..37651),gap(20),
CO   complement(AAHY01131009.1:1..20412),gap(35),
CO   complement(AAHY01131010.1:1..11802),gap(548),
CO   complement(AAHY01131011.1:1..3529),gap(78),AAHY01131012.1:1..6643,gap(20),
CO   complement(AAHY01131013.1:1..13580),gap(20),
CO   complement(AAHY01131014.1:1..17765),gap(20),
CO   complement(AAHY01131015.1:1..13242),gap(340),
CO   complement(AAHY01131016.1:1..66676),gap(20),
CO   complement(AAHY01131017.1:1..15123),gap(318),AAHY01131018.1:1..934,gap(28),
CO   complement(AAHY01131019.1:1..8378),gap(151),
CO   complement(AAHY01131020.1:1..4402),gap(102),
CO   complement(AAHY01131021.1:1..9328),gap(180),
CO   complement(AAHY01131022.1:1..8649),gap(20),
CO   complement(AAHY01131023.1:1..1498),gap(20),
CO   complement(AAHY01131024.1:1..35815),gap(20),
CO   complement(AAHY01131025.1:1..19421),gap(522),AAHY01131026.1:1..2056,
CO   gap(209),complement(AAHY01131027.1:1..38279),gap(336),
CO   complement(AAHY01131028.1:1..1023),gap(20),AAHY01131029.1:1..1237,gap(20),
CO   AAHY01131030.1:1..19826,gap(126),complement(AAHY01131031.1:1..3584),
CO   gap(43),AAHY01131032.1:1..627,gap(187),complement(AAHY01131033.1:1..52359),
CO   gap(967),complement(AAHY01131034.1:1..21949),gap(20),
CO   AAHY01131035.1:1..1066,gap(314),complement(AAHY01131036.1:1..5864),gap(98),
CO   complement(AAHY01131037.1:1..8110),gap(26),
CO   complement(AAHY01131038.1:1..26276),gap(20),
CO   complement(AAHY01131039.1:1..49561),gap(1644),
CO   complement(AAHY01131040.1:1..10974),gap(20),
CO   complement(AAHY01131041.1:1..13334),gap(329),
CO   complement(AAHY01131042.1:1..25420),gap(3523),
CO   complement(AAHY01131043.1:1..10680),gap(20),
CO   complement(AAHY01131044.1:1..73389),gap(20),
CO   complement(AAHY01131045.1:1..1650),gap(122),
CO   complement(AAHY01131046.1:1..42281),gap(20),
CO   complement(AAHY01131047.1:1..67839),gap(20),AAHY01131048.1:1..21253,
CO   gap(23),complement(AAHY01131049.1:1..136282),gap(74),
CO   AAHY01131050.1:1..15521,gap(189),complement(AAHY01131051.1:1..96673),
CO   gap(20),complement(AAHY01131052.1:1..54981),gap(166),
CO   complement(AAHY01131053.1:1..51958),gap(13316),
CO   complement(AAHY01131054.1:1..2588),gap(5068),
CO   complement(AAHY01131055.1:1..14846),gap(17808),
CO   complement(AAHY01131056.1:1..42434),gap(20),
CO   complement(AAHY01131057.1:1..47236),gap(1671),
CO   complement(AAHY01131058.1:1..192043),gap(7154),
CO   complement(AAHY01131059.1:1..1963),gap(20),
CO   complement(AAHY01131060.1:1..1404),gap(20),AAHY01131061.1:1..1091,gap(20),
CO   complement(AAHY01131062.1:1..16102),gap(125),
CO   complement(AAHY01131063.1:1..9078),gap(581),
CO   complement(AAHY01131064.1:1..3319),gap(20),
CO   complement(AAHY01131065.1:1..42334),gap(489),
CO   complement(AAHY01131066.1:1..5900),gap(4461),
CO   complement(AAHY01131067.1:1..1195),gap(20),
CO   complement(AAHY01131068.1:1..64467),gap(183),
CO   complement(AAHY01131069.1:1..14392),gap(20),
CO   complement(AAHY01131070.1:1..29493),gap(20),
CO   complement(AAHY01131071.1:1..17827),gap(20),
CO   complement(AAHY01131072.1:1..11038),gap(1245),
CO   complement(AAHY01131073.1:1..38392),gap(20),
CO   complement(AAHY01131074.1:1..13909),gap(20),
CO   complement(AAHY01131075.1:1..21168),gap(20),
CO   complement(AAHY01131076.1:1..28432),gap(250),
CO   complement(AAHY01131077.1:1..25211),gap(701),
CO   complement(AAHY01131078.1:1..2111),gap(132),
CO   complement(AAHY01131079.1:1..8622),gap(20),
CO   complement(AAHY01131080.1:1..6539),gap(2493),
CO   complement(AAHY01131081.1:1..14126),gap(20),
CO   complement(AAHY01131082.1:1..7131),gap(20),
CO   complement(AAHY01131083.1:1..7594),gap(426),
CO   complement(AAHY01131084.1:1..5534),gap(20),
CO   complement(AAHY01131085.1:1..50312),gap(20),
CO   complement(AAHY01131086.1:1..9875),gap(688),AAHY01131087.1:1..1144,gap(20),
CO   AAHY01131088.1:1..1186,gap(20),complement(AAHY01131089.1:1..5422),gap(20),
CO   complement(AAHY01131090.1:1..1224),gap(20),AAHY01131091.1:1..1050,gap(20),
CO   complement(AAHY01131092.1:1..10825),gap(20),
CO   complement(AAHY01131093.1:1..18846),gap(54),
CO   complement(AAHY01131094.1:1..2704),gap(20),
CO   complement(AAHY01131095.1:1..15137),gap(74),
CO   complement(AAHY01131096.1:1..10766),gap(20),
CO   complement(AAHY01131097.1:1..1254),gap(962),
CO   complement(AAHY01131098.1:1..45370),gap(20),AAHY01131099.1:1..3195,gap(20),
CO   complement(AAHY01131100.1:1..30397),gap(25),
CO   complement(AAHY01131101.1:1..49780),gap(713),
CO   complement(AAHY01131102.1:1..27546),gap(20),
CO   complement(AAHY01131103.1:1..25043),gap(295),
CO   complement(AAHY01131104.1:1..7009),gap(237),
CO   complement(AAHY01131105.1:1..5996),gap(20),
CO   complement(AAHY01131106.1:1..34094),gap(192),
CO   complement(AAHY01131107.1:1..9679),gap(20),
CO   complement(AAHY01131108.1:1..9393),gap(20),
CO   complement(AAHY01131109.1:1..15799),gap(138),
CO   complement(AAHY01131110.1:1..2816),gap(20),
CO   complement(AAHY01131111.1:1..10351),gap(20),
CO   complement(AAHY01131112.1:1..6187),gap(20),AAHY01131113.1:1..2809,gap(20),
CO   AAHY01131114.1:1..49209,gap(463),complement(AAHY01131115.1:1..3078),
CO   gap(20),AAHY01131116.1:1..1780,gap(20),AAHY01131117.1:1..14111,gap(53),
CO   complement(AAHY01131118.1:1..1297),gap(1195),
CO   complement(AAHY01131119.1:1..20592),gap(20),
CO   complement(AAHY01131120.1:1..511),gap(20),
CO   complement(AAHY01131121.1:1..11239),gap(20),
CO   complement(AAHY01131122.1:1..33626),gap(6084),AAHY01131123.1:1..1961,
CO   gap(20),complement(AAHY01131124.1:1..5839),gap(825),
CO   complement(AAHY01131125.1:1..1874),gap(20),
CO   complement(AAHY01131126.1:1..70642),gap(20),
CO   complement(AAHY01131127.1:1..1435),gap(1394),
CO   complement(AAHY01131128.1:1..67422),gap(157),
CO   complement(AAHY01131129.1:1..1610),gap(20),AAHY01131130.1:1..54528,
CO   gap(1484),complement(AAHY01131131.1:1..23841),gap(20),
CO   complement(AAHY01131132.1:1..1763),gap(166),AAHY01131133.1:1..4710,gap(31),
CO   AAHY01131134.1:1..11797,gap(20),complement(AAHY01131135.1:1..21097),
CO   gap(106),complement(AAHY01131136.1:1..9129),gap(427),
CO   AAHY01131137.1:1..1595,gap(20),AAHY01131138.1:1..27882,gap(145),
CO   AAHY01131139.1:1..8162,gap(100),complement(AAHY01131140.1:1..1424),gap(20),
CO   complement(AAHY01131141.1:1..16489),gap(20),AAHY01131142.1:1..6093,
CO   gap(2029),AAHY01131143.1:1..1305,gap(1402),
CO   complement(AAHY01131144.1:1..2161),gap(20),
CO   complement(AAHY01131145.1:1..1635),gap(20),
CO   complement(AAHY01131146.1:1..21871),gap(35),
CO   complement(AAHY01131147.1:1..15096),gap(20),
CO   complement(AAHY01131148.1:1..5561),gap(20),
CO   complement(AAHY01131149.1:1..5414),gap(43),
CO   complement(AAHY01131150.1:1..49752),gap(60),
CO   complement(AAHY01131151.1:1..247129),gap(20),
CO   complement(AAHY01131152.1:1..52763))
//


spacer
spacer