Dbfetch

ID   CH466617; SV 2; linear; genomic DNA; CON; MUS; 5425443 BP.
XX
AC   CH466617;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009746671 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5425443
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-5425443
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-5425443
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 8a67329f3c80101d5c1bba1fb78a1e9a.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000213.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000006262; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029286; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029288; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029366; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029370; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029373; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029375; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029376; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029378; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029379; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029384; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029385; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029397; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029403; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029405; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029409; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029413; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034855; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034981; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035505; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043635; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054945; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057068; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058013; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063015; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000082361; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029706; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029707; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029713; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029717; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029718; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029720; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029721; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029725; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029727; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029728; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029730; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029731; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029732; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029734; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029736; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029737; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029738; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029741; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029742; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029744; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029746; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029748; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029753; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029754; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029758; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029759; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029760; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029761; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029672; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029673; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029679; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029683; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029684; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029686; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029687; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029691; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029693; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029694; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029696; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029697; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029698; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029700; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029702; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029703; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029704; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029707; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029708; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029710; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029712; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029714; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029719; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029720; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029724; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029725; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029726; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029727; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029618; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029619; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029625; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029629; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029630; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029632; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029633; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029637; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029639; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029640; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029642; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029643; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029644; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029645; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029646; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029648; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029649; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029650; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029653; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029654; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029656; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029658; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029660; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029665; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029666; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029670; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029672; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029673; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029682; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029683; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029689; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029693; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029694; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029696; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029697; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029701; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029703; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029704; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029706; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029707; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029708; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029710; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029712; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029713; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029714; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029717; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029718; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029720; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029722; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029724; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029729; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029730; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029734; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029735; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029736; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029737; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029405; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029406; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029412; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029416; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029417; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029419; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029420; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029424; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029426; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029427; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029429; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029430; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029431; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029433; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029435; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029436; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029437; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029440; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029441; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029443; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029445; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029447; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029452; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029453; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029457; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029458; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029459; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029460; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030136; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030137; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030143; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030147; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030148; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030150; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030151; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030155; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030157; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030158; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030160; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030161; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030162; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030164; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030166; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030167; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030168; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030171; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030172; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030174; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030176; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030178; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030183; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030184; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030188; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030189; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030190; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030191; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028815; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028816; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028822; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028826; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028827; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028829; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028830; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028834; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028836; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028837; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028839; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028840; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028841; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028843; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028845; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028846; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028847; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028850; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028851; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028853; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028857; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028862; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028863; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028867; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028870; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029374; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029375; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029381; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029385; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029387; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029389; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029390; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029394; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029396; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029397; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029399; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029400; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029401; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029403; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029405; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029406; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029407; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029410; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029411; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029413; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029415; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029417; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029422; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029423; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029427; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029428; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029429; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0029430; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029519; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029520; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029526; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029530; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029531; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029533; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029534; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029538; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029540; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029541; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029543; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029544; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029545; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029547; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029549; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029550; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029551; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029554; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029555; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029557; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029559; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029561; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029566; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029567; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029571; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029573; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029574; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029478; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029479; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029485; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029489; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029490; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029492; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029493; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029497; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029499; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029500; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029502; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029503; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029504; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029506; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029508; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029509; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029510; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029513; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029514; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029516; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029518; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029520; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029525; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029526; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029530; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029531; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029532; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029533; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029607; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029608; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029614; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029618; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029619; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029621; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029622; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029626; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029628; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029629; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029631; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029632; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029633; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029635; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029637; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029638; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029639; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029642; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029643; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029645; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029647; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029649; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029654; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029655; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029659; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029660; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029661; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029662; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029507; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029508; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029514; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029518; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029519; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029521; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029522; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029526; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029528; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029529; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029531; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029532; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029533; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029535; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029537; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029538; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029539; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029542; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029543; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029545; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029547; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029549; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029554; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029555; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029559; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029560; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029561; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029562; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030170; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030171; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030177; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030181; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030182; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030184; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030185; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030189; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030191; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030192; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030194; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030195; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030196; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030198; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030200; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030201; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030202; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030205; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030206; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030208; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030210; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030212; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030217; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030218; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030222; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030223; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030224; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030225; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028534; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028535; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028541; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028545; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028546; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028548; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028549; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028553; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028555; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028556; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028559; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028560; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028562; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028564; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028565; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028566; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028569; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028570; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028572; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028574; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028576; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028581; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028582; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028586; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028588; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028589; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028894; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028895; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028901; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028905; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028906; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028908; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028909; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028913; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028915; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028916; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028918; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028919; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028920; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028922; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028924; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028925; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028926; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028929; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028930; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028932; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028934; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028936; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028941; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028942; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028946; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028948; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028949; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000006424; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031317; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031319; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031320; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031326; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031327; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031330; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041516; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048363; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058550; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061427; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068250; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071652; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000086978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121044; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146417; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159345; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199104; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200941; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202332; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202704; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072480; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072503; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072517; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072521; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072542; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072543; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072555; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072564; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072565; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072570; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072571; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072573; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072581; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072584; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072585; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072589; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072597; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072604; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072619; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072625; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072637; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072673; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072679; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072695; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072704; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072708; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0072710; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0072561; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072563; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072584; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072597; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072601; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072621; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072622; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072634; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072643; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072644; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072649; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072650; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072652; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072660; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072663; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072664; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072668; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072676; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072683; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072698; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072704; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072716; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072751; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072758; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072774; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072783; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072787; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0072789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0072475; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072477; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072498; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072511; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072515; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072535; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072536; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072548; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072557; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072558; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072563; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072564; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072566; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072570; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072573; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072576; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072577; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072581; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072596; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072611; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072617; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072629; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072664; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072671; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072688; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072702; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0072704; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072488; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072490; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072511; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072524; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072528; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072548; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072549; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072561; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072570; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072571; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072576; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072577; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072579; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072587; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072590; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072591; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072595; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072603; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072610; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072623; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072629; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072641; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072677; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072684; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072701; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072710; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072714; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0072716; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072131; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072133; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072154; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072167; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072171; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072191; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072192; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072204; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072213; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072214; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072219; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072220; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072222; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072230; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072233; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072234; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072238; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072246; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072253; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072268; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072274; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072286; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072320; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072328; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072345; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072354; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072358; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0072360; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072953; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072955; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072978; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072991; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072995; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073015; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073016; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073028; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073037; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073038; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073043; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073044; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073046; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073054; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073057; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073058; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073062; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073070; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073077; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073092; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073098; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073110; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073145; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073152; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073169; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073178; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073183; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0073185; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072677; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072679; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072701; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072714; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072718; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072735; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072736; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072749; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072758; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072759; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072764; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072765; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072767; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072775; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072778; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072781; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072785; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072793; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072800; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072815; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072834; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072870; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072876; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072892; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072901; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072907; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0072082; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072084; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072105; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072118; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072127; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072148; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072149; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072161; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072170; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072171; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072176; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072177; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072179; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072190; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072191; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072195; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072203; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072225; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072231; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072243; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072277; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072284; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072310; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072314; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0072316; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0072216; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072218; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072242; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072255; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072259; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072279; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072280; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072292; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072301; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072302; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072307; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072308; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072310; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072318; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072321; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072322; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072326; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072334; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072342; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072363; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072375; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072409; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072415; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072432; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072445; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0072447; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0072123; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072125; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072145; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072158; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072162; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072182; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072183; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072195; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072204; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072205; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072211; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072213; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072221; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072224; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072225; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072229; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072237; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072244; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072259; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072265; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072277; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072312; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072320; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072336; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072345; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072349; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0072351; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0072274; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072276; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072298; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072311; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072315; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072335; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072336; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072348; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072357; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072358; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072363; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072364; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072366; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072374; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072377; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072378; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072382; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072390; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072397; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072412; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072418; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072430; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072465; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072472; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072489; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072498; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072502; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0072504; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072124; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072126; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072147; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072160; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072164; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072184; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072185; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072197; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072206; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072207; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072212; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072213; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072215; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072223; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072226; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072227; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072231; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072239; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072246; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072261; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072267; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072279; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072314; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072321; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072337; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072346; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072351; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0072353; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073167; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073169; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073192; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073205; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073209; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073229; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073230; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073242; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073251; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073252; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073257; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073258; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073260; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073268; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073271; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073272; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073276; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073284; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073291; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073306; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073312; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073324; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073359; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073366; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073382; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073391; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073396; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0073398; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072144; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072146; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072166; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072179; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072183; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072203; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072204; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072217; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072225; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072226; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072232; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072234; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072242; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072245; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072247; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072251; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072259; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072266; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072281; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072287; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072300; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072336; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072343; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072359; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072372; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0072374; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071278; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071280; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071301; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071314; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071318; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071338; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071339; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071351; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071360; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071361; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071366; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071367; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071369; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071377; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071380; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071381; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071385; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071393; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071400; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071415; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071421; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071433; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071469; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071475; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071491; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071504; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0071506; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70976456.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5425443
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            1579..7510
FT                   /locus_tag="mCG_117999"
FT                   /note="gene_id=mCG117999.1"
FT   mRNA            join(1579..1597,3692..3758,7005..7510)
FT                   /locus_tag="mCG_117999"
FT                   /product="mCG117999"
FT                   /note="gene_id=mCG117999.1 transcript_id=mCT119149.1
FT                   created on 25-APR-2002"
FT   assembly_gap    1944..1963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(3705..3758,7005..7211)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117999"
FT                   /product="mCG117999"
FT                   /note="gene_id=mCG117999.1 transcript_id=mCT119149.1
FT                   protein_id=mCP53029.1"
FT                   /protein_id="EDL05372.1"
FT                   /translation="MKPLNLVLGLCILVGCFLSCECHRGPRRHDPRGPFPPPPPPHGPG
FT                   IGRPHPPPFGPGIGRPPPPPFGPGIGRPPPSTSLSTSSSTS"
FT   assembly_gap    46834..47351
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    49439..50500
FT                   /estimated_length=1062
FT                   /gap_type="unknown"
FT   assembly_gap    51487..51901
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   gene            54799..56676
FT                   /pseudo
FT                   /locus_tag="mCG_17775"
FT                   /note="gene_id=mCG17775.1"
FT   mRNA            54799..56676
FT                   /pseudo
FT                   /locus_tag="mCG_17775"
FT                   /note="gene_id=mCG17775.1 transcript_id=mCT16003.1 created
FT                   on 25-APR-2002"
FT   gene            63231..63611
FT                   /pseudo
FT                   /locus_tag="mCG_1041466"
FT                   /note="gene_id=mCG1041466.1"
FT   mRNA            63231..63611
FT                   /pseudo
FT                   /locus_tag="mCG_1041466"
FT                   /note="gene_id=mCG1041466.1 transcript_id=mCT159170.1
FT                   created on 25-APR-2002"
FT   gene            <78842..101339
FT                   /locus_tag="mCG_17774"
FT                   /note="gene_id=mCG17774.1"
FT   mRNA            join(78842..78915,80464..80530,81103..81172,97602..97668,
FT                   100805..101339)
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, transcript variant mCT16001"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT16001.0 created
FT                   on 25-APR-2002"
FT   mRNA            join(<78842..78915,80464..80530,97602..97668,
FT                   100805..101339)
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, transcript variant mCT189819"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT189819.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(78842..78915,80464..80530,100805..101339)
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, transcript variant mCT168220"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT168220.0 created
FT                   on 25-APR-2002"
FT   mRNA            join(<78842..78915,97602..97668,100805..101339)
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, transcript variant mCT189820"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT189820.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(78842..78915,80464..80530,90469..91007)
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, transcript variant mCT168221"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT168221.0 created
FT                   on 25-APR-2002"
FT   CDS             join(80477..80530,100805..101182)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, isoform CRA_b"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT168220.0
FT                   protein_id=mCP91150.0 isoform=CRA_b"
FT                   /protein_id="EDL05368.1"
FT                   /translation="MKALYMVFVLWVLIGCFLSSECQRGFRGQHDPTRPLSPSNPSSHF
FT                   YPQPDPNRVQISQPDNIPIFMFEQPHSLNICVPPPPLYLGEEFEKLPPNTHIPYILIRP
FT                   DIEPPSKYIQPVPRKKSNATPAANNFITTATAPNSTDSF"
FT   CDS             join(80477..80530,90469..90867)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, isoform CRA_c"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT168221.0
FT                   protein_id=mCP91152.0 isoform=CRA_c"
FT                   /protein_id="EDL05369.1"
FT                   /translation="MKALYMVFVLWVLIGCFLSGECHRAPRGQHGPRRTLAPSTHHRHY
FT                   HLYPLPDPNHVQFGVPPFLPTSSGFCKPHSLSLYAPPFEIVIQPSSIIVTIPGLILTLS
FT                   SDPSPQRNCPARTPPRVKANIIPGPITAQLLPKLKIPLIILDDSRK"
FT   CDS             join(<97612..97668,100805..101182)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, isoform CRA_d"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT189819.0
FT                   protein_id=mCP110805.0 isoform=CRA_d"
FT                   /protein_id="EDL05370.1"
FT                   /translation="KMKPLCLVFGLCVLIGCFLSSECQRGFRGQHDPTRPLSPSNPSSH
FT                   FYPQPDPNRVQISQPDNIPIFMFEQPHSLNICVPPPPLYLGEEFEKLPPNTHIPYILIR
FT                   PDIEPPSKYIQPVPRKKSNATPAANNFITTATAPNSTDSF"
FT   CDS             join(<97612..97668,100805..101182)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, isoform CRA_d"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT189820.0
FT                   protein_id=mCP110806.0 isoform=CRA_d"
FT                   /protein_id="EDL05371.1"
FT                   /translation="KMKPLCLVFGLCVLIGCFLSSECQRGFRGQHDPTRPLSPSNPSSH
FT                   FYPQPDPNRVQISQPDNIPIFMFEQPHSLNICVPPPPLYLGEEFEKLPPNTHIPYILIR
FT                   PDIEPPSKYIQPVPRKKSNATPAANNFITTATAPNSTDSF"
FT   CDS             join(97615..97668,100805..101182)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17774"
FT                   /product="mCG17774, isoform CRA_a"
FT                   /note="gene_id=mCG17774.1 transcript_id=mCT16001.0
FT                   protein_id=mCP22508.1 isoform=CRA_a"
FT                   /protein_id="EDL05367.1"
FT                   /translation="MKPLCLVFGLCVLIGCFLSSECQRGFRGQHDPTRPLSPSNPSSHF
FT                   YPQPDPNRVQISQPDNIPIFMFEQPHSLNICVPPPPLYLGEEFEKLPPNTHIPYILIRP
FT                   DIEPPSKYIQPVPRKKSNATPAANNFITTATAPNSTDSF"
FT   assembly_gap    140072..140091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    142718..142737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    146649..146668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    150013..151029
FT                   /estimated_length=1017
FT                   /gap_type="unknown"
FT   assembly_gap    154049..154069
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            200003..201930
FT                   /pseudo
FT                   /locus_tag="mCG_1041429"
FT                   /note="gene_id=mCG1041429.1"
FT   mRNA            200003..201930
FT                   /pseudo
FT                   /locus_tag="mCG_1041429"
FT                   /note="gene_id=mCG1041429.1 transcript_id=mCT159133.1
FT                   created on 25-APR-2002"
FT   assembly_gap    212919..212938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    230406..232151
FT                   /estimated_length=1746
FT                   /gap_type="unknown"
FT   assembly_gap    233808..234976
FT                   /estimated_length=1169
FT                   /gap_type="unknown"
FT   assembly_gap    254573..254592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(260878..270541)
FT                   /locus_tag="mCG_1041463"
FT                   /note="gene_id=mCG1041463.0"
FT   mRNA            complement(join(260878..261040,264337..264502,
FT                   270501..270541))
FT                   /locus_tag="mCG_1041463"
FT                   /product="mCG1041463"
FT                   /note="gene_id=mCG1041463.0 transcript_id=mCT159167.0
FT                   created on 25-APR-2002"
FT   CDS             complement(264348..264494)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041463"
FT                   /product="mCG1041463"
FT                   /note="gene_id=mCG1041463.0 transcript_id=mCT159167.0
FT                   protein_id=mCP53077.1"
FT                   /protein_id="EDL05366.1"
FT                   /translation="MLSRLKPRHESLRQQIGEPTQGLRKAEDIWKKHCWFGAPWKKKRI
FT                   KEN"
FT   gene            286817..298330
FT                   /gene="Muc10"
FT                   /locus_tag="mCG_118001"
FT                   /note="gene_id=mCG118001.1"
FT   mRNA            join(286817..286920,288068..288136,297315..297738,
FT                   297868..298330)
FT                   /gene="Muc10"
FT                   /locus_tag="mCG_118001"
FT                   /product="mucin 10, submandibular gland salivary mucin,
FT                   transcript variant mCT168206"
FT                   /note="gene_id=mCG118001.1 transcript_id=mCT168206.0
FT                   created on 07-FEB-2003"
FT   mRNA            join(286817..286920,288068..288136,297315..297581,
FT                   298015..298330)
FT                   /gene="Muc10"
FT                   /locus_tag="mCG_118001"
FT                   /product="mucin 10, submandibular gland salivary mucin,
FT                   transcript variant mCT119148"
FT                   /note="gene_id=mCG118001.1 transcript_id=mCT119148.2
FT                   created on 07-FEB-2003"
FT   CDS             join(288083..288136,297315..297738,297868..298211)
FT                   /codon_start=1
FT                   /gene="Muc10"
FT                   /locus_tag="mCG_118001"
FT                   /product="mucin 10, submandibular gland salivary mucin,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG118001.1 transcript_id=mCT168206.0
FT                   protein_id=mCP91148.0 isoform=CRA_b"
FT                   /protein_id="EDL05365.1"
FT                   /translation="MKNEMFILGLLALTSYFMPGESHHKSRSSQFPVRKYLEDPRYPRY
FT                   PRPHYSYGFIPSSPKFPKDNQWYKMCPPGTTLMLISRRSPKFLCIPKRQIISDKTKPNA
FT                   TTPAPTTKPTTNATTPAPTNRTTTNAITPAPTPQTYHKCNHTSTNQQNYHKCNHTTPTT
FT                   KSTTNVTTPATTTNVTTPATTTNATTPATTTNATTPATTTNATTPATTTKSTTKEPTTS
FT                   PKPSTSTAIPTTTKSANSTSSTTTSTTIQTTAPTFAEVFWKFFQQIFRLKK"
FT   CDS             join(288083..288136,297315..297581,298015..298203)
FT                   /codon_start=1
FT                   /gene="Muc10"
FT                   /locus_tag="mCG_118001"
FT                   /product="mucin 10, submandibular gland salivary mucin,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG118001.1 transcript_id=mCT119148.2
FT                   protein_id=mCP53028.2 isoform=CRA_a"
FT                   /protein_id="EDL05364.1"
FT                   /translation="MKNEMFILGLLALTSYFMPGESHHKSRSSQFPVRKYLEDPRYPRY
FT                   PRPHYSYGFIPSSPKFPKDNQWYKMCPPGTTLMLISRRSPKFLCIPKRQIISDKTKPNA
FT                   TTPQQPPNLQQKNLLLHLSLAPLQPYLQQLSLQIVLPLLQLVLPSKLQLQHLRKCFGSS
FT                   FSRSLG"
FT   assembly_gap    295982..296039
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    297825..297844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    304820..305189
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    306348..307754
FT                   /estimated_length=1407
FT                   /gap_type="unknown"
FT   assembly_gap    333473..333745
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   gene            345076..354900
FT                   /locus_tag="mCG_21581"
FT                   /note="gene_id=mCG21581.1"
FT   mRNA            join(345076..345151,345257..345325,347002..347088,
FT                   347824..347889,349246..349332,350570..350605,
FT                   351969..351995,353854..354127,354585..354627,
FT                   354635..354900)
FT                   /locus_tag="mCG_21581"
FT                   /product="mCG21581"
FT                   /note="gene_id=mCG21581.1 transcript_id=mCT19495.2 created
FT                   on 24-APR-2002"
FT   CDS             join(345272..345325,347002..347088,347824..347889,
FT                   349246..349332,350570..350605,351969..351995,
FT                   353854..354127,354585..354595)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21581"
FT                   /product="mCG21581"
FT                   /note="gene_id=mCG21581.1 transcript_id=mCT19495.2
FT                   protein_id=mCP6347.2"
FT                   /protein_id="EDL05363.1"
FT                   /translation="MKTMILLLCLLGSAQSLPKQLNPASGVPATKPTPGQVTPLPQQQP
FT                   NQVFPSISLIPLTQLLTLGSDLPLFNPAAGPHGAHTLPFTLGPLNGQQQLQPQMLPIIV
FT                   AQLGAQGALLSSEELPLASQIFTGLLIHPLFPGAIPPSGQAGTKPDVQNGVLPTRQAGA
FT                   KAVNQGTTPGHVTTPGVTDDDDYEMSTPAGLRRATHTTEGTTIDPPNRIQ"
FT   assembly_gap    378398..388157
FT                   /estimated_length=9760
FT                   /gap_type="unknown"
FT   assembly_gap    389609..389628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    391791..391810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    392837..392856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    394196..394215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    395400..395419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    396441..396460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    398389..398408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    403851..404407
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    406696..406715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    408284..408303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    409686..409705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    411481..412851
FT                   /estimated_length=1371
FT                   /gap_type="unknown"
FT   assembly_gap    415072..415897
FT                   /estimated_length=826
FT                   /gap_type="unknown"
FT   gene            421885..434432
FT                   /gene="Ambn"
FT                   /locus_tag="mCG_119077"
FT                   /note="gene_id=mCG119077.1"
FT   mRNA            join(421885..422001,422780..422848,425254..425319,
FT                   426598..426645,427528..427638,429122..429361,
FT                   430366..430404,431026..431085,431185..431229,
FT                   431601..431645,433353..434432)
FT                   /gene="Ambn"
FT                   /locus_tag="mCG_119077"
FT                   /product="ameloblastin, transcript variant mCT168207"
FT                   /note="gene_id=mCG119077.1 transcript_id=mCT168207.0
FT                   created on 07-AUG-2002"
FT   mRNA            join(421886..422001,422780..422848,425254..425319,
FT                   426598..426645,427528..427638,429167..429361,
FT                   430366..430404,431026..431085,431185..431229,
FT                   431601..431645,433353..434432)
FT                   /gene="Ambn"
FT                   /locus_tag="mCG_119077"
FT                   /product="ameloblastin, transcript variant mCT120241"
FT                   /note="gene_id=mCG119077.1 transcript_id=mCT120241.1
FT                   created on 07-AUG-2002"
FT   CDS             join(421987..422001,422780..422848,425254..425319,
FT                   426598..426645,427528..427638,429122..429361,
FT                   430366..430404,431026..431085,431185..431229,
FT                   431601..431645,433353..433883)
FT                   /codon_start=1
FT                   /gene="Ambn"
FT                   /locus_tag="mCG_119077"
FT                   /product="ameloblastin, isoform CRA_b"
FT                   /note="gene_id=mCG119077.1 transcript_id=mCT168207.0
FT                   protein_id=mCP91155.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5M8P3"
FT                   /db_xref="InterPro:IPR007798"
FT                   /db_xref="MGI:MGI:104655"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M8P3"
FT                   /protein_id="EDL05362.1"
FT                   /translation="MSASKIPLFKMKGLILFLSLVKMSLAVPAFPQQPGAQGMAPPGMA
FT                   SLSLETMRQLGSLQGLNALSQYSRLGFGKALNSLWLHGLLPPHNSFPWIGPREHETQQY
FT                   EYSLPVHPPPLPSQPSLQPHQPGLKPFLQPTAATGVQVTPQKPGPQPPMHPGQLPLQEG
FT                   ELIAPDEPQVAPSENPPTPEVPIMDFADPQFPTVFQIARSISRGPMAHNKASAFYPGMF
FT                   YMSYGANQLNAPARIGFMSSEEMPGERGSPMAYGTLFPRFGGFRQTLRRLNQNSPKGGD
FT                   FTVEVDSPVSVTKGPEKGEGPEGSPLQEANPGKRENPALLSQMAPGAHAGLLAFPNDHI
FT                   PSMARGPAGQRLLGVTPAAADPLITPELAEVYETYGADVTTPLGDGEATMDITMSPDTQ
FT                   QPLLPGNKVHQPQVHNAWRFQEP"
FT   CDS             join(421987..422001,422780..422848,425254..425319,
FT                   426598..426645,427528..427638,429167..429361,
FT                   430366..430404,431026..431085,431185..431229,
FT                   431601..431645,433353..433883)
FT                   /codon_start=1
FT                   /gene="Ambn"
FT                   /locus_tag="mCG_119077"
FT                   /product="ameloblastin, isoform CRA_a"
FT                   /note="gene_id=mCG119077.1 transcript_id=mCT120241.1
FT                   protein_id=mCP53082.1 isoform=CRA_a"
FT                   /protein_id="EDL05361.1"
FT                   /translation="MSASKIPLFKMKGLILFLSLVKMSLAVPAFPQQPGAQGMAPPGMA
FT                   SLSLETMRQLGSLQGLNALSQYSRLGFGKALNSLWLHGLLPPHNSFPWIGPREHETQQP
FT                   SLQPHQPGLKPFLQPTAATGVQVTPQKPGPQPPMHPGQLPLQEGELIAPDEPQVAPSEN
FT                   PPTPEVPIMDFADPQFPTVFQIARSISRGPMAHNKASAFYPGMFYMSYGANQLNAPARI
FT                   GFMSSEEMPGERGSPMAYGTLFPRFGGFRQTLRRLNQNSPKGGDFTVEVDSPVSVTKGP
FT                   EKGEGPEGSPLQEANPGKRENPALLSQMAPGAHAGLLAFPNDHIPSMARGPAGQRLLGV
FT                   TPAAADPLITPELAEVYETYGADVTTPLGDGEATMDITMSPDTQQPLLPGNKVHQPQVH
FT                   NAWRFQEP"
FT   assembly_gap    432279..432423
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    441586..441934
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   gene            453874..470612
FT                   /gene="Enam"
FT                   /locus_tag="mCG_21592"
FT                   /note="gene_id=mCG21592.2"
FT   mRNA            join(453874..454088,454388..454448,454592..454669,
FT                   455398..455463,455570..455620,457122..457163,
FT                   458827..459099,459948..460010,464516..464566,
FT                   467359..470612)
FT                   /gene="Enam"
FT                   /locus_tag="mCG_21592"
FT                   /product="enamelin, transcript variant mCT19506"
FT                   /note="gene_id=mCG21592.2 transcript_id=mCT19506.2 created
FT                   on 24-APR-2002"
FT   mRNA            join(453874..454088,454388..454448,454592..454669,
FT                   455398..455463,455576..455620,457122..457163,
FT                   458827..459099,459948..460010,464516..464566,
FT                   467359..467985,468397..470612)
FT                   /gene="Enam"
FT                   /locus_tag="mCG_21592"
FT                   /product="enamelin, transcript variant mCT168225"
FT                   /note="gene_id=mCG21592.2 transcript_id=mCT168225.0 created
FT                   on 24-APR-2002"
FT   mRNA            join(453874..454088,454388..454448,454592..454669,
FT                   455398..455463,455576..455620,457122..457163,
FT                   458827..459099,459948..460010,464516..464566,
FT                   467359..467896,468299..470612)
FT                   /gene="Enam"
FT                   /locus_tag="mCG_21592"
FT                   /product="enamelin, transcript variant mCT168224"
FT                   /note="gene_id=mCG21592.2 transcript_id=mCT168224.0 created
FT                   on 24-APR-2002"
FT   CDS             join(453949..454088,454388..454448,454592..454669,
FT                   455398..455463,455570..455620,457122..457163,
FT                   458827..459099,459948..460010,464516..464566,
FT                   467359..470583)
FT                   /codon_start=1
FT                   /gene="Enam"
FT                   /locus_tag="mCG_21592"
FT                   /product="enamelin, isoform CRA_c"
FT                   /note="gene_id=mCG21592.2 transcript_id=mCT19506.2
FT                   protein_id=mCP6356.2 isoform=CRA_c"
FT                   /db_xref="GOA:A0A0G2JEP7"
FT                   /db_xref="InterPro:IPR015673"
FT                   /db_xref="MGI:MGI:1333772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JEP7"
FT                   /protein_id="EDL05360.1"
FT                   /translation="MCLAPWLSLASAVCSHFYHRPLRTYFKDRLTRFKFTFYLVQLLSG
FT                   IGSHPNLKAPKIKLGFEDPLIRAYESFGENMLLLQCRNPTSPPKPCGLVPNVKMSLLVF
FT                   LGLLGVSAAMPFQMPMPRMPGFSSKSEEMMRYNQFNFMNAPPMMPMGPYGNGMPMPPHM
FT                   PPQYPPYQMPMWPPPVPNGWQQPPMPNFPSKTDQTQETAKPNQTNPQEPQPQKQPLKEP
FT                   PNEAARAKDDAQPPQPFPPFGNGLYPYPQPPWPIPQRGPPTAFGRPKFSNEEGNPYYAF
FT                   FGYHGFGGRPYYSEEMFEDYEKPKEKDPPKPEDPPPDDPPPEASTNSTVPDANATQSIP
FT                   EGGNDTSPIGNTGPGPNAGNNPTVQNGVFPPPKVNVSGQGVPKSQIPWRPSQPNIYENY
FT                   PYPNYPSERQWQTTGTQGPRQNGPGYRNPQVERGPQWNSFAWEGKQATRPGNPTYGKPP
FT                   SPTSGVNYAGNPVHFGRNLPGPNKPFVGANPASNKPFVGANPASNKPFVGANPASNKPF
FT                   VGANPASNKPFVGANPASNKPYVGANPASNKPFIGANPAANKPSIGTNPAANKPSIGTN
FT                   PAANKPFVRNNVGANKPFVGTNPSSNQPFLRSNQASNKPFMRSNQASNKPFVGTNVASV
FT                   GPKQVTVSHNMKTQNPKEKSLGQKERTVTPTKDASNPWRSAKQYGINNPNYNLPRSEGS
FT                   MVGPNFNSFDQQENSYFSKGASKRVPSPNIQIQSQNLPKGIALEPRRTPFQSETKKPEL
FT                   KHGTHQPAYPKKIPSPTRKHFPAERNTWNRQKILPPLKEDYGRQDENLRHPSYGSRGNI
FT                   FYHEYTNPYHNEKSQYIKSNPWDKSSPSTMMRPENPQYTMTSLDQKETEQYNEEDPIDP
FT                   NEDESFPGQSRWGDEEMNFKGNPTVRQYEGEHYASTLAKEYLPYSLSNPPKPSEDFPYS
FT                   EFYPWNPQETFPIYNPGPTIAPPVDPRSYYVNNAIGQEESTLFPSWTSWDHRNQAERQK
FT                   ESEPYFNRNVWDQSINLHKSNIPNHPYSTTSPARFPKDPTWFEGENLNYDLQITSLSPP
FT                   EREQLAFPDFLPQSYPTGQNEAHLFHQSQRGSCCIGGSTGHKDNVLALQDYTSSYGLPP
FT                   RKNQETSPVHTESSYIKYARPNVSPASILPSQRNISENKLTAESPNPSPFGDGVPTVRK
FT                   NTPYSGKNQLETGIVAFSEASSSQPKNTPCLKSDLGGDRRDVLKQFFEGSQLSERTAGL
FT                   TPEQLVIGIPDKGSGPDSIQSEVQGKEGEMQQQRPPTIMKLPCFGSNSKFHSSTTGPPI
FT                   NNRRPTLLNGALSTPTESPNTLVGLATREQLKSINVDKLNADEHTTLESFQGTSPQDQG
FT                   CLLLQA"
FT   CDS             join(453949..454088,454388..454448,454592..454669,
FT                   455398..455463,455576..455620,457122..457163,
FT                   458827..459099,459948..460010,464516..464566,
FT                   467359..467985,468397..470583)
FT                   /codon_start=1
FT                   /gene="Enam"
FT                   /locus_tag="mCG_21592"
FT                   /product="enamelin, isoform CRA_b"
FT                   /note="gene_id=mCG21592.2 transcript_id=mCT168225.0
FT                   protein_id=mCP91135.0 isoform=CRA_b"
FT                   /protein_id="EDL05359.1"
FT                   /translation="MCLAPWLSLASAVCSHFYHRPLRTYFKDRLTRFKFTFYLVQLLSG
FT                   IGSHPNLKAPKIKLGFEDPLIRAYESFGENMLLLQCRNPTSPPKPCGLVPNVKMSLLVF
FT                   LGLLGVSAAMPMPMPRMPGFSSKSEEMMRYNQFNFMNAPPMMPMGPYGNGMPMPPHMPP
FT                   QYPPYQMPMWPPPVPNGWQQPPMPNFPSKTDQTQETAKPNQTNPQEPQPQKQPLKEPPN
FT                   EAARAKDDAQPPQPFPPFGNGLYPYPQPPWPIPQRGPPTAFGRPKFSNEEGNPYYAFFG
FT                   YHGFGGRPYYSEEMFEDYEKPKEKDPPKPEDPPPDDPPPEASTNSTVPDANATQSIPEG
FT                   GNDTSPIGNTGPGPNAGNNPTVQNGVFPPPKVNVSGQGVPKSQIPWRPSQPNIYENYPY
FT                   PNYPSERQWQTTGTQGPRQNGPGYRNPQVERGPQWNSFAWEGKQATRPGNPTYGKPPSP
FT                   TSGVNYAGNPVHFGRNLPGPNKPFASNKPFVGTNVASVGPKQVTVSHNMKTQNPKEKSL
FT                   GQKERTVTPTKDASNPWRSAKQYGINNPNYNLPRSEGSMVGPNFNSFDQQENSYFSKGA
FT                   SKRVPSPNIQIQSQNLPKGIALEPRRTPFQSETKKPELKHGTHQPAYPKKIPSPTRKHF
FT                   PAERNTWNRQKILPPLKEDYGRQDENLRHPSYGSRGNIFYHEYTNPYHNEKSQYIKSNP
FT                   WDKSSPSTMMRPENPQYTMTSLDQKETEQYNEEDPIDPNEDESFPGQSRWGDEEMNFKG
FT                   NPTVRQYEGEHYASTLAKEYLPYSLSNPPKPSEDFPYSEFYPWNPQETFPIYNPGPTIA
FT                   PPVDPRSYYVNNAIGQEESTLFPSWTSWDHRNQAERQKESEPYFNRNVWDQSINLHKSN
FT                   IPNHPYSTTSPARFPKDPTWFEGENLNYDLQITSLSPPEREQLAFPDFLPQSYPTGQNE
FT                   AHLFHQSQRGSCCIGGSTGHKDNVLALQDYTSSYGLPPRKNQETSPVHTESSYIKYARP
FT                   NVSPASILPSQRNISENKLTAESPNPSPFGDGVPTVRKNTPYSGKNQLETGIVAFSEAS
FT                   SSQPKNTPCLKSDLGGDRRDVLKQFFEGSQLSERTAGLTPEQLVIGIPDKGSGPDSIQS
FT                   EVQGKEGEMQQQRPPTIMKLPCFGSNSKFHSSTTGPPINNRRPTLLNGALSTPTESPNT
FT                   LVGLATREQLKSINVDKLNADEHTTLESFQGTSPQDQGCLLLQA"
FT   CDS             join(453949..454088,454388..454448,454592..454669,
FT                   455398..455463,455576..455620,457122..457163,
FT                   458827..459099,459948..460010,464516..464566,
FT                   467359..467896,468299..470583)
FT                   /codon_start=1
FT                   /gene="Enam"
FT                   /locus_tag="mCG_21592"
FT                   /product="enamelin, isoform CRA_a"
FT                   /note="gene_id=mCG21592.2 transcript_id=mCT168224.0
FT                   protein_id=mCP91147.0 isoform=CRA_a"
FT                   /protein_id="EDL05358.1"
FT                   /translation="MCLAPWLSLASAVCSHFYHRPLRTYFKDRLTRFKFTFYLVQLLSG
FT                   IGSHPNLKAPKIKLGFEDPLIRAYESFGENMLLLQCRNPTSPPKPCGLVPNVKMSLLVF
FT                   LGLLGVSAAMPMPMPRMPGFSSKSEEMMRYNQFNFMNAPPMMPMGPYGNGMPMPPHMPP
FT                   QYPPYQMPMWPPPVPNGWQQPPMPNFPSKTDQTQETAKPNQTNPQEPQPQKQPLKEPPN
FT                   EAARAKDDAQPPQPFPPFGNGLYPYPQPPWPIPQRGPPTAFGRPKFSNEEGNPYYAFFG
FT                   YHGFGGRPYYSEEMFEDYEKPKEKDPPKPEDPPPDDPPPEASTNSTVPDANATQSIPEG
FT                   GNDTSPIGNTGPGPNAGNNPTVQNGVFPPPKVNVSGQGVPKSQIPWRPSQPNIYENYPY
FT                   PNYPSERQWQTTGTQGPRQNGPGYRNPQVERGPQWNSFAWEGKQATRPGNPTYGANKPF
FT                   VGTNPSSNQPFLRSNQASNKPFMRSNQASNKPFVGTNVASVGPKQVTVSHNMKTQNPKE
FT                   KSLGQKERTVTPTKDASNPWRSAKQYGINNPNYNLPRSEGSMVGPNFNSFDQQENSYFS
FT                   KGASKRVPSPNIQIQSQNLPKGIALEPRRTPFQSETKKPELKHGTHQPAYPKKIPSPTR
FT                   KHFPAERNTWNRQKILPPLKEDYGRQDENLRHPSYGSRGNIFYHEYTNPYHNEKSQYIK
FT                   SNPWDKSSPSTMMRPENPQYTMTSLDQKETEQYNEEDPIDPNEDESFPGQSRWGDEEMN
FT                   FKGNPTVRQYEGEHYASTLAKEYLPYSLSNPPKPSEDFPYSEFYPWNPQETFPIYNPGP
FT                   TIAPPVDPRSYYVNNAIGQEESTLFPSWTSWDHRNQAERQKESEPYFNRNVWDQSINLH
FT                   KSNIPNHPYSTTSPARFPKDPTWFEGENLNYDLQITSLSPPEREQLAFPDFLPQSYPTG
FT                   QNEAHLFHQSQRGSCCIGGSTGHKDNVLALQDYTSSYGLPPRKNQETSPVHTESSYIKY
FT                   ARPNVSPASILPSQRNISENKLTAESPNPSPFGDGVPTVRKNTPYSGKNQLETGIVAFS
FT                   EASSSQPKNTPCLKSDLGGDRRDVLKQFFEGSQLSERTAGLTPEQLVIGIPDKGSGPDS
FT                   IQSEVQGKEGEMQQQRPPTIMKLPCFGSNSKFHSSTTGPPINNRRPTLLNGALSTPTES
FT                   PNTLVGLATREQLKSINVDKLNADEHTTLESFQGTSPQDQGCLLLQA"
FT   gene            complement(486418..493686)
FT                   /gene="Igj"
FT                   /locus_tag="mCG_21585"
FT                   /note="gene_id=mCG21585.1"
FT   mRNA            complement(join(486418..487428,488395..488475,
FT                   492001..492121,493618..493686))
FT                   /gene="Igj"
FT                   /locus_tag="mCG_21585"
FT                   /product="immunoglobulin joining chain"
FT                   /note="gene_id=mCG21585.1 transcript_id=mCT19500.2 created
FT                   on 24-APR-2002"
FT   CDS             complement(join(487215..487428,488395..488475,
FT                   492001..492121,493618..493681))
FT                   /codon_start=1
FT                   /gene="Igj"
FT                   /locus_tag="mCG_21585"
FT                   /product="immunoglobulin joining chain"
FT                   /note="gene_id=mCG21585.1 transcript_id=mCT19500.2
FT                   protein_id=mCP6352.2"
FT                   /protein_id="EDL05357.1"
FT                   /translation="MKTHLLLWGVLAIFVKAVLVTGDDEATILADNKCMCTRVTSRIIP
FT                   STEDPNEDIVERNIRIVVPLNNRENISDPTSPLRRNFVYHLSDVCKKCDPVEVELEDQV
FT                   VTATQSNICNEDDGVPETCYMYDRNKCYTTMVPLRYHGETKMVQAALTPDSCYPD"
FT   assembly_gap    496309..496676
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    508270..508289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    512208..518329
FT                   /estimated_length=6122
FT                   /gap_type="unknown"
FT   gene            519731..521356
FT                   /gene="Crlz1"
FT                   /locus_tag="mCG_21590"
FT                   /note="gene_id=mCG21590.2"
FT   mRNA            519731..521356
FT                   /gene="Crlz1"
FT                   /locus_tag="mCG_21590"
FT                   /product="charged amino acid rich leucine zipper 1"
FT                   /note="gene_id=mCG21590.2 transcript_id=mCT19504.2 created
FT                   on 24-APR-2002"
FT   CDS             519888..521297
FT                   /codon_start=1
FT                   /gene="Crlz1"
FT                   /locus_tag="mCG_21590"
FT                   /product="charged amino acid rich leucine zipper 1"
FT                   /note="gene_id=mCG21590.2 transcript_id=mCT19504.2
FT                   protein_id=mCP6355.2"
FT                   /protein_id="EDL05356.1"
FT                   /translation="MVKKSRRRGAAQWAAVRAQAGLTATDENEDDLGLPPSPGDSSYYQ
FT                   DQVDEFHEARSRAVLAKGWNEVESGEEDGDEEEEVLPLDIDDGDDEDGESSEEEEVGED
FT                   DDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEVEEEEREEEEEAQI
FT                   IQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLKKESPEL
FT                   LELIEDLQAKLTEVKDELEPLLQLVEKGVIPTGRGSEYLKTKYNLYLNYCANISFYLIL
FT                   KARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTAKDGAVKKEMTPKAKLT
FT                   KTKPKSVKQAAAVALTDEPDFDGAALKYYKEMEDRQELKRKKEENSAEEQALEEQNAKR
FT                   AITYQIAKNRGLTPRRKKIDRNPRVKHREKFRKAKIRRRGQVREVRREEQRYSGELSGI
FT                   RAGVKKSIKLK"
FT   assembly_gap    523807..523826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    530013..531226
FT                   /estimated_length=1214
FT                   /gap_type="unknown"
FT   assembly_gap    532831..534311
FT                   /estimated_length=1481
FT                   /gap_type="unknown"
FT   assembly_gap    539545..539643
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   gene            550226..616498
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /note="gene_id=mCG21594.2"
FT   mRNA            join(550226..551031,581185..581358,582706..582823,
FT                   583579..583680,587603..587726,593522..593583,
FT                   594326..594391,596838..596907,598740..598832,
FT                   603395..603646,605268..605365,609216..609335,
FT                   610154..610451,614573..614611,616119..616498)
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, transcript
FT                   variant mCT168227"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT168227.0 created
FT                   on 24-APR-2002"
FT   mRNA            join(550226..551031,581185..581358,582706..582823,
FT                   583579..583680,587603..587726,593522..593583,
FT                   594326..594391,596838..596907,598740..598832,
FT                   601268..601320,601502..601568,603479..603646,
FT                   605268..605365,609216..609335,610355..610451,
FT                   611824..611879)
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, transcript
FT                   variant mCT168228"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT168228.0 created
FT                   on 24-APR-2002"
FT   mRNA            join(550226..551031,581185..581358,582706..582823,
FT                   583579..583680,587603..587726,593522..593583,
FT                   594326..594391,596838..596907,598740..598832,
FT                   601485..601568,603479..603646,605268..605365,
FT                   606876..607893)
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, transcript
FT                   variant mCT19508"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT19508.2 created
FT                   on 24-APR-2002"
FT   mRNA            join(550226..550668,550844..551031,565103..565156,
FT                   581185..581358,582706..582823,583579..583680,
FT                   587603..587726,593522..593583,594326..594391,
FT                   596838..596907,598740..598832,601485..601568,
FT                   603479..603646,605268..605365,606876..607893)
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, transcript
FT                   variant mCT168226"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT168226.0 created
FT                   on 24-APR-2002"
FT   mRNA            join(<550508..551031,565103..565156,581185..581358,
FT                   582706..582823,583579..583680,587603..587726,
FT                   593522..593583,594326..594391,596838..596907,
FT                   598740..598832,601485..601568,603479..603646,
FT                   605268..605365,606876..607208)
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, transcript
FT                   variant mCT189813"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT189813.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<550848..551031,565103..565156,581185..581358,
FT                   582706..582823,583579..583680,587603..587726,
FT                   593522..593583,594326..594391,596838..596907,
FT                   598740..598832,601485..601568,603479..603646,
FT                   605268..605365,606876..606948)
FT                   /codon_start=1
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT189813.0
FT                   protein_id=mCP110807.0 isoform=CRA_b"
FT                   /protein_id="EDL05352.1"
FT                   /translation="LIMSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLR
FT                   ELDDISLTPDPEPTHEDSWEDLTDLVEQVRADPEDPNYLMANERMNLMNMAKLSIKGLI
FT                   ESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEA
FT                   AEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMME
FT                   EEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSMYLKDGNSSKGSEGDGQITAIL
FT                   DQKNYVEELNRHLNATVNNLQTKVDLLEKSNTKLTEELAVANNRIITLQEEMERVKEES
FT                   SYLLESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVEKELELQISMRQEMELAMKM
FT                   LEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSRLEEKTNQMAA
FT                   TIKQLEQSEKDLVKQAKTLNSAANKLIPKHH"
FT   CDS             join(550854..551031,581185..581358,582706..582823,
FT                   583579..583680,587603..587726,593522..593583,
FT                   594326..594391,596838..596907,598740..598832,
FT                   603395..603646,605268..605365,609216..609335,
FT                   610154..610451,614573..614611,616119..616262)
FT                   /codon_start=1
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, isoform CRA_d"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT168227.0
FT                   protein_id=mCP91156.0 isoform=CRA_d"
FT                   /protein_id="EDL05354.1"
FT                   /translation="MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLREL
FT                   DDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQF
FT                   FVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRG
FT                   RAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANF
FT                   CMKGEDLDSQVGVIDFSMYLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNL
FT                   QTKVDLLEKSNTKLTEELAVANNRIITLQEEMERVKEESSYLLESNRKGLHKGSRQMYG
FT                   AYFIEEGVQAVCLSLGQDVEKELELQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLD
FT                   DLRALKHELAFKLQSSDLGVKQKSELNSRLEEKTNQMAATIKQLEQRLRQAERGRQSAE
FT                   LDNRLFKQDFGDKINSLQLEVEALTRQRSKLPLHVRASVVLLCSTVFQLSCPYVSGNSS
FT                   GIKTQLLNFKGQGLAFFRIYDYRNQNFHSLLSHLTRTQLELELKQEKERKSQNRGTPGK
FT                   GAQKPELRMVCQLCQEDDSLTKNTCRNCRGTFCNACTTNELPLPSSIKPERVCNPCHEQ
FT                   LIKQYSSSPP"
FT   CDS             join(550854..551031,565103..565156,581185..581358,
FT                   582706..582823,583579..583680,587603..587726,
FT                   593522..593583,594326..594391,596838..596907,
FT                   598740..598832,601485..601568,603479..603646,
FT                   605268..605365,606876..606948)
FT                   /codon_start=1
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT168226.0
FT                   protein_id=mCP91153.0 isoform=CRA_a"
FT                   /protein_id="EDL05351.1"
FT                   /translation="MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLREL
FT                   DDISLTPDPEPTHEDSWEDLTDLVEQVRADPEDPNYLMANERMNLMNMAKLSIKGLIES
FT                   ALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAE
FT                   ITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEE
FT                   GAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSMYLKDGNSSKGSEGDGQITAILDQ
FT                   KNYVEELNRHLNATVNNLQTKVDLLEKSNTKLTEELAVANNRIITLQEEMERVKEESSY
FT                   LLESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVEKELELQISMRQEMELAMKMLE
FT                   KDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSRLEEKTNQMAATI
FT                   KQLEQSEKDLVKQAKTLNSAANKLIPKHH"
FT   CDS             join(550854..551031,581185..581358,582706..582823,
FT                   583579..583680,587603..587726,593522..593583,
FT                   594326..594391,596838..596907,598740..598832,
FT                   601485..601568,603479..603646,605268..605365,
FT                   606876..606948)
FT                   /codon_start=1
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT19508.2
FT                   protein_id=mCP6360.2 isoform=CRA_c"
FT                   /protein_id="EDL05353.1"
FT                   /translation="MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLREL
FT                   DDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQF
FT                   FVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRG
FT                   RAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANF
FT                   CMKGEDLDSQVGVIDFSMYLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNL
FT                   QTKVDLLEKSNTKLTEELAVANNRIITLQEEMERVKEESSYLLESNRKGPKQDRTAEGQ
FT                   ALSEARKHLKEETQLRLDVEKELELQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLD
FT                   DLRALKHELAFKLQSSDLGVKQKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLN
FT                   SAANKLIPKHH"
FT   CDS             join(550854..551031,581185..581358,582706..582823,
FT                   583579..583680,587603..587726,593522..593583,
FT                   594326..594391,596838..596907,598740..598832,
FT                   601268..601320,601502)
FT                   /codon_start=1
FT                   /gene="Rufy3"
FT                   /locus_tag="mCG_21594"
FT                   /product="RUN and FYVE domain containing 3, isoform CRA_e"
FT                   /note="gene_id=mCG21594.2 transcript_id=mCT168228.0
FT                   protein_id=mCP91144.0 isoform=CRA_e"
FT                   /protein_id="EDL05355.1"
FT                   /translation="MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLREL
FT                   DDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQF
FT                   FVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRG
FT                   RAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANF
FT                   CMKGEDLDSQVGVIDFSMYLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNL
FT                   QTKVDLLEKSNTKLTEELAVANNRIITLQEEMERVKEESSYLLESNRKSQESIFQDRFG
FT                   ELHHLF"
FT   assembly_gap    562406..562425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    569982..570063
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    575068..575528
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    586756..586837
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    601350..601390
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   gene            complement(624688..643019)
FT                   /gene="Grsf1"
FT                   /locus_tag="mCG_21587"
FT                   /note="gene_id=mCG21587.2"
FT   mRNA            complement(join(624688..626746,628826..628901,
FT                   629411..629546,630355..630476,632046..632230,
FT                   636465..636600,637451..637594,638894..639049,
FT                   639982..640138,642244..643019))
FT                   /gene="Grsf1"
FT                   /locus_tag="mCG_21587"
FT                   /product="G-rich RNA sequence binding factor 1, transcript
FT                   variant mCT168222"
FT                   /note="gene_id=mCG21587.2 transcript_id=mCT168222.0 created
FT                   on 24-APR-2002"
FT   mRNA            complement(join(624688..626746,628826..628901,
FT                   629411..629546,630355..630476,632046..632230,
FT                   636465..636600,637451..637594,638894..639049,
FT                   639982..640138,641835..>641960))
FT                   /gene="Grsf1"
FT                   /locus_tag="mCG_21587"
FT                   /product="G-rich RNA sequence binding factor 1, transcript
FT                   variant mCT19502"
FT                   /note="gene_id=mCG21587.2 transcript_id=mCT19502.2 created
FT                   on 24-APR-2002"
FT   CDS             complement(join(628852..628901,629411..629546,
FT                   630355..630476,632046..632230,636465..636600,
FT                   637451..637594,638894..639049,639982..640138,
FT                   642244..642447))
FT                   /codon_start=1
FT                   /gene="Grsf1"
FT                   /locus_tag="mCG_21587"
FT                   /product="G-rich RNA sequence binding factor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21587.2 transcript_id=mCT168222.0
FT                   protein_id=mCP91141.0 isoform=CRA_a"
FT                   /protein_id="EDL05349.1"
FT                   /translation="MAGTRWVLGALLRGCGCNCSSCRRTGAACLPFYSAAGTFPSGVSG
FT                   RRRLLLLLGAAAAAASQTRGLQLESKTTYLEDLPPLPEYELSPSKLGDEVDDVYLIRAQ
FT                   GLPWSCTVEDVLNFFSDCRIRNSENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHR
FT                   MYMGQRYVEVYEINNEDVDALMKSLQVKPSPVLSDGVVRLRGLPYSCNEKDIVDFFAGL
FT                   NIVDITFVMDYRGRRKTGEAYVQFEEPEMANQALLKHREEIGNRYIEIFPSRRNEVRTH
FT                   VGSHKGKKMTSSPPTKYITEPEVVFEEHEVNEDIRPMTAFESDKEIELPKEMSEKLPEA
FT                   VDFGTLPSLHFVHMRGLPFQANAQDIINFFAPLKPVRITMEYSSSGKATGEADVHFDTH
FT                   EDAVAAMLKDRSHVQHRYIELFLNSCPKGK"
FT   CDS             complement(join(628852..628901,629411..629546,
FT                   630355..630476,632046..632230,636465..636600,
FT                   637451..637594,638894..639049,639982..640138,
FT                   641835..>641960))
FT                   /codon_start=1
FT                   /gene="Grsf1"
FT                   /locus_tag="mCG_21587"
FT                   /product="G-rich RNA sequence binding factor 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21587.2 transcript_id=mCT19502.2
FT                   protein_id=mCP6354.1 isoform=CRA_b"
FT                   /protein_id="EDL05350.1"
FT                   /translation="RGTHRTPASLPLRPPIGHGNKGRSHGPGSSCFVPSESGRLGSESK
FT                   TTYLEDLPPLPEYELSPSKLGDEVDDVYLIRAQGLPWSCTVEDVLNFFSDCRIRNSENG
FT                   IHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQ
FT                   VKPSPVLSDGVVRLRGLPYSCNEKDIVDFFAGLNIVDITFVMDYRGRRKTGEAYVQFEE
FT                   PEMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSHKGKKMTSSPPTKYITEPEVVFE
FT                   EHEVNEDIRPMTAFESDKEIELPKEMSEKLPEAVDFGTLPSLHFVHMRGLPFQANAQDI
FT                   INFFAPLKPVRITMEYSSSGKATGEADVHFDTHEDAVAAMLKDRSHVQHRYIELFLNSC
FT                   PKGK"
FT   assembly_gap    642000..642212
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    648146..648536
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    677765..677924
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   gene            687292..724392
FT                   /gene="Mobkl1a"
FT                   /locus_tag="mCG_21583"
FT                   /note="gene_id=mCG21583.3"
FT   mRNA            join(687292..687552,709731..709897,711484..711577,
FT                   715940..716073,719563..719726,722498..724392)
FT                   /gene="Mobkl1a"
FT                   /locus_tag="mCG_21583"
FT                   /product="MOB1, Mps One Binder kinase activator-like 1A
FT                   (yeast), transcript variant mCT19497"
FT                   /note="gene_id=mCG21583.3 transcript_id=mCT19497.3 created
FT                   on 06-FEB-2003"
FT   mRNA            join(687292..687552,709731..709897,711484..711577,
FT                   715940..716424)
FT                   /gene="Mobkl1a"
FT                   /locus_tag="mCG_21583"
FT                   /product="MOB1, Mps One Binder kinase activator-like 1A
FT                   (yeast), transcript variant mCT179794"
FT                   /note="gene_id=mCG21583.3 transcript_id=mCT179794.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(687292..687552,709731..715709)
FT                   /gene="Mobkl1a"
FT                   /locus_tag="mCG_21583"
FT                   /product="MOB1, Mps One Binder kinase activator-like 1A
FT                   (yeast), transcript variant mCT179795"
FT                   /note="gene_id=mCG21583.3 transcript_id=mCT179795.0 created
FT                   on 06-FEB-2003"
FT   CDS             join(687539..687552,709731..709897,711484..711577,
FT                   715940..716073,719563..719726,722498..722575)
FT                   /codon_start=1
FT                   /gene="Mobkl1a"
FT                   /locus_tag="mCG_21583"
FT                   /product="MOB1, Mps One Binder kinase activator-like 1A
FT                   (yeast), isoform CRA_c"
FT                   /note="gene_id=mCG21583.3 transcript_id=mCT19497.3
FT                   protein_id=mCP6351.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3T9U1"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="MGI:MGI:1915723"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T9U1"
FT                   /protein_id="EDL05348.1"
FT                   /translation="MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAV
FT                   MLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIK
FT                   KPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIY
FT                   HQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR"
FT   CDS             join(687539..687552,709731..709897,711484..711577,
FT                   715940..716096)
FT                   /codon_start=1
FT                   /gene="Mobkl1a"
FT                   /locus_tag="mCG_21583"
FT                   /product="MOB1, Mps One Binder kinase activator-like 1A
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG21583.3 transcript_id=mCT179794.0
FT                   protein_id=mCP102717.0 isoform=CRA_a"
FT                   /protein_id="EDL05346.1"
FT                   /translation="MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAV
FT                   MLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIK
FT                   KPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGKSILCD"
FT   CDS             join(687539..687552,709731..709956)
FT                   /codon_start=1
FT                   /gene="Mobkl1a"
FT                   /locus_tag="mCG_21583"
FT                   /product="MOB1, Mps One Binder kinase activator-like 1A
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG21583.3 transcript_id=mCT179795.0
FT                   protein_id=mCP102716.0 isoform=CRA_b"
FT                   /protein_id="EDL05347.1"
FT                   /translation="MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAV
FT                   MLPEGEDLNEWVAVNSKSPLCFCQTLNWPSDLLR"
FT   gene            complement(705639..706198)
FT                   /pseudo
FT                   /locus_tag="mCG_21589"
FT                   /note="gene_id=mCG21589.2"
FT   mRNA            complement(705639..706198)
FT                   /pseudo
FT                   /locus_tag="mCG_21589"
FT                   /note="gene_id=mCG21589.2 transcript_id=mCT19503.2 created
FT                   on 24-APR-2002"
FT   assembly_gap    716590..717002
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   gene            731350..749587
FT                   /gene="Dck"
FT                   /locus_tag="mCG_140146"
FT                   /note="gene_id=mCG140146.0"
FT   mRNA            join(731350..731749,736007..736122,739033..739226,
FT                   740485..740632,743172..743287,744677..744767,
FT                   747531..749587)
FT                   /gene="Dck"
FT                   /locus_tag="mCG_140146"
FT                   /product="deoxycytidine kinase"
FT                   /note="gene_id=mCG140146.0 transcript_id=mCT120233.1
FT                   created on 24-APR-2002"
FT   CDS             join(731659..731749,736007..736122,739033..739226,
FT                   740485..740632,743172..743287,744677..744767,
FT                   747531..747557)
FT                   /codon_start=1
FT                   /gene="Dck"
FT                   /locus_tag="mCG_140146"
FT                   /product="deoxycytidine kinase"
FT                   /note="gene_id=mCG140146.0 transcript_id=mCT120233.1
FT                   protein_id=mCP53015.1"
FT                   /db_xref="GOA:Q545E8"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="MGI:MGI:102726"
FT                   /db_xref="UniProtKB/TrEMBL:Q545E8"
FT                   /protein_id="EDL05345.1"
FT                   /translation="MATPPKRFCPSPSTSSEGTRIKKISIEGNIAAGKSTFVNILKQAS
FT                   EDWEVVPEPVARWCNVQSTQEEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSR
FT                   IRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMN
FT                   SQFGQSLELDGIIYLRATPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLK
FT                   TSFDYLQEVPVLTLDVNEDFKDKHESLVEKVKEFLSTL"
FT   gene            <760298..779533
FT                   /locus_tag="mCG_1041460"
FT                   /note="gene_id=mCG1041460.0"
FT   mRNA            join(<760298..760312,778916..779533)
FT                   /locus_tag="mCG_1041460"
FT                   /product="mCG1041460"
FT                   /note="gene_id=mCG1041460.0 transcript_id=mCT159164.0
FT                   created on 24-APR-2002"
FT   CDS             join(<760300..760312,778916..778956)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041460"
FT                   /product="mCG1041460"
FT                   /note="gene_id=mCG1041460.0 transcript_id=mCT159164.0
FT                   protein_id=mCP53072.1"
FT                   /protein_id="EDL05344.1"
FT                   /translation="KGPDYIHLFCDLCWLQT"
FT   assembly_gap    766924..767140
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    782736..782755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(803842..805442)
FT                   /pseudo
FT                   /locus_tag="mCG_21584"
FT                   /note="gene_id=mCG21584.2"
FT   mRNA            complement(803842..805442)
FT                   /pseudo
FT                   /locus_tag="mCG_21584"
FT                   /note="gene_id=mCG21584.2 transcript_id=mCT19499.2 created
FT                   on 24-APR-2002"
FT   assembly_gap    807457..807476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(807478..>852080)
FT                   /locus_tag="mCG_1041441"
FT                   /note="gene_id=mCG1041441.0"
FT   mRNA            complement(join(807478..807496,851397..>852080))
FT                   /locus_tag="mCG_1041441"
FT                   /product="mCG1041441"
FT                   /note="gene_id=mCG1041441.0 transcript_id=mCT159145.0
FT                   created on 24-APR-2002"
FT   assembly_gap    827543..827894
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    835992..839824
FT                   /estimated_length=3833
FT                   /gap_type="unknown"
FT   assembly_gap    849319..849338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(851909..>852079)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041441"
FT                   /product="mCG1041441"
FT                   /note="gene_id=mCG1041441.0 transcript_id=mCT159145.0
FT                   protein_id=mCP53104.1"
FT                   /protein_id="EDL05343.1"
FT                   /translation="SSVSRTKEDTWCLPWGWRSRYRGCVWGKLVCIKPLLNTQQALGTT
FT                   PSCLMSEIKMH"
FT   assembly_gap    853234..858038
FT                   /estimated_length=4805
FT                   /gap_type="unknown"
FT   assembly_gap    865512..865531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    882902..882921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    884838..885129
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    888262..888406
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   gene            900307..1195328
FT                   /gene="Slc4a4"
FT                   /locus_tag="mCG_21591"
FT                   /note="gene_id=mCG21591.2"
FT   mRNA            join(900307..900382,920459..920638,989447..989582,
FT                   999604..999764,1007335..1007514,1045951..1046027,
FT                   1083481..1083638,1090723..1090810,1093455..1093609,
FT                   1094241..1094354,1096730..1096904,1110530..1110663,
FT                   1117605..1117876,1131993..1132063,1140815..1141006,
FT                   1158816..1158929,1160825..1160986,1170083..1170261,
FT                   1171330..1171402,1178826..1178894,1181479..1181652,
FT                   1184512..1184673,1188449..1188545,1190470..1190549,
FT                   1191180..1195328)
FT                   /gene="Slc4a4"
FT                   /locus_tag="mCG_21591"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   4, transcript variant mCT19505"
FT                   /note="gene_id=mCG21591.2 transcript_id=mCT19505.2 created
FT                   on 24-APR-2002"
FT   mRNA            join(900307..900382,920459..920638,989462..989582,
FT                   999604..999764,1007335..1007727,1019066..1019174,
FT                   1083408..1083638,1090723..1090810,1093455..1093609,
FT                   1094241..1094354,1096730..1096904,1110530..1110663,
FT                   1117605..1117876,1140771..1141006,1158816..1158929,
FT                   1160825..1160986,1170083..1170261,1171330..1171402,
FT                   1178826..1178894,1181479..1181652,1184512..1184673,
FT                   1188449..1188545,1190470..1190549,1191180..1195328)
FT                   /gene="Slc4a4"
FT                   /locus_tag="mCG_21591"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   4, transcript variant mCT168223"
FT                   /note="gene_id=mCG21591.2 transcript_id=mCT168223.0 created
FT                   on 24-APR-2002"
FT   CDS             join(900310..900382,920459..920638,989447..989582,
FT                   999604..999764,1007335..1007514,1045951..1046027,
FT                   1083481..1083638,1090723..1090810,1093455..1093609,
FT                   1094241..1094354,1096730..1096904,1110530..1110663,
FT                   1117605..1117876,1131993..1132063,1140815..1141006,
FT                   1158816..1158929,1160825..1160986,1170083..1170261,
FT                   1171330..1171402,1178826..1178894,1181479..1181652,
FT                   1184512..1184673,1188449..1188545,1190470..1190513)
FT                   /codon_start=1
FT                   /gene="Slc4a4"
FT                   /locus_tag="mCG_21591"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   4, isoform CRA_a"
FT                   /note="gene_id=mCG21591.2 transcript_id=mCT19505.2
FT                   protein_id=mCP6358.2 isoform=CRA_a"
FT                   /protein_id="EDL05341.1"
FT                   /translation="MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRH
FT                   KRKAGHKEKKEKERISENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPA
FT                   PPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRT
FT                   CMEKGSIMLDREASSLPQLVEMIADHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLR
FT                   SLADIGKTVSSASRMFSNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRD
FT                   AEASNVLVGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEI
FT                   GRAIATLMSDEVFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEWDPTIRIEPPKSLPS
FT                   SDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFA
FT                   SDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCL
FT                   FAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFL
FT                   VQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPV
FT                   NLSVSNDTTLAPEDLPTISSTDMYHNVTFDWAYLSKKECVKYGGKLVGNNCDFVPDITL
FT                   MSFILFLGTYTSSMAMKKFKTSRYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKL
FT                   IVPSEFKPTSPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHK
FT                   LKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFL
FT                   GVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLL
FT                   MPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKG
FT                   MDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIP
FT                   MDIMEQQPFLSDNKPLDRERSSTFLERHTSC"
FT   CDS             join(900310..900382,920459..920638,989462..989582,
FT                   999604..999764,1007335..1007727,1019066..1019174,
FT                   1083408..1083638,1090723..1090810,1093455..1093609,
FT                   1094241..1094354,1096730..1096904,1110530..1110663,
FT                   1117605..1117876,1140771..1141006,1158816..1158929,
FT                   1160825..1160986,1170083..1170261,1171330..1171402,
FT                   1178826..1178894,1181479..1181652,1184512..1184673,
FT                   1188449..1188545,1190470..1190513)
FT                   /codon_start=1
FT                   /gene="Slc4a4"
FT                   /locus_tag="mCG_21591"
FT                   /product="solute carrier family 4 (anion exchanger), member
FT                   4, isoform CRA_b"
FT                   /note="gene_id=mCG21591.2 transcript_id=mCT168223.0
FT                   protein_id=mCP91137.0 isoform=CRA_b"
FT                   /protein_id="EDL05342.1"
FT                   /translation="MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRH
FT                   KRKAGHKEKKEKERISENYSDKSDVENADESSSSILKPLKRIRFILGEEDDSPAPPQLF
FT                   TELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKG
FT                   SIMLDREASSLPQLVEMIADHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADI
FT                   GKTVSSASRMFSNPDNGNAEPVAAASSLFLCHLTPSLHTPYPLYFFSQVHAPWSFHDPR
FT                   SITGCMCNLVGRVSLLLQVTKPQCLDSLSRSPLENSVPCLANRTLDDDPRVRRTPSVGW
FT                   LSKSMGSYVYGIFYYFSLEINYIFLALPMQLKNKFMKKLPRDAEASNVLVGEVDFLDTP
FT                   FIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIA
FT                   YKAKDRHDLIAGIDEFLDEVIVLPPGEWDPTIRIEPPKSLPSSDKRKNMYSGGENVQMN
FT                   GDTPHDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILF
FT                   IYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLV
FT                   FERLLFNFSKDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQYFTRFTEEGFSSLIS
FT                   FIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPVSKETIKKPFLFSFQYHN
FT                   VTFDWAYLSKKECVKYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFP
FT                   TTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVPPFGGNPWW
FT                   VCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMAL
FT                   PWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPIL
FT                   KFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFL
FT                   QVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKE
FT                   DEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDNKPLDRERSSTFLE
FT                   RHTSC"
FT   assembly_gap    917598..917781
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    944062..944081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    945899..945918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    954855..955471
FT                   /estimated_length=617
FT                   /gap_type="unknown"
FT   assembly_gap    969593..969612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    983414..983442
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    1045135..1045561
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    1046953..1047012
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    1048328..1048694
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    1074471..1074579
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    1077431..1078239
FT                   /estimated_length=809
FT                   /gap_type="unknown"
FT   assembly_gap    1097605..1097772
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    1140143..1140343
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    1179195..1179219
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    1221942..1221961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1234736..1235086
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    1263540..1266879
FT                   /estimated_length=3340
FT                   /gap_type="unknown"
FT   assembly_gap    1271434..1273331
FT                   /estimated_length=1898
FT                   /gap_type="unknown"
FT   assembly_gap    1273674..1273693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1281924..1282747
FT                   /estimated_length=824
FT                   /gap_type="unknown"
FT   assembly_gap    1283868..1285806
FT                   /estimated_length=1939
FT                   /gap_type="unknown"
FT   assembly_gap    1289952..1289971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1321015..1322599
FT                   /estimated_length=1585
FT                   /gap_type="unknown"
FT   assembly_gap    1339216..1339235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1339354..1340135
FT                   /pseudo
FT                   /locus_tag="mCG_1041459"
FT                   /note="gene_id=mCG1041459.1"
FT   mRNA            1339354..1340135
FT                   /pseudo
FT                   /locus_tag="mCG_1041459"
FT                   /note="gene_id=mCG1041459.1 transcript_id=mCT159163.1
FT                   created on 24-APR-2002"
FT   assembly_gap    1340479..1340934
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    1343087..1343743
FT                   /estimated_length=657
FT                   /gap_type="unknown"
FT   assembly_gap    1346549..1346568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1351051..1351335
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    1353351..1355320
FT                   /estimated_length=1970
FT                   /gap_type="unknown"
FT   assembly_gap    1361120..1361433
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   gene            complement(1371637..1410659)
FT                   /locus_tag="mCG_12452"
FT                   /note="gene_id=mCG12452.1"
FT   mRNA            complement(join(1371637..1371813,1376187..1376245,
FT                   1380170..1380500,1391005..1391207,1392292..1392421,
FT                   1393961..1394055,1394322..1394454,1396164..1396375,
FT                   1398065..1398197,1399267..1399336,1410419..1410659))
FT                   /locus_tag="mCG_12452"
FT                   /product="mCG12452, transcript variant mCT13247"
FT                   /note="gene_id=mCG12452.1 transcript_id=mCT13247.2 created
FT                   on 24-APR-2002"
FT   mRNA            complement(join(1371650..1371813,1376187..1376245,
FT                   1380170..1380302,1391005..1391207,1392292..1392421,
FT                   1393961..1394055,1394322..1394454,1396164..1396375,
FT                   1398065..1398197,1399267..1399336,1410419..1410658))
FT                   /locus_tag="mCG_12452"
FT                   /product="mCG12452, transcript variant mCT168211"
FT                   /note="gene_id=mCG12452.1 transcript_id=mCT168211.0 created
FT                   on 24-APR-2002"
FT   CDS             complement(join(1376210..1376245,1380170..1380302,
FT                   1391005..1391207,1392292..1392421,1393961..1394055,
FT                   1394322..1394454,1396164..1396375,1398065..1398197,
FT                   1399267..1399336,1410419..1410476))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12452"
FT                   /product="mCG12452, isoform CRA_b"
FT                   /note="gene_id=mCG12452.1 transcript_id=mCT168211.0
FT                   protein_id=mCP91143.0 isoform=CRA_b"
FT                   /protein_id="EDL05340.1"
FT                   /translation="MKRVLVLLLALAFGHALERGRDYEKDKVCNELAMLGKEDFRSLSL
FT                   ILYSRKFSSSTFEQVNQLVKEVVSLTEECCAEGADPTCYDTRTSELSVKSCESDAPFPV
FT                   HPGTPECCTKEGLERKLCMAALSHQPQEFPTYVEPTNDEICEAFRRDPKGFADQFLYEY
FT                   SSNYGQAPLPLLVAYTKNYLSMVGSCCTSANPTVCFVKERLQMKHLSLLTTMSNRVCSQ
FT                   YAAYGKEKSRLSHLIKLAQKVPTANLENVLPLAEDFTEILSRCCESTSEDCMASELPEH
FT                   TIKICQNLSKKNSKFEECCQENTPMNIFMCTYFMPAAEPLQLPAIKLPTGKDLCGQSTT
FT                   QAMDQLAERLRTKTPNTSPAELKDMVEKHSDFASKCCSINSPPLYCSSQIDAEMIDTLQ
FT                   S"
FT   CDS             complement(join(1376210..1376245,1380170..1380500,
FT                   1391005..1391207,1392292..1392421,1393961..1394055,
FT                   1394322..1394454,1396164..1396375,1398065..1398197,
FT                   1399267..1399336,1410419..1410476))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12452"
FT                   /product="mCG12452, isoform CRA_a"
FT                   /note="gene_id=mCG12452.1 transcript_id=mCT13247.2
FT                   protein_id=mCP10886.2 isoform=CRA_a"
FT                   /protein_id="EDL05339.1"
FT                   /translation="MKRVLVLLLALAFGHALERGRDYEKDKVCNELAMLGKEDFRSLSL
FT                   ILYSRKFSSSTFEQVNQLVKEVVSLTEECCAEGADPTCYDTRTSELSVKSCESDAPFPV
FT                   HPGTPECCTKEGLERKLCMAALSHQPQEFPTYVEPTNDEICEAFRRDPKGFADQFLYEY
FT                   SSNYGQAPLPLLVAYTKNYLSMVGSCCTSANPTVCFVKERLQMKHLSLLTTMSNRVCSQ
FT                   YAAYGKEKSRLSHLIKLAQKVPTANLENVLPLAEDFTEILSRCCESTSEDCMASELPEH
FT                   TIKICQNLSKKNSKFEECCQENTPMNIFMCTYFMPAAEPLQLPAIKLPTGKDLCGQSTT
FT                   QAMDHWLSNSVSISVCLHDFEWGIDFNSNPNTAHSNSIPQIGFPEMVVILLKQCSYNNS
FT                   SLTLQIIIFFFRLAERLRTKTPNTSPAELKDMVEKHSDFASKCCSINSPPLYCSSQIDA
FT                   EMIDTLQS"
FT   assembly_gap    1382065..1388739
FT                   /estimated_length=6675
FT                   /gap_type="unknown"
FT   assembly_gap    1413725..1413927
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    1437979..1437998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1445295..1445314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1451890..1452720)
FT                   /pseudo
FT                   /locus_tag="mCG_12456"
FT                   /note="gene_id=mCG12456.2"
FT   mRNA            complement(1451890..1452720)
FT                   /pseudo
FT                   /locus_tag="mCG_12456"
FT                   /note="gene_id=mCG12456.2 transcript_id=mCT13251.2 created
FT                   on 24-APR-2002"
FT   assembly_gap    1455652..1455671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1463795..1463814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1465776..1467441
FT                   /estimated_length=1666
FT                   /gap_type="unknown"
FT   assembly_gap    1479256..1480704
FT                   /estimated_length=1449
FT                   /gap_type="unknown"
FT   assembly_gap    1484890..1484909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1485650..1485872
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    1489856..1489965
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            <1518563..>1534278
FT                   /gene="Npffr2"
FT                   /locus_tag="mCG_12457"
FT                   /note="gene_id=mCG12457.2"
FT   mRNA            join(<1518563..1518890,1522393..1522492,1533453..>1534278)
FT                   /gene="Npffr2"
FT                   /locus_tag="mCG_12457"
FT                   /product="neuropeptide FF receptor 2"
FT                   /note="gene_id=mCG12457.2 transcript_id=mCT13252.1 created
FT                   on 24-APR-2002"
FT   CDS             join(1518563..1518890,1522393..1522492,1533453..1534278)
FT                   /codon_start=1
FT                   /gene="Npffr2"
FT                   /locus_tag="mCG_12457"
FT                   /product="neuropeptide FF receptor 2"
FT                   /note="gene_id=mCG12457.2 transcript_id=mCT13252.1
FT                   protein_id=mCP10897.1"
FT                   /protein_id="EDL05338.1"
FT                   /translation="MSEKWDSNSSESWNHIWSGNDTQHHWYSDINITYVNYYLHQPQVA
FT                   AVFISSYLLIFVLCMVGNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLL
FT                   DNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVT
FT                   IVIIWGLAIAIMTPSAIMLHVQEEKYYRVRLSSHNKTSTVYWCREDWPRHEMRRIYTTV
FT                   LFATIYLAPLSLIVIMYARIGASLFKTAAHCTGKQRPVQWHVSKKKQKVIKMLLTVALL
FT                   FILSWLPLWTLMMLSDYTDLSPNKLRIINIYIYPFAHWLAFCNSSVNPIIYGFFNENFR
FT                   NGFQDAFQICQKKAKPQEAYSLRAKRNIVINTSGLLVQEPVSQNPGGENLGCGKSADNP
FT                   TQESLIEEMGEATNSTVA"
FT   assembly_gap    1520254..1520273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1568964..1568983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<1570201..>1571055)
FT                   /locus_tag="mCG_1041458"
FT                   /note="gene_id=mCG1041458.1"
FT   mRNA            complement(<1570201..>1571055)
FT                   /locus_tag="mCG_1041458"
FT                   /product="mCG1041458"
FT                   /note="gene_id=mCG1041458.1 transcript_id=mCT159162.1
FT                   created on 24-APR-2002"
FT   CDS             complement(<1570201..>1571054)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041458"
FT                   /product="mCG1041458"
FT                   /note="gene_id=mCG1041458.1 transcript_id=mCT159162.1
FT                   protein_id=mCP53067.1"
FT                   /protein_id="EDL05337.1"
FT                   /translation="ESPLAAFTRGFWKLESPLAAFTWGFWKLESPLAAFMRGFWKLESP
FT                   LAAFTWGFWKLESPLAALMRGFWKLESPLAALMRGFWKLESPLAAFTWGFWKLESPLAA
FT                   FTRGFWKLESPLAAFTWGFWKLESPLAAFTWGFWKLESPLAAFTWGFWKLESSLAALMR
FT                   GFWKLESPLAAFTWGFWKLESPLAAFTWGFWKLESPLAAFMWGFWKLESPLAALMRGFW
FT                   KLESPLAALMQGFWKLESPLAAFTWGFWKLESPLAALMRGFWKLESPHFHSASAASVNA
FT                   PLP"
FT   assembly_gap    1571261..1571943
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   gene            complement(<1571944..1573325)
FT                   /locus_tag="mCG_1041440"
FT                   /note="gene_id=mCG1041440.1"
FT   mRNA            complement(<1571944..1573325)
FT                   /locus_tag="mCG_1041440"
FT                   /product="mCG1041440"
FT                   /note="gene_id=mCG1041440.1 transcript_id=mCT159144.1
FT                   created on 24-APR-2002"
FT   CDS             complement(<1571944..1572736)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041440"
FT                   /product="mCG1041440"
FT                   /note="gene_id=mCG1041440.1 transcript_id=mCT159144.1
FT                   protein_id=mCP53102.1"
FT                   /protein_id="EDL05336.1"
FT                   /translation="MGLLEVGVTPCCIHVGLLEVGVTPCCIHVGLLEVGVTPCCIHVGL
FT                   LEVGVTPCCIHAGLLEVGVTPCCIHVGLLEVGVTPCCIHVGLLEVGVTPCCIHVGLLEV
FT                   GVTPCCIHVGLLEVGVTPCCIHAGLLEVGVTPCCIHVGLLEVGVTPCCIHVGLLEVGVT
FT                   PCCIHAGLLEVGVTPCCIHVGLLEVGVTPCCTHAGLLEVGVTPCCTHAGLLEVGVTPCC
FT                   IHVGLLEVGVTPCCVHTGLLEVGVTPCCIHVGLLEVGVTPCC"
FT   assembly_gap    1614185..1614373
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    1618443..1618872
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   gene            complement(1628158..1844262)
FT                   /locus_tag="mCG_12454"
FT                   /note="gene_id=mCG12454.3"
FT   mRNA            complement(join(1628158..1629081,1634279..1634396,
FT                   1635449..1635656,1637914..1638046,1642417..1642582,
FT                   1644158..1644321,1645869..1645949,1649319..1649442,
FT                   1651532..1651665,1652764..1652939,1654059..1654204,
FT                   1656362..1656475,1657814..1657946,1658469..1658612,
FT                   1658966..1659071,1659775..1659931,1661808..1661891,
FT                   1672736..1672935,1725637..1725793,1822295..1822701,
FT                   1842464..1842491,1843749..1844262))
FT                   /locus_tag="mCG_12454"
FT                   /product="mCG12454, transcript variant mCT13248"
FT                   /note="gene_id=mCG12454.3 transcript_id=mCT13248.3 created
FT                   on 25-APR-2003"
FT   CDS             complement(join(1628519..1629081,1634279..1634396,
FT                   1635449..1635656,1637914..1638046,1642417..1642582,
FT                   1644158..1644321,1645869..1645949,1649319..1649442,
FT                   1651532..1651665,1652764..1652939,1654059..1654204,
FT                   1656362..1656475,1657814..1657946,1658469..1658612,
FT                   1658966..1659071,1659775..1659931,1661808..1661891,
FT                   1672736..1672935,1725637..1725793,1822295..1822701,
FT                   1842464..1842491,1843749..1843817))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12454"
FT                   /product="mCG12454, isoform CRA_a"
FT                   /note="gene_id=mCG12454.3 transcript_id=mCT13248.3
FT                   protein_id=mCP10891.3 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9D2"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR010294"
FT                   /db_xref="InterPro:IPR010909"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR036383"
FT                   /db_xref="MGI:MGI:3045353"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9D2"
FT                   /protein_id="EDL05334.1"
FT                   /translation="MVFLSLWLIAASLVEVRTSADGQAGTDEMVQIDLPTKRYREYELV
FT                   TPVSTNLKGHYLSHILSANHKKRSPRDVSSNSEHLFFNVTAFGRDFHLRLKPNTHFIAP
FT                   GAVVEWHETAPRPGNTTDPRNSHLHGSASEGSWRSEPLQTSCAYVGDIMDIPGTSVAIS
FT                   NCDGLAGMIKSDDEEYFIEPLERGKQMDEENGRIHVVYKRSAVEQPPRDVSEDVYHRES
FT                   DLEGLDDLGTVYSNIGQQLNKTMRRRRHTGENDYNIEVLLGVDDSVVRFHGKEHVQNYL
FT                   LTLMNIVNEIYHDESLGVHINVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWACQQQ
FT                   KTDPNHAEHHDHAIFLTRQDFGPAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHE
FT                   TGHVLGMEHDGQGNRCGDETAMGSVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLD
FT                   DPFEHDWPKLPELPGINYSMDEQCRFDFGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCK
FT                   TKKGPPLDGTECAAGKWCYKGHCMWKNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTR
FT                   QCNNPTPINGGQDCPGVNFEYQLCNTEECQKHFEDFRAQQCQQRNSHFDYQNTKHHWLP
FT                   HEHPDSKKRCHLYCQSKETGDVAYMKQLVHDGTRCSYKDPYSICVRGECVKVGCDREIG
FT                   SNKVEDKCGVCGGDNSHCRTVKGTFTRTPRKLGYLKMFDIPPGARHVLIQEDEASPHVL
FT                   AIKNQATGHYILNGKGEEAKSRTFIDLGVEWDYNIEDDIETLHTDGPLHDPVIVLIIPQ
FT                   ENDTRSSLTYKYIIHEDSVPTINSNNVIQEELDTFEWALKSWSQCSEPCGGGFQYTKYG
FT                   CRRKSDSKMVHRSFCEVNKKPKPIRRMCNIQECTHPVWAADEWEHCSRSCGSSGNQLRT
FT                   VRCLQPLQDGTNRSVHSKYCLGDRPESRRPCNRVPCPAQWKTGSWNECSVTCGEGTEVR
FT                   QVLCRTGDHCDGEKPESVRPCQLPPCNDEPCLGDKSIFCQMEVLARYCSIPGYNKLCCE
FT                   SCSKRSGTLPPPYLQEAAEIHSDAIFGPSDLPRSLVMPTPFLPSSSGTRAEKKSLSSFS
FT                   SMANPNADAAFRASSRASADFPRKRAHQAGRKTLESVPSSSSIKTDHLRPASPVAAAPS
FT                   PAISDSIGASPQTRTPKKDDAKSVSRRHPTRSTASER"
FT   gene            complement(1640271..1641447)
FT                   /pseudo
FT                   /locus_tag="mCG_12453"
FT                   /note="gene_id=mCG12453.2"
FT   mRNA            complement(1640271..1641447)
FT                   /pseudo
FT                   /locus_tag="mCG_12453"
FT                   /note="gene_id=mCG12453.2 transcript_id=mCT13249.2 created
FT                   on 24-APR-2002"
FT   assembly_gap    1664554..1664573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1758775..1758794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1760543..1763015
FT                   /estimated_length=2473
FT                   /gap_type="unknown"
FT   assembly_gap    1764170..1764189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1781924..1781943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1784553..1784572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1787424..1787443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1788275..1791153
FT                   /estimated_length=2879
FT                   /gap_type="unknown"
FT   assembly_gap    1792907..1792926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1794662..1794681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1795596..1796447,1822295..1822701,
FT                   1842464..1842491,1843749..1844262))
FT                   /locus_tag="mCG_12454"
FT                   /product="mCG12454, transcript variant mCT168212"
FT                   /note="gene_id=mCG12454.3 transcript_id=mCT168212.1 created
FT                   on 25-APR-2003"
FT   CDS             complement(join(1796265..1796447,1822295..1822701,
FT                   1842464..1842491,1843749..1843817))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12454"
FT                   /product="mCG12454, isoform CRA_b"
FT                   /note="gene_id=mCG12454.3 transcript_id=mCT168212.1
FT                   protein_id=mCP91131.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BIB2"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="MGI:MGI:3045353"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BIB2"
FT                   /protein_id="EDL05335.1"
FT                   /translation="MVFLSLWLIAASLVEVRTSADGQAGTDEMVQIDLPTKRYREYELV
FT                   TPVSTNLKGHYLSHILSANHKKRSPRDVSSNSEHLFFNVTAFGRDFHLRLKPNTHFIAP
FT                   GAVVEWHETAPRPGNTTDPRNSHLHGSASEGSWRSEPLQTSCAYVGDIMDIPGTSVAIS
FT                   NCDGLTFEEDSSPWTSWLTVAFAKIAQNDLYLWSSLTFMPLPPSAKMAIACPHMLHFSQ
FT                   HQMVGF"
FT   assembly_gap    1814605..1814688
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    1817612..1817631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1818911..1819208
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    1844439..1844497
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    1880174..1880253
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1917973..1919933
FT                   /estimated_length=1961
FT                   /gap_type="unknown"
FT   assembly_gap    1928684..1932650
FT                   /estimated_length=3967
FT                   /gap_type="unknown"
FT   assembly_gap    1948016..1948803
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    1955260..1955417
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    1969429..1970134
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    1993216..1993235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2002206..2002225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2003240..2003259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2011660..2011679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2013403..2013422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2026523..2027380
FT                   /estimated_length=858
FT                   /gap_type="unknown"
FT   assembly_gap    2029958..2029991
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    2034529..2034548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2035625..2035644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2037321..2037340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2038512..2038531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2039925..2039944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2041320..2041339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2045277..2047838
FT                   /estimated_length=2562
FT                   /gap_type="unknown"
FT   assembly_gap    2060901..2060920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2069474..2073429
FT                   /estimated_length=3956
FT                   /gap_type="unknown"
FT   assembly_gap    2082179..2082250
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2092382..2092414
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            2103370..2104475
FT                   /locus_tag="mCG_49576"
FT                   /note="gene_id=mCG49576.2"
FT   mRNA            2103370..2104475
FT                   /locus_tag="mCG_49576"
FT                   /product="mCG49576, transcript variant mCT49759"
FT                   /note="gene_id=mCG49576.2 transcript_id=mCT49759.2 created
FT                   on 23-APR-2002"
FT   mRNA            join(2103370..2103837,2103917..2104475)
FT                   /locus_tag="mCG_49576"
FT                   /product="mCG49576, transcript variant mCT168229"
FT                   /note="gene_id=mCG49576.2 transcript_id=mCT168229.0 created
FT                   on 23-APR-2002"
FT   CDS             join(2103406..2103837,2103917..2103970)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49576"
FT                   /product="mCG49576, isoform CRA_a"
FT                   /note="gene_id=mCG49576.2 transcript_id=mCT168229.0
FT                   protein_id=mCP91146.0 isoform=CRA_a"
FT                   /protein_id="EDL05332.1"
FT                   /translation="MADDLDFETGDAGPSATFPMQCSALRKNGFVVLKGGPCKIVEMST
FT                   SKTGKHGHAKVHLVGTDIFTGKKYEDICPSTHNMDVPNIKRNNFQLVGIQNGYLSLLQN
FT                   SEEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEPGSALAGPLARLLFKFI"
FT   CDS             2103406..2103852
FT                   /codon_start=1
FT                   /locus_tag="mCG_49576"
FT                   /product="mCG49576, isoform CRA_b"
FT                   /note="gene_id=mCG49576.2 transcript_id=mCT49759.2
FT                   protein_id=mCP32764.2 isoform=CRA_b"
FT                   /protein_id="EDL05333.1"
FT                   /translation="MADDLDFETGDAGPSATFPMQCSALRKNGFVVLKGGPCKIVEMST
FT                   SKTGKHGHAKVHLVGTDIFTGKKYEDICPSTHNMDVPNIKRNNFQLVGIQNGYLSLLQN
FT                   SEEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAMAK"
FT   assembly_gap    2108991..2109074
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    2110336..2110424
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    2113359..2113378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2121704..2121774
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    2137887..2137906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2143714..2143782
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    2150341..2150360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2156267..2156286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2157854..2157873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2158903..2160689
FT                   /estimated_length=1787
FT                   /gap_type="unknown"
FT   assembly_gap    2163273..2163292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2173274..2173559
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    2177046..2177207
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    2179743..2180512
FT                   /estimated_length=770
FT                   /gap_type="unknown"
FT   gene            complement(2190081..2199340)
FT                   /gene="Cox18"
FT                   /locus_tag="mCG_12451"
FT                   /note="gene_id=mCG12451.2"
FT   mRNA            complement(join(2190081..2190529,2192871..2192978,
FT                   2194266..2194387,2194714..2194877,2197585..2197685,
FT                   2198968..2199340))
FT                   /gene="Cox18"
FT                   /locus_tag="mCG_12451"
FT                   /product="COX18 cytochrome c oxidase assembly homolog (S.
FT                   cerevisiae), transcript variant mCT13246"
FT                   /note="gene_id=mCG12451.2 transcript_id=mCT13246.2 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(2190081..2190529,2192871..2192978,
FT                   2194266..2194390,2194714..2194877,2197585..2197685,
FT                   2198968..2199339))
FT                   /gene="Cox18"
FT                   /locus_tag="mCG_12451"
FT                   /product="COX18 cytochrome c oxidase assembly homolog (S.
FT                   cerevisiae), transcript variant mCT179784"
FT                   /note="gene_id=mCG12451.2 transcript_id=mCT179784.0 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(2190081..2190529,2192871..2192978,
FT                   2194266..2194387,2194714..2195145))
FT                   /gene="Cox18"
FT                   /locus_tag="mCG_12451"
FT                   /product="COX18 cytochrome c oxidase assembly homolog (S.
FT                   cerevisiae), transcript variant mCT168210"
FT                   /note="gene_id=mCG12451.2 transcript_id=mCT168210.0 created
FT                   on 06-FEB-2003"
FT   CDS             complement(join(2190353..2190529,2192871..2192978,
FT                   2194266..2194387,2194714..2194877,2197585..2197685,
FT                   2198968..2199291))
FT                   /codon_start=1
FT                   /gene="Cox18"
FT                   /locus_tag="mCG_12451"
FT                   /product="COX18 cytochrome c oxidase assembly homolog (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG12451.2 transcript_id=mCT13246.2
FT                   protein_id=mCP10935.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VC74"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="MGI:MGI:2448532"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VC74"
FT                   /protein_id="EDL05329.1"
FT                   /translation="MLCRSCAGWLRSLPTLRLPAPGSPPAWSSARLPALPVWAAASVSA
FT                   ASPGGWYEALAASAPVRTAEEVLLGAQEATGLPWWSNIILSTVALRGAVTLPLAAYQHY
FT                   ILAKVENLQPEIKDIAKRLNQEVAVCARQFGWSKRVARLTYLKNMRRLISELYVRDNCH
FT                   PFKATVLVWVQLPMWVFISVALRNLSTGATHSDGISVQEQLAAGGTLWFPDLTAVDSTW
FT                   ILPVSVGVVNLLIVEIFALQKIGTSRFQMYVTNFVRAVSVLMIPVAATVPSALVLYWLC
FT                   SSLMGLAQNLLLRSPGFRQLCRIPPSKSDSETPYRDLSAAFCAKFLSRKR"
FT   CDS             complement(join(2190353..2190529,2192871..2192978,
FT                   2194266..2194390,2194714..2194877,2197585..2197685,
FT                   2198968..2199291))
FT                   /codon_start=1
FT                   /gene="Cox18"
FT                   /locus_tag="mCG_12451"
FT                   /product="COX18 cytochrome c oxidase assembly homolog (S.
FT                   cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG12451.2 transcript_id=mCT179784.0
FT                   protein_id=mCP102706.0 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8U6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="MGI:MGI:2448532"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8U6"
FT                   /protein_id="EDL05331.1"
FT                   /translation="MLCRSCAGWLRSLPTLRLPAPGSPPAWSSARLPALPVWAAASVSA
FT                   ASPGGWYEALAASAPVRTAEEVLLGAQEATGLPWWSNIILSTVALRGAVTLPLAAYQHY
FT                   ILAKVENLQPEIKDIAKRLNQEVAVCARQFGWSKRVARLTYLKNMRRLISELYVRDNCH
FT                   PFKATVLVWVQLPMWVFISVALRNLSTGATHSDAGISVQEQLAAGGTLWFPDLTAVDST
FT                   WILPVSVGVVNLLIVEIFALQKIGTSRFQMYVTNFVRAVSVLMIPVAATVPSALVLYWL
FT                   CSSLMGLAQNLLLRSPGFRQLCRIPPSKSDSETPYRDLSAAFCAKFLSRKR"
FT   CDS             complement(join(2190353..2190529,2192871..2192978,
FT                   2194266..2194387,2194714..2194858))
FT                   /codon_start=1
FT                   /gene="Cox18"
FT                   /locus_tag="mCG_12451"
FT                   /product="COX18 cytochrome c oxidase assembly homolog (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG12451.2 transcript_id=mCT168210.0
FT                   protein_id=mCP91154.0 isoform=CRA_b"
FT                   /protein_id="EDL05330.1"
FT                   /translation="MRRLISELYVRDNCHPFKATVLVWVQLPMWVFISVALRNLSTGAT
FT                   HSDGISVQEQLAAGGTLWFPDLTAVDSTWILPVSVGVVNLLIVEIFALQKIGTSRFQMY
FT                   VTNFVRAVSVLMIPVAATVPSALVLYWLCSSLMGLAQNLLLRSPGFRQLCRIPPSKSDS
FT                   ETPYRDLSAAFCAKFLSRKR"
FT   gene            complement(2202518..2343897)
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /note="gene_id=mCG12455.4"
FT   mRNA            complement(join(2202518..2204693,2206159..2206323,
FT                   2207592..2207770,2209252..2209500,2214290..2214502,
FT                   2218215..2219845,2226688..2226837,2229166..2229321,
FT                   2229794..2230241,2230938..2231109,2236165..2236281,
FT                   2236964..2237059,2240138..2240300,2240870..2241045,
FT                   2241507..2241720,2242311..2242453,2245779..2245924,
FT                   2246085..2246196,2255691..2255839,2262489..2262591,
FT                   2262936..2263079,2263284..2263411,2264697..2264784,
FT                   2266032..2266141,2266686..2266877,2268396..2268633,
FT                   2270650..2270744,2273033..2273266,2275436..2275583,
FT                   2275990..2276137,2277439..2277595,2281363..2281516,
FT                   2342991..>2343518))
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, transcript variant
FT                   mCT189817"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT189817.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(2202518..2204693,2206159..2206323,
FT                   2207592..2207770,2209252..2209500,2214290..2214502,
FT                   2218215..2219845,2226688..2226837,2229166..2229321,
FT                   2229794..2230241,2230938..2231109,2236165..2236281,
FT                   2236964..2237059,2240138..2240300,2240870..2241045,
FT                   2241507..2241720,2242311..2242453,2245779..2245924,
FT                   2246085..2246196,2255691..2255839,2260299..2261051,
FT                   2262489..2262591,2262936..2263079,2263284..2263411,
FT                   2264697..2264784,2266032..2266141,2266686..2266877,
FT                   2268396..2268633,2270650..2270744,2273033..2273266,
FT                   2275436..2275583,2275990..2276137,2277439..2277595,
FT                   2281363..2281516,2342991..>2343518))
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, transcript variant
FT                   mCT189816"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT189816.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(2202519..2204693,2206159..2206323,
FT                   2207592..2207770,2209252..2209500,2214290..2214502,
FT                   2218215..2219845,2226688..2226837,2229166..2229321,
FT                   2229794..2230241,2230938..2231109,2234732..2234848,
FT                   2236964..2237059,2240138..2240300,2240870..2241045,
FT                   2241507..2241720,2242311..2242453,2245779..2245924,
FT                   2246085..2246196,2255691..2255836,2260299..2261051,
FT                   2262489..2262591,2262936..2263079,2263284..2263411,
FT                   2264697..2264784,2266032..2266141,2266686..2266877,
FT                   2268396..2268633,2270650..2270744,2273033..2273266,
FT                   2275436..2275583,2275990..2276137,2277439..2277595,
FT                   2281363..2281516,2342991..2343897))
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, transcript variant
FT                   mCT182051"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT182051.0 created
FT                   on 25-APR-2003"
FT   mRNA            complement(join(2202519..2204693,2206159..2206323,
FT                   2207592..2207770,2209252..2209500,2214290..2214502,
FT                   2218215..2219845,2226688..2226837,2229166..2229321,
FT                   2229794..2230241,2230938..2231109,2236165..2236281,
FT                   2236964..2237059,2240138..2240300,2240870..2241045,
FT                   2241507..2241720,2242311..2242453,2245779..2245924,
FT                   2246085..2246196,2255691..2255836,2260299..2261051,
FT                   2262489..2262591,2262936..2263079,2263284..2263411,
FT                   2264697..2264784,2266032..2266141,2266686..2266877,
FT                   2268396..2268633,2270650..2270744,2273033..2273266,
FT                   2275436..2275583,2275990..2276137,2277439..2277595,
FT                   2281363..2281516,2342991..2343897))
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, transcript variant
FT                   mCT13250"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT13250.3 created
FT                   on 25-APR-2003"
FT   mRNA            complement(join(2202519..2204693,2206159..2206323,
FT                   2207592..2207770,2209252..2209500,2214290..2214502,
FT                   2218215..2219845,2226688..2226837,2229166..2229321,
FT                   2229794..2230241,2230938..2231109,2236165..2236281,
FT                   2236964..2237059,2240138..2240300,2240870..2241045,
FT                   2241507..2241720,2242311..2242453,2245779..2245924,
FT                   2246085..2246196,2255691..2255836,2260299..2261051,
FT                   2262489..2262591,2262936..2263079,2263284..2263411,
FT                   2264697..2264784,2266032..2266141,2266686..2266877,
FT                   2268396..2268633,2270650..2270744,2273033..2273266,
FT                   2275436..2275583,2275990..2276137,2277439..2277595,
FT                   2281363..2281516,2316991..2318010))
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, transcript variant
FT                   mCT182052"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT182052.0 created
FT                   on 25-APR-2003"
FT   CDS             complement(join(2204634..2204693,2206159..2206323,
FT                   2207592..2207770,2209252..2209500,2214290..2214502,
FT                   2218215..2219845,2226688..2226837,2229166..2229321,
FT                   2229794..2230241,2230938..2231109,2236165..2236281,
FT                   2236964..2237059,2240138..2240300,2240870..2241045,
FT                   2241507..2241720,2242311..2242453,2245779..2245924,
FT                   2246085..2246196,2255691..2255839,2262489..2262591,
FT                   2262936..2263079,2263284..2263411,2264697..2264784,
FT                   2266032..2266141,2266686..2266877,2268396..2268633,
FT                   2270650..2270744,2273033..2273266,2275436..2275583,
FT                   2275990..2276137,2277439..2277595,2281363..2281516,
FT                   2342991..>2343518))
FT                   /codon_start=1
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, isoform CRA_d"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT189817.0
FT                   protein_id=mCP110803.0 isoform=CRA_d partial"
FT                   /protein_id="EDL05327.1"
FT                   /translation="SRGDRGGGGGGGPERCVGPGATEVAVERSPPTXXXXXXXRVPHPL
FT                   FPRGWRRRRFRRRLREKGVPRRRRQWRPPPAAAAAEVGGGARPASSPRGMVRVCDLLLK
FT                   KKPPQQQQQQQPPHHKAKRNRTCRPPSSSESSSDSDNSGGGGGGGGGGGGGTSSNNSEE
FT                   EEDDDDEEEEVSEVESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLEA
FT                   LLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDNR
FT                   SLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVED
FT                   RGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLL
FT                   ESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGH
FT                   LEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLT
FT                   LAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTE
FT                   ETQETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANV
FT                   HATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFL
FT                   ISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGG
FT                   HTSVVCYLLDYPNNLLAAPPPDVTQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPAN
FT                   LAATLPVRSKAVSGRASAMSNTPTHSIAASVSQPQTPTPSPIISPSAMLPIYPAIDIDA
FT                   QTESNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILL
FT                   DNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASGGY
FT                   VNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNT
FT                   ALTLACFQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYAEVGRVLLDKGADVNA
FT                   PPVPSSRDTALTIAADKGHYKFCELLIGKGAHIDVRNKKGNTPLWLAANGGHLDVVQLL
FT                   VQATADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEML
FT                   KKCHLCMESIVQAKDRQAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRK
FT                   KKEEQRRKLEEIEAKNKENFELQAAQEKEKLKVEEEPEVLTEPPSATTTTTIGISATWT
FT                   TLAGSHGKRNNTITTTSSKRKNRKNKITPENVQIIFDDPLPISYSQPEKVNGESKSSST
FT                   SESGDSDNMRISSCSDESSNSNSSRKSNNHASAVVTTTMASKKQPSVLVTFPKEERKSV
FT                   SGKASIKLSETVNEGTSNSLSTCTKSGPSPLSSPNGKLTVASPKRGPKREEGWKEVVRR
FT                   SKKVSVPSTVISRVIGRGGCNINAIRECTGAHIDIDKQKDKTGDRIITIRGGTESTRQA
FT                   TQLINALIKDPDKEIDELIPKNRLKSSTANSKIGSSAPTTTAANSSLMGIKMTTVALSS
FT                   TSQTATALTVPAISSASTHKTIKNPVNNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQI
FT                   RPPRLPMTHFGGTFPPAQSTWGPFPVRPLSPARATNSPKPHMVPRHSNQNSSGSQVNSA
FT                   GSLTSSPTTTASSSASAVPGTTSNGSPSSPSVRRQLFVTVVKTSNATTTTVTTTASNNS
FT                   TAPTNATYPMPTAKEHYPVSSPSSPSPPAQPGGVSRNSPLDCGSASPNKGASASEQEAS
FT                   SPPVVEPANSRPPHSSSSSGSSSGHSTQQQPPGSVPQEPRPPLQQSQVPSPDVRMTVPP
FT                   TATSSAPVAVPSTAPVTYPMPQTQMGCSQPPKMEAPAIRPPSHATAAPHKTPAPVQSSS
FT                   ASVLNVNHIKRPHSVPSSVQLPSTLSTQSACQNSVHPANKPVAPNFSAPLPFGPFSTLF
FT                   ENNPTNAHAFWGGPVVSSQSTPESMLSGKSSYLPNSDPLHQSDTSKAPGFRPPLQRPAP
FT                   SPSGIVNMDTPYGSVTPSSTHLGNFASSLSGGQMYGPGAPLGGAPLGGAPTAANFNRQH
FT                   FSPLSLLTPCSSASNESPAQSVSSGVRAPSPAPSSVPLGSEKPSSVSQDRKVPVPIGTE
FT                   RSARIRQTGTSAPSVIGSNLSTSVGHSGIWSFEGIGGNQDKVDWCNPGMGNPMIHRPMS
FT                   DPGVFSQHQAMERDSTGIVTPSGTFHQHVPAGYMDFPKVGSMPFSVYGNAMLPPVAPIA
FT                   DGAGGPIFNGPHSAEPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG"
FT   CDS             complement(join(2204634..2204693,2206159..2206323,
FT                   2207592..2207770,2209252..2209500,2214290..2214502,
FT                   2218215..2219845,2226688..2226837,2229166..2229321,
FT                   2229794..2230241,2230938..2231109,2236165..2236281,
FT                   2236964..2237059,2240138..2240300,2240870..2241045,
FT                   2241507..2241720,2242311..2242453,2245779..2245924,
FT                   2246085..2246196,2255691..2255839,2260299..2261051,
FT                   2262489..2262591,2262936..2263079,2263284..2263411,
FT                   2264697..2264784,2266032..2266141,2266686..2266877,
FT                   2268396..2268633,2270650..2270744,2273033..2273266,
FT                   2275436..2275583,2275990..2276137,2277439..2277595,
FT                   2281363..2281516,2342991..>2343518))
FT                   /codon_start=1
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, isoform CRA_c"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT189816.0
FT                   protein_id=mCP110802.0 isoform=CRA_c partial"
FT                   /protein_id="EDL05326.1"
FT                   /translation="SRGDRGGGGGGGPERCVGPGATEVAVERSPPTXXXXXXXRVPHPL
FT                   FPRGWRRRRFRRRLREKGVPRRRRQWRPPPAAAAAEVGGGARPASSPRGMVRVCDLLLK
FT                   KKPPQQQQQQQPPHHKAKRNRTCRPPSSSESSSDSDNSGGGGGGGGGGGGGTSSNNSEE
FT                   EEDDDDEEEEVSEVESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLEA
FT                   LLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDNR
FT                   SLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVED
FT                   RGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLL
FT                   ESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGH
FT                   LEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLT
FT                   LAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTE
FT                   ETQETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANV
FT                   HATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFL
FT                   ISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGADPTHRLKDGSTMLIEAAKGG
FT                   HTSVVCYLLDYPNNLLAAPPPDVTQLTPPSHDLNRAPRVPVQALPMVVPPQEPDKPPAN
FT                   LAATLPVRSKAASKQKSNSHLPANSQDVQGYITNQSPESIVEEAQGKLTELEQRIKEAI
FT                   EKNAQLQSLELAHADQLTKEKIEELNKTREEQIQKKQKILEELQKVERELQLKTQQQLK
FT                   KQYLEVKAQRIQLQQQQQQSCQHLGLFTSVGVGEQLSEGDYARLQQVDPVLLKDEPQQT
FT                   AAQMGFAPIQPLAMPQALPLATGPLPPGSIANLTELQGVIVGQPVLGQAQLAGLGQGIL
FT                   TETQQGLMVASPAQTLNDTLDDIMAAVSGRASAMSNTPTHSIAASVSQPQTPTPSPIIS
FT                   PSAMLPIYPAIDIDAQTESNHDTALTLACAGGHEELVQTLLERGASIEHRDKKGFTPLI
FT                   LAATAGHVGVVEILLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLLARGANKEHRN
FT                   VSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLD
FT                   MGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYA
FT                   EVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELLIGKGAHIDVRNKKGNTPL
FT                   WLAANGGHLDVVQLLVQATADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDS
FT                   ECMRYIATITDKEMLKKCHLCMESIVQAKDRQAAEANKNASILLEELDLEKLREESRRL
FT                   ALAAKREKRKEKRRKKKEEQRRKLEEIEAKNKENFELQAAQEKEKLKVEEEPEVLTEPP
FT                   SATTTTTIGISATWTTLAGSHGKRNNTITTTSSKRKNRKNKITPENVQIIFDDPLPISY
FT                   SQPEKVNGESKSSSTSESGDSDNMRISSCSDESSNSNSSRKSNNHASAVVTTTMASKKQ
FT                   PSVLVTFPKEERKSVSGKASIKLSETVNEGTSNSLSTCTKSGPSPLSSPNGKLTVASPK
FT                   RGPKREEGWKEVVRRSKKVSVPSTVISRVIGRGGCNINAIRECTGAHIDIDKQKDKTGD
FT                   RIITIRGGTESTRQATQLINALIKDPDKEIDELIPKNRLKSSTANSKIGSSAPTTTAAN
FT                   SSLMGIKMTTVALSSTSQTATALTVPAISSASTHKTIKNPVNNVRPGFPVSLPLAYPPP
FT                   QFAHALLAAQTFQQIRPPRLPMTHFGGTFPPAQSTWGPFPVRPLSPARATNSPKPHMVP
FT                   RHSNQNSSGSQVNSAGSLTSSPTTTASSSASAVPGTTSNGSPSSPSVRRQLFVTVVKTS
FT                   NATTTTVTTTASNNSTAPTNATYPMPTAKEHYPVSSPSSPSPPAQPGGVSRNSPLDCGS
FT                   ASPNKGASASEQEASSPPVVEPANSRPPHSSSSSGSSSGHSTQQQPPGSVPQEPRPPLQ
FT                   QSQVPSPDVRMTVPPTATSSAPVAVPSTAPVTYPMPQTQMGCSQPPKMEAPAIRPPSHA
FT                   TAAPHKTPAPVQSSSASVLNVNHIKRPHSVPSSVQLPSTLSTQSACQNSVHPANKPVAP
FT                   NFSAPLPFGPFSTLFENNPTNAHAFWGGPVVSSQSTPESMLSGKSSYLPNSDPLHQSDT
FT                   SKAPGFRPPLQRPAPSPSGIVNMDTPYGSVTPSSTHLGNFASSLSGGQMYGPGAPLGGA
FT                   PLGGAPTAANFNRQHFSPLSLLTPCSSASNESPAQSVSSGVRAPSPAPSSVPLGSEKPS
FT                   SVSQDRKVPVPIGTERSARIRQTGTSAPSVIGSNLSTSVGHSGIWSFEGIGGNQDKVDW
FT                   CNPGMGNPMIHRPMSDPGVFSQHQAMERDSTGIVTPSGTFHQHVPAGYMDFPKVGSMPF
FT                   SVYGNAMLPPVAPIADGAGGPIFNGPHSAEPSWNSLIKMVSSSTENNGPQTVWTGPWAP
FT                   HMNSVHMNQLG"
FT   CDS             complement(join(2204634..2204693,2206159..2206323,
FT                   2207592..2207770,2209252..2209500,2214290..2214502,
FT                   2218215..2219845,2226688..2226837,2229166..2229321,
FT                   2229794..2230241,2230938..2231109,2236165..2236281,
FT                   2236964..2237059,2240138..2240300,2240870..2241045,
FT                   2241507..2241720,2242311..2242453,2245779..2245924,
FT                   2246085..2246196,2255691..2255836,2260299..2261051,
FT                   2262489..2262591,2262936..2263079,2263284..2263411,
FT                   2264697..2264784,2266032..2266141,2266686..2266877,
FT                   2268396..2268633,2270650..2270744,2273033..2273266,
FT                   2275436..2275583,2275990..2276137,2277439..2277595,
FT                   2281363..2281516,2316991..2317044))
FT                   /codon_start=1
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, isoform CRA_b"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT182052.0
FT                   protein_id=mCP104974.0 isoform=CRA_b"
FT                   /protein_id="EDL05325.1"
FT                   /translation="MVETAAEMEAYVLEDILEVESFILDQDDLENPMLETASKLLLSGT
FT                   ADGADLRTVDPETQARLEALLEAAGIGKLSTADGKAFADPEVLRRLTSSVSCALDEAAA
FT                   ALTRMRAESTANAGQSDNRSLAEACSEGDVNAVRKLLIEGRSVNEHTEEGESLLCLACS
FT                   AGYYELAQVLLAMHANVEDRGIKGDITPLMAAANGGHVKIVKLLLAHKADVNAQSSTGN
FT                   TALTYACAGGYVDVVKVLLESGASIEDHNENGHTPLMEAGSAGHVEVARLLLENGAGIN
FT                   THSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLL
FT                   LDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGASLEEVNDEGYTPLMEAAREGH
FT                   EEMVALLLGQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADIELGCSTPLMEA
FT                   AQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADVLLQAGADLEHESEGG
FT                   RTPLMKAARAGHVCTVQFLISKGANVNRTTANNDHTVLSLACAGGHLAVVELLLAHGAD
FT                   PTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNLLAAPPPDVTQLTPPSHDLNRAPRVP
FT                   VQALPMVVPPQEPDKPPANLAATLPVRSKAASKQKSNSHLPANSQDVQGYITNQSPESI
FT                   VEEAQGKLTELEQRIKEAIEKNAQLQSLELAHADQLTKEKIEELNKTREEQIQKKQKIL
FT                   EELQKVERELQLKTQQQLKKQYLEVKAQRIQLQQQQQQSCQHLGLFTSVGVGEQLSEGD
FT                   YARLQQVDPVLLKDEPQQTAAQMGFAPIQPLAMPQALPLATGPLPPGSIANLTELQGVI
FT                   VGQPVLGQAQLAGLGQGILTETQQGLMVASPAQTLNDTLDDIMAVSGRASAMSNTPTHS
FT                   IAASVSQPQTPTPSPIISPSAMLPIYPAIDIDAQTESNHDTALTLACAGGHEELVQTLL
FT                   ERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEAQSERTKDTPLSLACSGGR
FT                   QEVVELLLARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISP
FT                   LMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRTEVVSLLLDRKANVEH
FT                   RAKTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHYKFCELL
FT                   IGKGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQATADVDAADNRKITPLMAAFRKGH
FT                   VKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLCMESIVQAKDRQAAEANKNAS
FT                   ILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRRKLEEIEAKNKENFELQAAQ
FT                   EKEKLKVEEEPEVLTEPPSATTTTTIGISATWTTLAGSHGKRNNTITTTSSKRKNRKNK
FT                   ITPENVQIIFDDPLPISYSQPEKVNGESKSSSTSESGDSDNMRISSCSDESSNSNSSRK
FT                   SNNHASAVVTTTMASKKQPSVLVTFPKEERKSVSGKASIKLSETVNEGTSNSLSTCTKS
FT                   GPSPLSSPNGKLTVASPKRGPKREEGWKEVVRRSKKVSVPSTVISRVIGRGGCNINAIR
FT                   ECTGAHIDIDKQKDKTGDRIITIRGGTESTRQATQLINALIKDPDKEIDELIPKNRLKS
FT                   STANSKIGSSAPTTTAANSSLMGIKMTTVALSSTSQTATALTVPAISSASTHKTIKNPV
FT                   NNVRPGFPVSLPLAYPPPQFAHALLAAQTFQQIRPPRLPMTHFGGTFPPAQSTWGPFPV
FT                   RPLSPARATNSPKPHMVPRHSNQNSSGSQVNSAGSLTSSPTTTASSSASAVPGTTSNGS
FT                   PSSPSVRRQLFVTVVKTSNATTTTVTTTASNNSTAPTNATYPMPTAKEHYPVSSPSSPS
FT                   PPAQPGGVSRNSPLDCGSASPNKGASASEQEASSPPVVEPANSRPPHSSSSSGSSSGHS
FT                   TQQQPPGSVPQEPRPPLQQSQVPSPDVRMTVPPTATSSAPVAVPSTAPVTYPMPQTQMG
FT                   CSQPPKMEAPAIRPPSHATAAPHKTPAPVQSSSASVLNVNHIKRPHSVPSSVQLPSTLS
FT                   TQSACQNSVHPANKPVAPNFSAPLPFGPFSTLFENNPTNAHAFWGGPVVSSQSTPESML
FT                   SGKSSYLPNSDPLHQSDTSKAPGFRPPLQRPAPSPSGIVNMDTPYGSVTPSSTHLGNFA
FT                   SSLSGGQMYGPGAPLGGAPLGGAPTAANFNRQHFSPLSLLTPCSSASNESPAQSVSSGV
FT                   RAPSPAPSSVPLGSEKPSSVSQDRKVPVPIGTERSARIRQTGTSAPSVIGSNLSTSVGH
FT                   SGIWSFEGIGGNQDKVDWCNPGMGNPMIHRPMSDPGVFSQHQAMERDSTGIVTPSGTFH
FT                   QHVPAGYMDFPKVGSMPFSVYGNAMLPPVAPIADGAGGPIFNGPHSAEPSWNSLIKMVS
FT                   SSTENNGPQTVWTGPWAPHMNSVHMNQLG"
FT   assembly_gap    2226510..2226529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2234946..2234965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2236026..2236045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2243596..2243615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2310560..2310791
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   CDS             complement(2342992..2343372)
FT                   /codon_start=1
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, isoform CRA_a"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT13250.3
FT                   protein_id=mCP10933.3 isoform=CRA_a partial"
FT                   /protein_id="EDL05324.1"
FT                   /translation="MEKATVPAAAEGEGSPPAAAAVAAPPRGGGGGGRRRGSPGLFSSW
FT                   DGASLRPAPEEEATAATAAAAAAAPQGQAEPDLPTPEQQRKQQRQRQQRRRWRWRRRRR
FT                   RRHQQQQQRGRGGRRRRGRGGF"
FT   CDS             complement(2342992..2343372)
FT                   /codon_start=1
FT                   /gene="Ankrd17"
FT                   /locus_tag="mCG_12455"
FT                   /product="ankyrin repeat domain 17, isoform CRA_a"
FT                   /note="gene_id=mCG12455.4 transcript_id=mCT182051.0
FT                   protein_id=mCP104973.0 isoform=CRA_a partial"
FT                   /protein_id="EDL05328.1"
FT                   /translation="MEKATVPAAAEGEGSPPAAAAVAAPPRGGGGGGRRRGSPGLFSSW
FT                   DGASLRPAPEEEATAATAAAAAAAPQGQAEPDLPTPEQQRKQQRQRQQRRRWRWRRRRR
FT                   RRHQQQQQRGRGGRRRRGRGGF"
FT   assembly_gap    2343403..2343422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2344532..2345820
FT                   /locus_tag="mCG_147145"
FT                   /note="gene_id=mCG147145.0"
FT   mRNA            2344532..2345820
FT                   /locus_tag="mCG_147145"
FT                   /product="mCG147145"
FT                   /note="gene_id=mCG147145.0 transcript_id=mCT187408.0
FT                   created on 13-JAN-2004"
FT   CDS             2345177..2345497
FT                   /codon_start=1
FT                   /locus_tag="mCG_147145"
FT                   /product="mCG147145"
FT                   /note="gene_id=mCG147145.0 transcript_id=mCT187408.0
FT                   protein_id=mCP109669.0"
FT                   /db_xref="GOA:Q8C9U4"
FT                   /db_xref="MGI:MGI:3641866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9U4"
FT                   /protein_id="EDL05323.1"
FT                   /translation="MDLDCMVSAGSCPFSVFFSTFVSLSTSIPFAIFECQPRFIIRLTN
FT                   SFTRRLRPLTANSFNFPNARDGLIFSQYGENDRTPCPHARSVNSPTIFWFQCLSLACFL
FT                   FF"
FT   assembly_gap    2355633..2355652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2364308..2364851
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    2366547..2366566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2388867..2388946
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    2414777..2415870
FT                   /estimated_length=1094
FT                   /gap_type="unknown"
FT   assembly_gap    2422420..2422439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2424257..2424276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2436980..2436999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2439237..2455072
FT                   /gene="Alb1"
FT                   /locus_tag="mCG_1705"
FT                   /note="gene_id=mCG1705.1"
FT   mRNA            join(2439237..2439355,2440063..2440120,2441042..2441174,
FT                   2442326..2442537,2443195..2443327,2444216..2444313,
FT                   2445686..2445815,2446823..2447037,2447844..2447976,
FT                   2449083..2449180,2450347..2450485,2450803..2451026,
FT                   2452890..2453022,2453592..2453659,2454783..2455072)
FT                   /gene="Alb1"
FT                   /locus_tag="mCG_1705"
FT                   /product="albumin 1"
FT                   /note="gene_id=mCG1705.1 transcript_id=mCT7936.1 created on
FT                   23-APR-2002"
FT   CDS             join(2439277..2439355,2440063..2440120,2441042..2441174,
FT                   2442326..2442537,2443195..2443327,2444216..2444313,
FT                   2445686..2445815,2446823..2447037,2447844..2447976,
FT                   2449083..2449180,2450347..2450485,2450803..2451026,
FT                   2452890..2453022,2453592..2453633)
FT                   /codon_start=1
FT                   /gene="Alb1"
FT                   /locus_tag="mCG_1705"
FT                   /product="albumin 1"
FT                   /note="gene_id=mCG1705.1 transcript_id=mCT7936.1
FT                   protein_id=mCP10923.2"
FT                   /db_xref="GOA:Q546G4"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87991"
FT                   /db_xref="UniProtKB/TrEMBL:Q546G4"
FT                   /protein_id="EDL05322.1"
FT                   /translation="MKWVTFLLLLFVSGSAFSRGVFRREAHKSEIAHRYNDLGEQHFKG
FT                   LVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESAANCDKSLHTLFGDKLCAIPNL
FT                   RENYGELADCCTKQEPERNECFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYL
FT                   HEVARRHPYFYAPELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRM
FT                   KCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDLLECADDR
FT                   AELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHDTMPADLPAIAADFVEDQEVC
FT                   KNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEATLEKCCAEANPPACYGTVLA
FT                   EFQPLVEEPKNLVKTNCDLYEKLGEYGFQNAILVRYTQKAPQVSTPTLVEAARNLGRVG
FT                   TKCCTLPEDQRLPCVEDYLSAILNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTV
FT                   DETYVPKEFKAETFTFHSDICTLPEKEKQIKKQTALAELVKHKPKATAEQLKTVMDDFA
FT                   QFLDTCCKAADKDTCFSTEGPNLVTRCKDALA"
FT   gene            2469119..2487287
FT                   /gene="Afp"
FT                   /locus_tag="mCG_1716"
FT                   /note="gene_id=mCG1716.3"
FT   mRNA            join(2469119..2469246,2470079..2470130,2471031..2471151,
FT                   2474329..2474555,2475577..2475709,2476645..2476742,
FT                   2477980..2478109,2479787..2480001,2481954..2482086,
FT                   2482711..2482808,2483330..2483468,2484901..2485124,
FT                   2486178..2486310,2486810..2486864,2487097..2487287)
FT                   /gene="Afp"
FT                   /locus_tag="mCG_1716"
FT                   /product="alpha fetoprotein, transcript variant mCT186519"
FT                   /note="gene_id=mCG1716.3 transcript_id=mCT186519.0 created
FT                   on 26-JUN-2003"
FT   mRNA            join(2469121..2469246,2470079..2470130,2471031..2471151,
FT                   2474344..2474555,2475577..2475709,2476645..2476742,
FT                   2477980..2478109,2479787..2480001,2481954..2482086,
FT                   2482711..2482808,2483330..2483468,2484901..2485124,
FT                   2486178..2486310,2486810..2486864,2487097..2487234)
FT                   /gene="Afp"
FT                   /locus_tag="mCG_1716"
FT                   /product="alpha fetoprotein, transcript variant mCT7947"
FT                   /note="gene_id=mCG1716.3 transcript_id=mCT7947.1 created on
FT                   26-JUN-2003"
FT   CDS             join(2469162..2469246,2470079..2470130,2471031..2471151,
FT                   2474329..2474555,2475577..2475709,2476645..2476742,
FT                   2477980..2478109,2479787..2480001,2481954..2482086,
FT                   2482711..2482808,2483330..2483468,2484901..2485124,
FT                   2486178..2486310,2486810..2486854)
FT                   /codon_start=1
FT                   /gene="Afp"
FT                   /locus_tag="mCG_1716"
FT                   /product="alpha fetoprotein, isoform CRA_a"
FT                   /note="gene_id=mCG1716.3 transcript_id=mCT186519.0
FT                   protein_id=mCP107223.0 isoform=CRA_a"
FT                   /protein_id="EDL05320.1"
FT                   /translation="MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLS
FT                   IATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESQIFFSQLSVFLDEICHETE
FT                   LSNKYGLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRF
FT                   IYEVSRRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNE
FT                   HVCSVIRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQD
FT                   GEKVMTYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNF
FT                   AQFSSEEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNLE
FT                   EELQKHIEESQALSKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSI
FT                   ASTCCQLSEEKWSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFL
FT                   RDETYAPPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADF
FT                   SGLLEKCCKAQDQEVCFTEEGPKLISKTRDALGV"
FT   CDS             join(2469162..2469246,2470079..2470130,2471031..2471151,
FT                   2474344..2474555,2475577..2475709,2476645..2476742,
FT                   2477980..2478109,2479787..2480001,2481954..2482086,
FT                   2482711..2482808,2483330..2483468,2484901..2485124,
FT                   2486178..2486310,2486810..2486854)
FT                   /codon_start=1
FT                   /gene="Afp"
FT                   /locus_tag="mCG_1716"
FT                   /product="alpha fetoprotein, isoform CRA_b"
FT                   /note="gene_id=mCG1716.3 transcript_id=mCT7947.1
FT                   protein_id=mCP10905.1 isoform=CRA_b"
FT                   /protein_id="EDL05321.1"
FT                   /translation="MKWITPASLILLLHFAASKALHENEFGIASTLDSSQCVTEKNVLS
FT                   IATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESQLSVFLDEICHETELSNKY
FT                   GLSGCCSQSGVERHQCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRFIYEVS
FT                   RRNPFMYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNEHVCSV
FT                   IRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQGNSLECLQDGEKVM
FT                   TYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVKPEGLSLNPSQFLGDRNFAQFSS
FT                   EEKIMFMASFLHEYSRTHPNLPVSVILRIAKTYQEILEKCSQSGNLPGCQDNLEEELQK
FT                   HIEESQALSKQSCALYQTLGDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCC
FT                   QLSEEKWSGCGEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFLRDETY
FT                   APPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVTADFSGLLE
FT                   KCCKAQDQEVCFTEEGPKLISKTRDALGV"
FT   assembly_gap    2495271..2495720
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   gene            2497387..2522063
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /note="gene_id=mCG140143.0"
FT   mRNA            join(2497387..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502407,2503255..2503387,2503971..2504068,
FT                   2504809..2504938,2509957..2510171,2513907..2514039,
FT                   2516343..2516440,2517258..2517390,2518679..2518902,
FT                   2519864..2519996,2521064..2521121,2521922..2522063)
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, transcript variant mCT168209"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT168209.0
FT                   created on 26-JUN-2003"
FT   mRNA            join(2497390..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502311,2503364..2503387,2503971..2504068,
FT                   2504809..2504938,2509957..2510171,2513907..2514039,
FT                   2516343..2516440,2517258..2517390,2518679..2518902,
FT                   2519864..2519996,2521064..2521121,2521922..2522063)
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, transcript variant mCT186503"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT186503.0
FT                   created on 26-JUN-2003"
FT   mRNA            join(2497390..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502407,2503255..2503387,2503971..2504068,
FT                   2504809..2504938,2509957..2510171,2513928..2514039,
FT                   2516343..2516440,2517258..2517390,2518679..2518902,
FT                   2519864..2519996,2521064..2521146)
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, transcript variant mCT186504"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT186504.0
FT                   created on 26-JUN-2003"
FT   mRNA            join(2497391..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502315,2502364..2502407,2503255..2503387,
FT                   2503971..2504068,2504809..2504938,2509957..2510171,
FT                   2513907..2514039,2516343..2516440,2517258..2517390,
FT                   2518679..2518902,2519864..2519996,2521064..2521121,
FT                   2521922..2522063)
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, transcript variant mCT186505"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT186505.0
FT                   created on 26-JUN-2003"
FT   mRNA            join(2497401..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502407,2503255..2503387,2503971..2504068,
FT                   2504809..2504938,2509957..2510171,2513907..2514039,
FT                   2516343..2517571)
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, transcript variant mCT186502"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT186502.0
FT                   created on 26-JUN-2003"
FT   CDS             join(2497437..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502407,2503255..2503387,2503971..2504068,
FT                   2504809..2504938,2509957..2510171,2513907..2514039,
FT                   2516343..2516440,2517258..2517390,2518679..2518902,
FT                   2519864..2519996,2521064..2521111)
FT                   /codon_start=1
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, isoform CRA_e"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT168209.0
FT                   protein_id=mCP91132.0 isoform=CRA_e"
FT                   /protein_id="EDL05319.1"
FT                   /translation="MRHLKLTGFIFFLLPLTESLALPTKPQDVDHFNATQKFIDENTTY
FT                   LAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTLPECSKTANDAIQDMLCDMEGL
FT                   PQKHNFSHCCGKAGFPRRLCFFYNKKANVGFLPPFPTLDPEEKCQAYKNNSESFLHLYM
FT                   YEVARRNPFVFAPVLLAVAAWFEEAATTCCEQQQKATCFQAKAAPITQYLKASSSYQRN
FT                   VCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDVVHCIRSQ
FT                   SQVVNHICSKQDSISSKIKVCCEKKTLEREACIINANKDDRPEGLSLREAKFTESENVC
FT                   QERDSDPDKFFAEFIYEYSRRHPDLSTPELLRITKVYMDFLEDCCSRENPAGCYRHVED
FT                   KFNETTQRSLAMVQQECKQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAAL
FT                   TTCCTLSDEFACVDNLADLVLGELCGVNTNRTINPAVDHCCKTDFAFRRHCFEHLKADT
FT                   TYELPSVSALVSALHTDWCQPRKEDLQNKKHRFLVNLVKWMPGITDEEWLCLFTKFTAA
FT                   REECSEVQEPESCFSPESSKTGDESQATEKQR"
FT   CDS             join(2497437..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502407,2503255..2503387,2503971..2504068,
FT                   2504809..2504938,2509957..2510171,2513928..2514039,
FT                   2516343..2516440,2517258..2517390,2518679..2518902,
FT                   2519864..2519996,2521064..2521111)
FT                   /codon_start=1
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, isoform CRA_c"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT186504.0
FT                   protein_id=mCP107209.0 isoform=CRA_c"
FT                   /protein_id="EDL05317.1"
FT                   /translation="MRHLKLTGFIFFLLPLTESLALPTKPQDVDHFNATQKFIDENTTY
FT                   LAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTLPECSKTANDAIQDMLCDMEGL
FT                   PQKHNFSHCCGKAGFPRRLCFFYNKKANVGFLPPFPTLDPEEKCQAYKNNSESFLHLYM
FT                   YEVARRNPFVFAPVLLAVAAWFEEAATTCCEQQQKATCFQAKAAPITQYLKASSSYQRN
FT                   VCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDVVHCIRSQ
FT                   SQVVNHICSKQDSISSKIKVCCEKKTLEREACIINANKDDRPEGLSLREAKFTESENVC
FT                   QERDSDPDKFFAERHPDLSTPELLRITKVYMDFLEDCCSRENPAGCYRHVEDKFNETTQ
FT                   RSLAMVQQECKQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCCTLS
FT                   DEFACVDNLADLVLGELCGVNTNRTINPAVDHCCKTDFAFRRHCFEHLKADTTYELPSV
FT                   SALVSALHTDWCQPRKEDLQNKKHRFLVNLVKWMPGITDEEWLCLFTKFTAAREECSEV
FT                   QEPESCFSPESSKTGDESQATEKQR"
FT   CDS             join(2497437..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502315,2502364..2502407,2503255..2503387,
FT                   2503971..2504068,2504809..2504938,2509957..2510171,
FT                   2513907..2514039,2516343..2516440,2517258..2517390,
FT                   2518679..2518902,2519864..2519996,2521064..2521111)
FT                   /codon_start=1
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, isoform CRA_d"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT186505.0
FT                   protein_id=mCP107206.0 isoform=CRA_d"
FT                   /protein_id="EDL05318.1"
FT                   /translation="MRHLKLTGFIFFLLPLTESLALPTKPQDVDHFNATQKFIDENTTY
FT                   LAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTLPECSKTANDAIQDMLCDMEGL
FT                   PQKHNFSHCCGKAGFPRRLCFFYNKKKCQAYKNNSESFLHLYMYEVARRNPFVFAPVLL
FT                   AVAAWFEEAATTCCEQQQKATCFQAKAAPITQYLKASSSYQRNVCGALIKFGPKVLNSI
FT                   NVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDVVHCIRSQSQVVNHICSKQDSISS
FT                   KIKVCCEKKTLEREACIINANKDDRPEGLSLREAKFTESENVCQERDSDPDKFFAEFIY
FT                   EYSRRHPDLSTPELLRITKVYMDFLEDCCSRENPAGCYRHVEDKFNETTQRSLAMVQQE
FT                   CKQFQELGKDTLQRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCCTLSDEFACVDNL
FT                   ADLVLGELCGVNTNRTINPAVDHCCKTDFAFRRHCFEHLKADTTYELPSVSALVSALHT
FT                   DWCQPRKEDLQNKKHRFLVNLVKWMPGITDEEWLCLFTKFTAAREECSEVQEPESCFSP
FT                   ESSKTGDESQATEKQR"
FT   CDS             join(2497437..2497524,2500369..2500417,2500624..2500756,
FT                   2502196..2502407,2503255..2503387,2503971..2504068,
FT                   2504809..2504938,2509957..2510171,2513907..2514039,
FT                   2516343..2516444)
FT                   /codon_start=1
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, isoform CRA_a"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT186502.0
FT                   protein_id=mCP107208.0 isoform=CRA_a"
FT                   /protein_id="EDL05315.1"
FT                   /translation="MRHLKLTGFIFFLLPLTESLALPTKPQDVDHFNATQKFIDENTTY
FT                   LAIIAFSQYVQEASFDEVETLVKVMLDYRDRCWADNTLPECSKTANDAIQDMLCDMEGL
FT                   PQKHNFSHCCGKAGFPRRLCFFYNKKANVGFLPPFPTLDPEEKCQAYKNNSESFLHLYM
FT                   YEVARRNPFVFAPVLLAVAAWFEEAATTCCEQQQKATCFQAKAAPITQYLKASSSYQRN
FT                   VCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDVVHCIRSQ
FT                   SQVVNHICSKQDSISSKIKVCCEKKTLEREACIINANKDDRPEGLSLREAKFTESENVC
FT                   QERDSDPDKFFAEFIYEYSRRHPDLSTPELLRITKVYMDFLEDCCSRENPAGCYRHVED
FT                   KFNETTQRSLAMVQQECKQFQELGKDTLQRQ"
FT   assembly_gap    2499192..2499583
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   CDS             join(2504888..2504938,2509957..2510171,2513907..2514039,
FT                   2516343..2516440,2517258..2517390,2518679..2518902,
FT                   2519864..2519996,2521064..2521111)
FT                   /codon_start=1
FT                   /gene="Afm"
FT                   /locus_tag="mCG_140143"
FT                   /product="afamin, isoform CRA_b"
FT                   /note="gene_id=mCG140143.0 transcript_id=mCT186503.0
FT                   protein_id=mCP107207.0 isoform=CRA_b"
FT                   /protein_id="EDL05316.1"
FT                   /translation="MYEGCCEGDVVHCIRSQSQVVNHICSKQDSISSKIKVCCEKKTLE
FT                   REACIINANKDDRPEGLSLREAKFTESENVCQERDSDPDKFFAEFIYEYSRRHPDLSTP
FT                   ELLRITKVYMDFLEDCCSRENPAGCYRHVEDKFNETTQRSLAMVQQECKQFQELGKDTL
FT                   QRHFLVKFTKAAPQLPMEELVSLSKEMVAALTTCCTLSDEFACVDNLADLVLGELCGVN
FT                   TNRTINPAVDHCCKTDFAFRRHCFEHLKADTTYELPSVSALVSALHTDWCQPRKEDLQN
FT                   KKHRFLVNLVKWMPGITDEEWLCLFTKFTAAREECSEVQEPESCFSPESSKTGDESQAT
FT                   EKQR"
FT   gene            2529624..2566673
FT                   /locus_tag="mCG_147146"
FT                   /note="gene_id=mCG147146.0"
FT   mRNA            join(2529624..2529836,2532493..2532544,2532705..2532843,
FT                   2534923..2535065,2566413..2566673)
FT                   /locus_tag="mCG_147146"
FT                   /product="mCG147146"
FT                   /note="gene_id=mCG147146.0 transcript_id=mCT187409.0
FT                   created on 13-JAN-2004"
FT   CDS             join(2529752..2529836,2532493..2532544,2532705..2532843,
FT                   2534923..2535065,2566413..2566521)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147146"
FT                   /product="mCG147146"
FT                   /note="gene_id=mCG147146.0 transcript_id=mCT187409.0
FT                   protein_id=mCP109667.0"
FT                   /protein_id="EDL05313.1"
FT                   /translation="MEVLKALPFIVFFSYSKCESLQTSLLHAARQHVSGQDHLEENLGV
FT                   SVSIMVAQFLQDAAYDQVQTIAKELLKLAEKCKRLKPESPSECAHQLVAAFLIHICNNQ
FT                   GLVDSHVFTDCCKMKTAARLRCFLSYKKDDADSHDTPPSLSPQQMPYGLPDQPRSELSH
FT                   LTACLSRAETRT"
FT   assembly_gap    2530883..2531073
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            <2540170..2561780
FT                   /locus_tag="mCG_140142"
FT                   /note="gene_id=mCG140142.0"
FT   mRNA            join(<2540170..2540279,2541205..2541334,2546302..2546516,
FT                   2548155..2548287,2552799..2552937,2553332..2553558,
FT                   2561648..2561780)
FT                   /locus_tag="mCG_140142"
FT                   /product="mCG140142"
FT                   /note="gene_id=mCG140142.0 transcript_id=mCT168208.0
FT                   created on 23-APR-2002"
FT   CDS             join(<2540170..2540279,2541205..2541334,2546302..2546516,
FT                   2548155..2548287,2552799..2552819)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140142"
FT                   /product="mCG140142"
FT                   /note="gene_id=mCG140142.0 transcript_id=mCT168208.0
FT                   protein_id=mCP91149.0"
FT                   /protein_id="EDL05314.1"
FT                   /translation="FHLQLEPIRKYIRGISARHHHLCEIGTKFNEKVASAVELILLTKK
FT                   QPKANFSEIAKLTMDVKNLHETCCEGNTLVCALGRRQLMNYTCSNQAILSSKFAECCEQ
FT                   PEPFRGECIVNSENDDKPDLSPLPLTRFTEDWSVCQQFSGNQDSFLQEFLYEYSRRHLE
FT                   LAVPVILRVFETYKRVLEKCCKLENSLECHQPGAHGALY"
FT   assembly_gap    2548088..2548107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2555259..2555323
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    2559078..2559568
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   gene            complement(2571861..2609428)
FT                   /gene="Rassf6"
FT                   /locus_tag="mCG_1703"
FT                   /note="gene_id=mCG1703.3"
FT   mRNA            complement(join(2571861..2572714,2572809..2572906,
FT                   2573012..2573130,2575181..2575232,2575542..2575643,
FT                   2577565..2577750,2578492..2578589,2584566..2584708,
FT                   2586478..2586556,2600284..2600382,2609353..2609428))
FT                   /gene="Rassf6"
FT                   /locus_tag="mCG_1703"
FT                   /product="Ras association (RalGDS/AF-6) domain family 6,
FT                   transcript variant mCT168217"
FT                   /note="gene_id=mCG1703.3 transcript_id=mCT168217.1 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(2571861..2572714,2572809..2572906,
FT                   2573012..2573130,2575181..2575232,2575542..2575643,
FT                   2577565..2577707,2577719..2577769,2578492..2578589,
FT                   2584566..2584708,2586478..2586556,2600284..2600382,
FT                   2609158..2609245))
FT                   /gene="Rassf6"
FT                   /locus_tag="mCG_1703"
FT                   /product="Ras association (RalGDS/AF-6) domain family 6,
FT                   transcript variant mCT7934"
FT                   /note="gene_id=mCG1703.3 transcript_id=mCT7934.3 created on
FT                   06-FEB-2003"
FT   mRNA            complement(join(2571861..2572714,2572809..2572906,
FT                   2573012..2573130,2575181..2575232,2575542..2575643,
FT                   2577565..2577707,2578480..2578589,2584566..2584708,
FT                   2586478..2586556,2600284..2600382,2609158..2609245))
FT                   /gene="Rassf6"
FT                   /locus_tag="mCG_1703"
FT                   /product="Ras association (RalGDS/AF-6) domain family 6,
FT                   transcript variant mCT179792"
FT                   /note="gene_id=mCG1703.3 transcript_id=mCT179792.0 created
FT                   on 06-FEB-2003"
FT   CDS             complement(join(2572639..2572714,2572809..2572906,
FT                   2573012..2573130,2575181..2575232,2575542..2575643,
FT                   2577565..2577707,2577719..2577769,2578492..2578589,
FT                   2584566..2584708,2586478..2586556,2600284..2600348))
FT                   /codon_start=1
FT                   /gene="Rassf6"
FT                   /locus_tag="mCG_1703"
FT                   /product="Ras association (RalGDS/AF-6) domain family 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1703.3 transcript_id=mCT7934.3
FT                   protein_id=mCP10901.3 isoform=CRA_b"
FT                   /db_xref="GOA:G3X8Z9"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR011524"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR033614"
FT                   /db_xref="InterPro:IPR033625"
FT                   /db_xref="MGI:MGI:1920496"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Z9"
FT                   /protein_id="EDL05311.1"
FT                   /translation="MTAMDHQFPSWIVVNESTSISREQLNYLLETYNVFYENQKNLHIL
FT                   YGQTEDGQLIVEGMLDIFWGVKRPIQLKIQDEKQISSFDLLNTPETFSSKGRMTRWGEF
FT                   DDLYRISELDRTHVLASEARHSPEDYLSYHSTLTPYADEEPESPLLYRTMSEAALVRKR
FT                   MRAPEMYRKDRMGVLSNHRASINGHVYDHETSIFTPTFGSETKVRANSIMRTEEVIKQL
FT                   LQKFKIENSPRDFALYIIFGTGEQRKLKKTDVPLLQRLLQGPSKSNARIFLMDKDAEEI
FT                   SRDVAPYINFHFSFLESILQRLDEEEKMEIERIMAKFNTERAFILKCLQSKQAAKTETT
FT                   V"
FT   CDS             complement(join(2572639..2572714,2572809..2572906,
FT                   2573012..2573130,2575181..2575232,2575542..2575643,
FT                   2577565..2577684))
FT                   /codon_start=1
FT                   /gene="Rassf6"
FT                   /locus_tag="mCG_1703"
FT                   /product="Ras association (RalGDS/AF-6) domain family 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1703.3 transcript_id=mCT168217.1
FT                   protein_id=mCP91133.0 isoform=CRA_a"
FT                   /protein_id="EDL05310.1"
FT                   /translation="MSEAALVRKRMRAPEMYRKDRMGVLSNHRASINGHVYDHETSIFT
FT                   PTFGSETKVRANSIMRTEEVIKQLLQKFKIENSPRDFALYIIFGTGEQRKLKKTDVPLL
FT                   QRLLQGPSKSNARIFLMDKDAEEISRDVAPYINFHFSFLESILQRLDEEEKMEIERIMA
FT                   KFNTERAFILKCLQSKQAAKTETTV"
FT   CDS             complement(join(2572639..2572714,2572809..2572906,
FT                   2573012..2573130,2575181..2575232,2575542..2575643,
FT                   2577565..2577684))
FT                   /codon_start=1
FT                   /gene="Rassf6"
FT                   /locus_tag="mCG_1703"
FT                   /product="Ras association (RalGDS/AF-6) domain family 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1703.3 transcript_id=mCT179792.0
FT                   protein_id=mCP102714.0 isoform=CRA_a"
FT                   /protein_id="EDL05312.1"
FT                   /translation="MSEAALVRKRMRAPEMYRKDRMGVLSNHRASINGHVYDHETSIFT
FT                   PTFGSETKVRANSIMRTEEVIKQLLQKFKIENSPRDFALYIIFGTGEQRKLKKTDVPLL
FT                   QRLLQGPSKSNARIFLMDKDAEEISRDVAPYINFHFSFLESILQRLDEEEKMEIERIMA
FT                   KFNTERAFILKCLQSKQAAKTETTV"
FT   assembly_gap    2627759..2628151
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    2641582..2641601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2685724..2685743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2693790..2693809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2713929..2713948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2728132..2730338
FT                   /gene="Cxcl5"
FT                   /locus_tag="mCG_1701"
FT                   /note="gene_id=mCG1701.2"
FT   mRNA            join(2728132..2728333,2728462..2728597,2728740..2728823,
FT                   2729220..2730338)
FT                   /gene="Cxcl5"
FT                   /locus_tag="mCG_1701"
FT                   /product="chemokine (C-X-C motif) ligand 5"
FT                   /note="gene_id=mCG1701.2 transcript_id=mCT7932.2 created on
FT                   23-APR-2002"
FT   CDS             join(2728216..2728333,2728462..2728597,2728740..2728823,
FT                   2729220..2729280)
FT                   /codon_start=1
FT                   /gene="Cxcl5"
FT                   /locus_tag="mCG_1701"
FT                   /product="chemokine (C-X-C motif) ligand 5"
FT                   /note="gene_id=mCG1701.2 transcript_id=mCT7932.2
FT                   protein_id=mCP10917.1"
FT                   /db_xref="GOA:Q790R4"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="UniProtKB/TrEMBL:Q790R4"
FT                   /protein_id="EDL05309.1"
FT                   /translation="MSLQLRSSAHIPSGSSSPFMRMAPLAFLLLFTLPQHLAEAAPSSV
FT                   IAATELRCVCLTVTPKINPKLIANLEVIPAGPQCPTVEVIAKLKNQKEVCLDPEAPVIK
FT                   KIIQKILGSDKKKAKRNALAVERTASVQ"
FT   gene            2737231..2738775
FT                   /gene="Cxcl7"
FT                   /locus_tag="mCG_1702"
FT                   /note="gene_id=mCG1702.2"
FT   mRNA            join(2737231..2737489,2737768..2737897,2738032..2738775)
FT                   /gene="Cxcl7"
FT                   /locus_tag="mCG_1702"
FT                   /product="chemokine (C-X-C motif) ligand 7, transcript
FT                   variant mCT168216"
FT                   /note="gene_id=mCG1702.2 transcript_id=mCT168216.0 created
FT                   on 23-APR-2002"
FT   mRNA            join(2737231..2737438,2737768..2737897,2738032..2738775)
FT                   /gene="Cxcl7"
FT                   /locus_tag="mCG_1702"
FT                   /product="chemokine (C-X-C motif) ligand 7, transcript
FT                   variant mCT7933"
FT                   /note="gene_id=mCG1702.2 transcript_id=mCT7933.2 created on
FT                   23-APR-2002"
FT   CDS             join(2737318..2737489,2737768..2737897,2738032..2738122)
FT                   /codon_start=1
FT                   /gene="Cxcl7"
FT                   /locus_tag="mCG_1702"
FT                   /product="chemokine (C-X-C motif) ligand 7, isoform CRA_a"
FT                   /note="gene_id=mCG1702.2 transcript_id=mCT168216.0
FT                   protein_id=mCP91151.0 isoform=CRA_a"
FT                   /protein_id="EDL05307.1"
FT                   /translation="MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKCKRNS
FT                   GKDEYEGCFPSSSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATL
FT                   KNGQKTCLDPNAPGVKRIVMKILEGY"
FT   CDS             join(2737318..2737438,2737768..2737897,2738032..2738122)
FT                   /codon_start=1
FT                   /gene="Cxcl7"
FT                   /locus_tag="mCG_1702"
FT                   /product="chemokine (C-X-C motif) ligand 7, isoform CRA_b"
FT                   /note="gene_id=mCG1702.2 transcript_id=mCT7933.2
FT                   protein_id=mCP10922.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9EQI5"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:1888712"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQI5"
FT                   /protein_id="EDL05308.1"
FT                   /translation="MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMD
FT                   PYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKR
FT                   IVMKILEGY"
FT   gene            2741121..2742091
FT                   /gene="Cxcl4"
FT                   /locus_tag="mCG_1704"
FT                   /note="gene_id=mCG1704.1"
FT   mRNA            join(2741121..2741387,2741621..2742091)
FT                   /gene="Cxcl4"
FT                   /locus_tag="mCG_1704"
FT                   /product="chemokine (C-X-C motif) ligand 4, transcript
FT                   variant mCT168219"
FT                   /note="gene_id=mCG1704.1 transcript_id=mCT168219.0 created
FT                   on 23-APR-2002"
FT   mRNA            join(2741121..2741387,2741621..2741753,2741882..2742091)
FT                   /gene="Cxcl4"
FT                   /locus_tag="mCG_1704"
FT                   /product="chemokine (C-X-C motif) ligand 4, transcript
FT                   variant mCT7935"
FT                   /note="gene_id=mCG1704.1 transcript_id=mCT7935.1 created on
FT                   23-APR-2002"
FT   CDS             join(2741291..2741387,2741621..2741753,2741882..2741969)
FT                   /codon_start=1
FT                   /gene="Cxcl4"
FT                   /locus_tag="mCG_1704"
FT                   /product="chemokine (C-X-C motif) ligand 4, isoform CRA_c"
FT                   /note="gene_id=mCG1704.1 transcript_id=mCT7935.1
FT                   protein_id=mCP10924.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TVN6"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="InterPro:IPR027222"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:1888711"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TVN6"
FT                   /protein_id="EDL05306.1"
FT                   /translation="MSVAAVFRGLRPSPELLLLGLLFLPAVVAVTSAGPEESDGDLSCV
FT                   CVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILE
FT                   S"
FT   CDS             join(2741291..2741387,2741621..2741757)
FT                   /codon_start=1
FT                   /gene="Cxcl4"
FT                   /locus_tag="mCG_1704"
FT                   /product="chemokine (C-X-C motif) ligand 4, isoform CRA_a"
FT                   /note="gene_id=mCG1704.1 transcript_id=mCT168219.0
FT                   protein_id=mCP91139.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0J9YTR7"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR027222"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:1888711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YTR7"
FT                   /protein_id="EDL05304.1"
FT                   /translation="MSVAAVFRGLRPSPELLLLGLLFLPAVVAVTSAGPEESDGDLSCV
FT                   CVKTISSGIHLKHITSLEVIKAGRHCAVPQLM"
FT   mRNA            join(<2741600..2741753,2741882..2742091)
FT                   /gene="Cxcl4"
FT                   /locus_tag="mCG_1704"
FT                   /product="chemokine (C-X-C motif) ligand 4, transcript
FT                   variant mCT168218"
FT                   /note="gene_id=mCG1704.1 transcript_id=mCT168218.0 created
FT                   on 23-APR-2002"
FT   CDS             join(<2741602..2741753,2741882..2741969)
FT                   /codon_start=1
FT                   /gene="Cxcl4"
FT                   /locus_tag="mCG_1704"
FT                   /product="chemokine (C-X-C motif) ligand 4, isoform CRA_b"
FT                   /note="gene_id=mCG1704.1 transcript_id=mCT168218.0
FT                   protein_id=mCP91136.0 isoform=CRA_b"
FT                   /protein_id="EDL05305.1"
FT                   /translation="SPRLPSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHC
FT                   AVPQLIATLKNGRKICLDRQAPLYKKVIKKILES"
FT   gene            2754808..2756796
FT                   /locus_tag="mCG_1050951"
FT                   /note="gene_id=mCG1050951.0"
FT   mRNA            join(2754808..2754954,2755047..2755170,2755289..2755372,
FT                   2756139..2756796)
FT                   /locus_tag="mCG_1050951"
FT                   /product="mCG1050951"
FT                   /note="gene_id=mCG1050951.0 transcript_id=mCT194740.0
FT                   created on 27-JAN-2005"
FT   CDS             join(2754876..2754954,2755047..2755170,2755289..2755372,
FT                   2756139..2756154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050951"
FT                   /product="mCG1050951"
FT                   /note="gene_id=mCG1050951.0 transcript_id=mCT194740.0
FT                   protein_id=mCP115769.0"
FT                   /db_xref="GOA:Q6W5C0"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:3037818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6W5C0"
FT                   /protein_id="EDL05303.1"
FT                   /translation="MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRV
FT                   DFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS"
FT   assembly_gap    2759313..2759332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2763173..2770596
FT                   /gene="Cxcl15"
FT                   /locus_tag="mCG_1706"
FT                   /note="gene_id=mCG1706.2"
FT   mRNA            join(2763173..2763340,2763911..2764040,2766645..2766728,
FT                   2769946..2770596)
FT                   /gene="Cxcl15"
FT                   /locus_tag="mCG_1706"
FT                   /product="chemokine (C-X-C motif) ligand 15"
FT                   /note="gene_id=mCG1706.2 transcript_id=mCT7937.1 created on
FT                   23-APR-2002"
FT   CDS             join(2763283..2763340,2763911..2764040,2766645..2766728,
FT                   2769946..2770177)
FT                   /codon_start=1
FT                   /gene="Cxcl15"
FT                   /locus_tag="mCG_1706"
FT                   /product="chemokine (C-X-C motif) ligand 15"
FT                   /note="gene_id=mCG1706.2 transcript_id=mCT7937.1
FT                   protein_id=mCP10928.0"
FT                   /db_xref="GOA:Q9WVL7"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:1339941"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVL7"
FT                   /protein_id="EDL05302.1"
FT                   /translation="MAAQGWSMLLLAVLNLGIFVRPCDTQELRCLCIQEHSEFIPLKLI
FT                   KNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPP
FT                   AMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLT
FT                   GSDA"
FT   assembly_gap    2780365..2780802
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    2781337..2781356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2784080..2784114
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    2785283..2785830
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    2786770..2790150
FT                   /estimated_length=3381
FT                   /gap_type="unknown"
FT   assembly_gap    2797815..2798465
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    2806839..2806858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2814241..2814701
FT                   /pseudo
FT                   /locus_tag="mCG_140141"
FT                   /note="gene_id=mCG140141.0"
FT   mRNA            2814241..2814701
FT                   /pseudo
FT                   /locus_tag="mCG_140141"
FT                   /note="gene_id=mCG140141.0 transcript_id=mCT168204.0
FT                   created on 23-APR-2002"
FT   assembly_gap    2816020..2816039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2846969..2847608
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   gene            2852697..2854523
FT                   /gene="Cxcl1"
FT                   /locus_tag="mCG_1708"
FT                   /note="gene_id=mCG1708.2"
FT   mRNA            join(2852697..2852788,2852878..2853001,2853117..2853197,
FT                   2853916..2854523)
FT                   /gene="Cxcl1"
FT                   /locus_tag="mCG_1708"
FT                   /product="chemokine (C-X-C motif) ligand 1"
FT                   /note="gene_id=mCG1708.2 transcript_id=mCT7938.2 created on
FT                   23-APR-2002"
FT   CDS             join(2852719..2852788,2852878..2853001,2853117..2853197,
FT                   2853916..2853931)
FT                   /codon_start=1
FT                   /gene="Cxcl1"
FT                   /locus_tag="mCG_1708"
FT                   /product="chemokine (C-X-C motif) ligand 1"
FT                   /note="gene_id=mCG1708.2 transcript_id=mCT7938.2
FT                   protein_id=mCP10931.1"
FT                   /db_xref="GOA:A2RTH0"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:108068"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTH0"
FT                   /protein_id="EDL05301.1"
FT                   /translation="MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLK
FT                   NIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK"
FT   gene            2865305..2867344
FT                   /locus_tag="mCG_1710"
FT                   /note="gene_id=mCG1710.0"
FT   mRNA            join(2865305..2865429,2865522..2865645,2865763..2865846,
FT                   2866595..2867344)
FT                   /locus_tag="mCG_1710"
FT                   /product="mCG1710"
FT                   /note="gene_id=mCG1710.0 transcript_id=mCT7941.1 created on
FT                   23-APR-2002"
FT   CDS             join(2865351..2865429,2865522..2865645,2865763..2865846,
FT                   2866595..2866610)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1710"
FT                   /product="mCG1710"
FT                   /note="gene_id=mCG1710.0 transcript_id=mCT7941.1
FT                   protein_id=mCP10938.1"
FT                   /db_xref="GOA:Q3U1J5"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:1340094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1J5"
FT                   /protein_id="EDL05300.1"
FT                   /translation="MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLKTLPRV
FT                   DFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN"
FT   assembly_gap    2879038..2881902
FT                   /estimated_length=2865
FT                   /gap_type="unknown"
FT   gene            2883334..2974085
FT                   /locus_tag="mCG_1717"
FT                   /note="gene_id=mCG1717.2"
FT   mRNA            join(2883334..2883549,2898900..2899084,2900933..2901055,
FT                   2911664..2911816,2913249..2913356,2926335..2926427,
FT                   2953080..2953205,2972874..2974085)
FT                   /locus_tag="mCG_1717"
FT                   /product="mCG1717, transcript variant mCT7948"
FT                   /note="gene_id=mCG1717.2 transcript_id=mCT7948.2 created on
FT                   06-FEB-2003"
FT   mRNA            join(2883334..2883549,2898900..2899084,2900933..2901055,
FT                   2911664..2911816,2913249..2913356,2926335..2926427,
FT                   2972874..2974085)
FT                   /locus_tag="mCG_1717"
FT                   /product="mCG1717, transcript variant mCT179793"
FT                   /note="gene_id=mCG1717.2 transcript_id=mCT179793.0 created
FT                   on 06-FEB-2003"
FT   CDS             join(2883434..2883549,2898900..2899084,2900933..2901055,
FT                   2911664..2911816,2913249..2913356,2926335..2926427,
FT                   2953080..2953205,2972874..2972986)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1717"
FT                   /product="mCG1717, isoform CRA_b"
FT                   /note="gene_id=mCG1717.2 transcript_id=mCT7948.2
FT                   protein_id=mCP10893.1 isoform=CRA_b"
FT                   /db_xref="GOA:D3YZG8"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:1915871"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3YZG8"
FT                   /protein_id="EDL05299.1"
FT                   /translation="MATRARGFSLLRGRLGRGPVRAPGVAERAWRGFGSSGRRHEAVII
FT                   SGTNMAKQIQKEIQQGVESWIALGNRRPHLSIILVGDNPASHTYVRNKIKAASAVGICS
FT                   ELIIKPKNVSQEELLDITDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFH
FT                   IINIGRLCLDQHSLIPATASAVWEIIKRAGIETFGKNVVVAGRSKNVGMPIAMLLHTDG
FT                   EHERPGGDATVTIAHRYTPREQLKAHTQLADIIIVAAGIPRLITADMVREGAAVIDVGI
FT                   NYIQDPVTGKTKLVGDVDFEAVKKKASFITPVPGGVGPMTVAMLLKNTLLAAKNIAY"
FT   CDS             join(2883434..2883549,2898900..2899084,2900933..2901055,
FT                   2911664..2911816,2913249..2913356,2926335..2926427,
FT                   2972874..2972986)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1717"
FT                   /product="mCG1717, isoform CRA_a"
FT                   /note="gene_id=mCG1717.2 transcript_id=mCT179793.0
FT                   protein_id=mCP102715.0 isoform=CRA_a"
FT                   /protein_id="EDL05298.1"
FT                   /translation="MATRARGFSLLRGRLGRGPVRAPGVAERAWRGFGSSGRRHEAVII
FT                   SGTNMAKQIQKEIQQGVESWIALGNRRPHLSIILVGDNPASHTYVRNKIKAASAVGICS
FT                   ELIIKPKNVSQEELLDITDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFH
FT                   IINIGRLCLDQHSLIPATASAVWEIIKRAGIETFGKNVVVAGRSKNVGMPIAMLLHTDG
FT                   EHERPGGDATVTIAHRYTPREQLKAHTQLADIIIVAAAVKKKASFITPVPGGVGPMTVA
FT                   MLLKNTLLAAKNIAY"
FT   assembly_gap    2907695..2908003
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    2917744..2917932
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    2928453..2928472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2946060..2951410
FT                   /estimated_length=5351
FT                   /gap_type="unknown"
FT   assembly_gap    2954802..2954964
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    2974537..2974556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2980360..2988012
FT                   /gene="Epgn"
FT                   /locus_tag="mCG_1713"
FT                   /note="gene_id=mCG1713.2"
FT   mRNA            join(<2980360..2980402,2980987..2981073,2983787..2983907,
FT                   2984886..2985038,2986720..2988012)
FT                   /gene="Epgn"
FT                   /locus_tag="mCG_1713"
FT                   /product="epithelial mitogen"
FT                   /note="gene_id=mCG1713.2 transcript_id=mCT7944.2 created on
FT                   23-APR-2002"
FT   CDS             join(2980360..2980402,2980987..2981073,2983787..2983907,
FT                   2984886..2985038,2986720..2986774)
FT                   /codon_start=1
FT                   /gene="Epgn"
FT                   /locus_tag="mCG_1713"
FT                   /product="epithelial mitogen"
FT                   /note="gene_id=mCG1713.2 transcript_id=mCT7944.2
FT                   protein_id=mCP10919.2"
FT                   /db_xref="GOA:Q0VEB7"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR015497"
FT                   /db_xref="MGI:MGI:1919170"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VEB7"
FT                   /protein_id="EDL05297.1"
FT                   /translation="MALGVLIAVCLLFKAMKAALSEEAEVIPPSTAQQSNWTFNNTEAD
FT                   YIEEPVALKFSHPCLEDHNSYCINGACAFHHELKQAICRCFTGYTGQRCEHLTLTSYAV
FT                   DSYEKYIAIGIGVGLLISAFLAVFYCYIRKRCINLKSPYIICSGGSPL"
FT   assembly_gap    2980568..2980587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2985227..2985456
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    3006079..3006744
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    3008581..3008600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3010005..3010024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3012716..3012735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3013756..3013775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3016464..3016483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3021560..3022999
FT                   /estimated_length=1440
FT                   /gap_type="unknown"
FT   assembly_gap    3024950..3024969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3029874..3048063
FT                   /gene="Ereg"
FT                   /locus_tag="mCG_1712"
FT                   /note="gene_id=mCG1712.1"
FT   mRNA            join(3029874..3030057,3041206..3041292,3042863..3042986,
FT                   3043495..3043644,3044478..3048063)
FT                   /gene="Ereg"
FT                   /locus_tag="mCG_1712"
FT                   /product="epiregulin"
FT                   /note="gene_id=mCG1712.1 transcript_id=mCT7943.1 created on
FT                   23-APR-2002"
FT   CDS             join(3030012..3030057,3041206..3041292,3042863..3042986,
FT                   3043495..3043644,3044478..3044559)
FT                   /codon_start=1
FT                   /gene="Ereg"
FT                   /locus_tag="mCG_1712"
FT                   /product="epiregulin"
FT                   /note="gene_id=mCG1712.1 transcript_id=mCT7943.1
FT                   protein_id=mCP10884.1"
FT                   /protein_id="EDL05296.1"
FT                   /translation="METLPASWVLTLLCLGSHLLQAVISTTVIPSCIPGESEDNCTALV
FT                   QMEDDPRVAQVQITKCSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFLTVH
FT                   QPLSKEYVALTVILIFLFLIITAGCIYYFCRWYKNRKSKKSREEYERVTSGDPVLPQV"
FT   assembly_gap    3063146..3063165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3075128..3075147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3093539..3094062
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   gene            3094680..3103501
FT                   /gene="Areg"
FT                   /locus_tag="mCG_1714"
FT                   /note="gene_id=mCG1714.2"
FT   mRNA            join(3094680..3094955,3095976..3096203,3098567..3098768,
FT                   3099412..3099573,3101716..3101824,3103273..3103501)
FT                   /gene="Areg"
FT                   /locus_tag="mCG_1714"
FT                   /product="amphiregulin"
FT                   /note="gene_id=mCG1714.2 transcript_id=mCT7945.2 created on
FT                   23-APR-2002"
FT   CDS             join(3094895..3094955,3095976..3096203,3098567..3098768,
FT                   3099412..3099573,3101716..3101809)
FT                   /codon_start=1
FT                   /gene="Areg"
FT                   /locus_tag="mCG_1714"
FT                   /product="amphiregulin"
FT                   /note="gene_id=mCG1714.2 transcript_id=mCT7945.2
FT                   protein_id=mCP10888.1"
FT                   /db_xref="GOA:Q4FJT2"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR015497"
FT                   /db_xref="MGI:MGI:88068"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJT2"
FT                   /protein_id="EDL05295.1"
FT                   /translation="MRTPLLPLARSVLLLLVLGSGHYAAALELNDPSSGKGESLSGDHS
FT                   AGGLELSVGREVSTISEMPSGSELSTGDYDYSEEYDNEPQISGYIIDDSVRVEQVIKPK
FT                   KNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTC
FT                   NCHQDYFGERCGEKSMKTHSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKR
FT                   YFREYEGETEERRRLRQENGTVHAIA"
FT   assembly_gap    3127020..3127373
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    3139102..3139369
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    3158538..3158749
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    3199411..3199430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3212876..>3238347)
FT                   /locus_tag="mCG_144557"
FT                   /note="gene_id=mCG144557.0"
FT   mRNA            complement(join(3212876..3213930,3219903..3219979,
FT                   3229005..3229269,3234994..3236172,3236690..3236888,
FT                   3238266..>3238347))
FT                   /locus_tag="mCG_144557"
FT                   /product="mCG144557"
FT                   /note="gene_id=mCG144557.0 transcript_id=mCT183981.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    3215504..3215547
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   CDS             complement(join(3219931..3219979,3229005..3229269,
FT                   3234994..>3235039))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144557"
FT                   /product="mCG144557"
FT                   /note="gene_id=mCG144557.0 transcript_id=mCT183981.0
FT                   protein_id=mCP106220.0"
FT                   /protein_id="EDL05294.1"
FT                   /translation="KTIIEEHSQRARLTAGFSAFTWHSSQCLETEPFLFQARISSGLQL
FT                   EASYSAHTLRCVNDLEIQCRERKRFFLTVTILDPESILGEYQVRVFSSTRGQLNFHIIW
FT                   CLRVSRTWCCGTTGF"
FT   assembly_gap    3306146..3306165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3308864..3308901
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    3311131..3311150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3312479..3357874)
FT                   /gene="Btc"
FT                   /locus_tag="mCG_12529"
FT                   /note="gene_id=mCG12529.2"
FT   mRNA            complement(join(3312479..3314545,3315964..3316071,
FT                   3317523..3317669,3321474..3321591,3332267..3332365,
FT                   3357537..3357874))
FT                   /gene="Btc"
FT                   /locus_tag="mCG_12529"
FT                   /product="betacellulin, epidermal growth factor family
FT                   member, transcript variant mCT13431"
FT                   /note="gene_id=mCG12529.2 transcript_id=mCT13431.1 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(3312479..3314545,3315964..3317669,
FT                   3321474..3321591,3332267..3332365,3357537..3357874))
FT                   /gene="Btc"
FT                   /locus_tag="mCG_12529"
FT                   /product="betacellulin, epidermal growth factor family
FT                   member, transcript variant mCT179785"
FT                   /note="gene_id=mCG12529.2 transcript_id=mCT179785.0 created
FT                   on 06-FEB-2003"
FT   CDS             complement(join(3315966..3316071,3317523..3317669,
FT                   3321474..3321591,3332267..3332365,3357537..3357600))
FT                   /codon_start=1
FT                   /gene="Btc"
FT                   /locus_tag="mCG_12529"
FT                   /product="betacellulin, epidermal growth factor family
FT                   member, isoform CRA_a"
FT                   /note="gene_id=mCG12529.2 transcript_id=mCT13431.1
FT                   protein_id=mCP10898.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q543J8"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR015497"
FT                   /db_xref="MGI:MGI:99439"
FT                   /db_xref="UniProtKB/TrEMBL:Q543J8"
FT                   /protein_id="EDL05292.1"
FT                   /translation="MDPTAPGSSVSSLPLLLVLALGLAILHCVVADGNTTRTPETNGSL
FT                   CGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARC
FT                   ERVDLFYLQQDRGQILVVCLIVVMVVFIILVIGVCTCCHPLRKHRKKKKEEKMETLDKD
FT                   KTPISEDIQETNIA"
FT   CDS             complement(join(3317519..3317669,3321474..3321591,
FT                   3332267..3332365,3357537..3357600))
FT                   /codon_start=1
FT                   /gene="Btc"
FT                   /locus_tag="mCG_12529"
FT                   /product="betacellulin, epidermal growth factor family
FT                   member, isoform CRA_b"
FT                   /note="gene_id=mCG12529.2 transcript_id=mCT179785.0
FT                   protein_id=mCP102707.0 isoform=CRA_b"
FT                   /protein_id="EDL05293.1"
FT                   /translation="MDPTAPGSSVSSLPLLLVLALGLAILHCVVADGNTTRTPETNGSL
FT                   CGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARC
FT                   ERVDLFYLQQDRGQILVVCLIVVMVVFIILVIGVCTCCQ"
FT   assembly_gap    3318260..3318390
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    3343875..3343903
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    3355140..3355274
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    3357049..3357068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3373347..3377339
FT                   /estimated_length=3993
FT                   /gap_type="unknown"
FT   assembly_gap    3391335..3391354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3408508..3408884
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    3434797..3434839
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    3435706..3436041
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    3441980..3441999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3466370..3466460
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    3467697..3467765
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   gene            3472507..3581717
FT                   /gene="9130213B05Rik"
FT                   /locus_tag="mCG_12525"
FT                   /note="gene_id=mCG12525.2"
FT   mRNA            join(3472507..3472741,3548804..3549487,3567969..3568047,
FT                   3577907..3581717)
FT                   /gene="9130213B05Rik"
FT                   /locus_tag="mCG_12525"
FT                   /product="RIKEN cDNA 9130213B05"
FT                   /note="gene_id=mCG12525.2 transcript_id=mCT13427.2 created
FT                   on 23-APR-2002"
FT   CDS             join(3472699..3472741,3548804..3549487,3567969..3568047,
FT                   3577907..3577991)
FT                   /codon_start=1
FT                   /gene="9130213B05Rik"
FT                   /locus_tag="mCG_12525"
FT                   /product="RIKEN cDNA 9130213B05"
FT                   /note="gene_id=mCG12525.2 transcript_id=mCT13427.2
FT                   protein_id=mCP10927.2"
FT                   /db_xref="GOA:Q923D3"
FT                   /db_xref="InterPro:IPR031431"
FT                   /db_xref="MGI:MGI:2443349"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q923D3"
FT                   /protein_id="EDL05291.1"
FT                   /translation="MVCKVLIALCIFTAGLRVQGSPTVPLPVSLMTKSSAPVATWTTSA
FT                   PHTARATTPVASATHNASVLRTTAASLTSQLPTDHREEAVTSPPLKRDVNSTDSSPAGF
FT                   PSTSSDGHLAPTPEEHSLGSPEATVPATGSQSPMLLSSQAPTSATTSPATSLSESLSAS
FT                   VTSSHNSTVANIQPTEAPMAPASPTEEHSSSHTPTSHVTAEPVPKEKSPQDTEPGKVIC
FT                   ESETTTPFLIMQEVENALSSGSIAAITVTVIAVVLLVFGGAAYLKIRHSSYGRLLDDHD
FT                   YGSWGNYNNPLYDDS"
FT   assembly_gap    3480912..3481037
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    3497292..3497608
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    3516665..3516786
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    3536374..3536443
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            complement(3581153..3581867)
FT                   /locus_tag="mCG_1041428"
FT                   /note="gene_id=mCG1041428.1"
FT   mRNA            complement(3581153..3581867)
FT                   /locus_tag="mCG_1041428"
FT                   /product="mCG1041428"
FT                   /note="gene_id=mCG1041428.1 transcript_id=mCT159132.1
FT                   created on 23-APR-2002"
FT   CDS             complement(3581487..3581648)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041428"
FT                   /product="mCG1041428"
FT                   /note="gene_id=mCG1041428.1 transcript_id=mCT159132.1
FT                   protein_id=mCP53037.1"
FT                   /protein_id="EDL05290.1"
FT                   /translation="MMSSNIKEVAHLPIFKRCQLTLLQESNVTMSQYKLTLLRSKLKWY
FT                   IHLPSKEG"
FT   assembly_gap    3586467..3586486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3608770..3608789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3619749..3619768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3623444..3623644
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    3632990..3636963
FT                   /estimated_length=3974
FT                   /gap_type="unknown"
FT   assembly_gap    3644915..3645287
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    3645652..3646066
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    3647558..3647603
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3650114..3650133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3680683..3681255
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   gene            complement(3688456..3689039)
FT                   /locus_tag="mCG_12532"
FT                   /note="gene_id=mCG12532.1"
FT   mRNA            complement(3688456..3689039)
FT                   /locus_tag="mCG_12532"
FT                   /product="mCG12532"
FT                   /note="gene_id=mCG12532.1 transcript_id=mCT13433.1 created
FT                   on 23-APR-2002"
FT   CDS             complement(3688628..3689005)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12532"
FT                   /product="mCG12532"
FT                   /note="gene_id=mCG12532.1 transcript_id=mCT13433.1
FT                   protein_id=mCP10903.1"
FT                   /protein_id="EDL05289.1"
FT                   /translation="MKLLIHNLLSSHVRGVGTRGFPLRLQATEVRINPVEFNPEFMARM
FT                   IPKVEWAALVQAADTLNLAEVPKEPTEGYEHDETFLRKMHHVLLEVDVLEGTLQCPESG
FT                   RLFPISRGIPNMLLNDEETET"
FT   gene            complement(3711173..3712636)
FT                   /pseudo
FT                   /locus_tag="mCG_12517"
FT                   /note="gene_id=mCG12517.1"
FT   mRNA            complement(3711173..3712636)
FT                   /pseudo
FT                   /locus_tag="mCG_12517"
FT                   /note="gene_id=mCG12517.1 transcript_id=mCT13418.1 created
FT                   on 23-APR-2002"
FT   gene            complement(3717194..>3718241)
FT                   /locus_tag="mCG_145901"
FT                   /note="gene_id=mCG145901.0"
FT   mRNA            complement(join(3717194..3717504,3717913..3718069,
FT                   3718218..>3718241))
FT                   /locus_tag="mCG_145901"
FT                   /product="mCG145901"
FT                   /note="gene_id=mCG145901.0 transcript_id=mCT186009.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(3717459..3717504,3717913..>3718031))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145901"
FT                   /product="mCG145901"
FT                   /note="gene_id=mCG145901.0 transcript_id=mCT186009.0
FT                   protein_id=mCP107739.0"
FT                   /protein_id="EDL05288.1"
FT                   /translation="KPPTPHVSETYERLEICRTSGKISFNLDSKRRNRKGMLGVSASKP
FT                   RQGLYSSKQ"
FT   assembly_gap    3717607..3717662
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    3720301..3721524
FT                   /estimated_length=1224
FT                   /gap_type="unknown"
FT   gene            complement(3722107..3722580)
FT                   /pseudo
FT                   /locus_tag="mCG_140144"
FT                   /note="gene_id=mCG140144.0"
FT   mRNA            complement(3722107..3722580)
FT                   /pseudo
FT                   /locus_tag="mCG_140144"
FT                   /note="gene_id=mCG140144.0 transcript_id=mCT168213.0
FT                   created on 23-APR-2002"
FT   assembly_gap    3725411..3725850
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    3730406..3730957
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   gene            complement(3737302..3738680)
FT                   /pseudo
FT                   /locus_tag="mCG_140145"
FT                   /note="gene_id=mCG140145.0"
FT   mRNA            complement(3737302..3738680)
FT                   /pseudo
FT                   /locus_tag="mCG_140145"
FT                   /note="gene_id=mCG140145.0 transcript_id=mCT168215.0
FT                   created on 19-FEB-2003"
FT   assembly_gap    3740099..3740453
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   gene            complement(3757428..3758184)
FT                   /pseudo
FT                   /locus_tag="mCG_12518"
FT                   /note="gene_id=mCG12518.3"
FT   mRNA            complement(3757428..3758184)
FT                   /pseudo
FT                   /locus_tag="mCG_12518"
FT                   /note="gene_id=mCG12518.3 transcript_id=mCT13419.2 created
FT                   on 18-JUL-2003"
FT   assembly_gap    3768333..3768352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3777899..3777987
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    3785984..3786975
FT                   /estimated_length=992
FT                   /gap_type="unknown"
FT   assembly_gap    3799202..3799454
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    3806217..3806236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3810888..3810907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3840885..3841133
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    3843581..3844536
FT                   /estimated_length=956
FT                   /gap_type="unknown"
FT   gene            complement(<3863035..3865060)
FT                   /locus_tag="mCG_1041451"
FT                   /note="gene_id=mCG1041451.0"
FT   mRNA            complement(join(<3863035..3863318,3865013..3865060))
FT                   /locus_tag="mCG_1041451"
FT                   /product="mCG1041451, transcript variant mCT159155"
FT                   /note="gene_id=mCG1041451.0 transcript_id=mCT159155.0
FT                   created on 23-APR-2002"
FT   mRNA            complement(join(<3863035..3863318,3864630..3864692))
FT                   /locus_tag="mCG_1041451"
FT                   /product="mCG1041451, transcript variant mCT168205"
FT                   /note="gene_id=mCG1041451.0 transcript_id=mCT168205.0
FT                   created on 23-APR-2002"
FT   CDS             complement(3863035..3863235)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041451"
FT                   /product="mCG1041451, isoform CRA_a"
FT                   /note="gene_id=mCG1041451.0 transcript_id=mCT168205.0
FT                   protein_id=mCP91142.0 isoform=CRA_a"
FT                   /protein_id="EDL05286.1"
FT                   /translation="MDRRLTMPMQMRAVMAEILMRPAQRPSWSHSKCFSCSNSLDPHLR
FT                   RIKSIPLKTFIFQMKALLHRD"
FT   CDS             complement(3863035..3863235)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041451"
FT                   /product="mCG1041451, isoform CRA_a"
FT                   /note="gene_id=mCG1041451.0 transcript_id=mCT159155.0
FT                   protein_id=mCP53042.1 isoform=CRA_a"
FT                   /protein_id="EDL05287.1"
FT                   /translation="MDRRLTMPMQMRAVMAEILMRPAQRPSWSHSKCFSCSNSLDPHLR
FT                   RIKSIPLKTFIFQMKALLHRD"
FT   assembly_gap    3872890..3873324
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    3877380..3877399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3879351..3883768
FT                   /estimated_length=4418
FT                   /gap_type="unknown"
FT   assembly_gap    3892165..3892184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3893296..3893429
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    3895089..3895443
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    3899773..3899792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3906887..3908489
FT                   /estimated_length=1603
FT                   /gap_type="unknown"
FT   gene            complement(3908693..3922898)
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /note="gene_id=mCG12522.2"
FT   mRNA            complement(join(3908693..3909715,3911672..3911792,
FT                   3912792..3912818,3912904..3912962,3913065..3913109,
FT                   3915386..3915464,3917386..3917501,3922461..3922898))
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /product="ring finger and CHY zinc finger domain containing
FT                   1, transcript variant mCT168043"
FT                   /note="gene_id=mCG12522.2 transcript_id=mCT168043.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3908693..3909715,3911672..3911792,
FT                   3912792..3912818,3912904..3912962,3913065..3913122,
FT                   3917416..3917501,3917729..3917848,3922461..3922898))
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /product="ring finger and CHY zinc finger domain containing
FT                   1, transcript variant mCT168041"
FT                   /note="gene_id=mCG12522.2 transcript_id=mCT168041.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3908693..3909715,3911672..3911792,
FT                   3912792..3912818,3912904..3912962,3913065..3913109,
FT                   3915386..3915464,3917386..3917501,3917729..3917848,
FT                   3922461..3922898))
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /product="ring finger and CHY zinc finger domain containing
FT                   1, transcript variant mCT13424"
FT                   /note="gene_id=mCG12522.2 transcript_id=mCT13424.2 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(3908693..3909715,3911672..3911792,
FT                   3912792..3912818,3912904..3912962,3913065..3913109,
FT                   3915386..3915464,3917386..3917501,3917729..3917848,
FT                   3920536..3920896,3922318..3922898))
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /product="ring finger and CHY zinc finger domain containing
FT                   1, transcript variant mCT168042"
FT                   /note="gene_id=mCG12522.2 transcript_id=mCT168042.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(3909587..3909715,3911672..3911792,
FT                   3912792..3912818,3912904..3912962,3913065..3913109,
FT                   3915386..3915464,3917386..3917501,3922461..3922550))
FT                   /codon_start=1
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /product="ring finger and CHY zinc finger domain containing
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG12522.2 transcript_id=mCT168043.0
FT                   protein_id=mCP90988.0 isoform=CRA_d"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017921"
FT                   /db_xref="InterPro:IPR037275"
FT                   /db_xref="MGI:MGI:1915348"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWD8"
FT                   /protein_id="EDL05285.1"
FT                   /translation="MAATAREDGVRNLAQGPRGCEHYDRACLLKAQQTCEDCSTLFGEY
FT                   YCSICHLFDKDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIENVSRQN
FT                   CPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDTE
FT                   VAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGGRRVPVDQQ"
FT   CDS             complement(join(3909587..3909715,3911672..3911792,
FT                   3912792..3912818,3912904..3912962,3913065..3913122,
FT                   3917416..3917501,3917729..3917848,3922461..3922550))
FT                   /codon_start=1
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /product="ring finger and CHY zinc finger domain containing
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG12522.2 transcript_id=mCT168041.0
FT                   protein_id=mCP90992.0 isoform=CRA_b"
FT                   /protein_id="EDL05283.1"
FT                   /translation="MAATAREDGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHD
FT                   TNEDHQLDRFKVKEVQCINCEKLQHAQQTCEDCSTLFGEYYCSICHLFDKDKRQFSFQC
FT                   IENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTR
FT                   YWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGGR
FT                   RVPVDQQ"
FT   CDS             complement(join(3909587..3909715,3911672..3911792,
FT                   3912792..3912818,3912904..3912962,3913065..3913109,
FT                   3915386..3915464,3917386..3917501,3917729..3917848,
FT                   3922461..3922550))
FT                   /codon_start=1
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /product="ring finger and CHY zinc finger domain containing
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG12522.2 transcript_id=mCT13424.2
FT                   protein_id=mCP10915.1 isoform=CRA_a"
FT                   /protein_id="EDL05282.1"
FT                   /translation="MAATAREDGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHD
FT                   TNEDHQLDRFKVKEVQCINCEKLQHAQQTCEDCSTLFGEYYCSICHLFDKDKRQYHCES
FT                   CGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIENVSRQNCPICLEDIHTSRVVAHVLP
FT                   CGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDTEVAQTPMPSEYQNVTVDILC
FT                   NDCNGRSTVQFHILGMKCKLCDSYNTAQAGGRRVPVDQQ"
FT   CDS             complement(join(3920866..3920896,3922318..3922550))
FT                   /codon_start=1
FT                   /gene="Rchy1"
FT                   /locus_tag="mCG_12522"
FT                   /product="ring finger and CHY zinc finger domain containing
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG12522.2 transcript_id=mCT168042.0
FT                   protein_id=mCP90999.0 isoform=CRA_c"
FT                   /protein_id="EDL05284.1"
FT                   /translation="MAATAREDGVRNLAQGPRGCEHYDRACLLKVTTLEGTSSMSCGRV
FT                   WQGQVGQKLQTELLVRIPAIWSWALLAGNVLARRGQLRCFKE"
FT   gene            <3922215..3930416
FT                   /locus_tag="mCG_12521"
FT                   /note="gene_id=mCG12521.3"
FT   mRNA            join(<3922215..3922809,3923514..3923616,3924927..3925135,
FT                   3926283..3926405,3929372..3930413)
FT                   /locus_tag="mCG_12521"
FT                   /product="mCG12521, transcript variant mCT168040"
FT                   /note="gene_id=mCG12521.3 transcript_id=mCT168040.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(<3922215..3922809,3923066..3923353,3923514..3923616,
FT                   3924927..3925135,3926283..3926429)
FT                   /locus_tag="mCG_12521"
FT                   /product="mCG12521, transcript variant mCT13423"
FT                   /note="gene_id=mCG12521.3 transcript_id=mCT13423.2 created
FT                   on 19-APR-2002"
FT   CDS             3922215..3922451
FT                   /codon_start=1
FT                   /locus_tag="mCG_12521"
FT                   /product="mCG12521, isoform CRA_a"
FT                   /note="gene_id=mCG12521.3 transcript_id=mCT13423.2
FT                   protein_id=mCP10912.2 isoform=CRA_a"
FT                   /protein_id="EDL05279.1"
FT                   /translation="MTDKPTREVNLSKGQVFTNKNLACSGDRVQSSCSPCQNVSCKESP
FT                   TPDGRYPDKQLGLKLLPNLPLPDPTAAHRGGTL"
FT   CDS             3922215..3922451
FT                   /codon_start=1
FT                   /locus_tag="mCG_12521"
FT                   /product="mCG12521, isoform CRA_a"
FT                   /note="gene_id=mCG12521.3 transcript_id=mCT168040.0
FT                   protein_id=mCP91003.0 isoform=CRA_a"
FT                   /protein_id="EDL05280.1"
FT                   /translation="MTDKPTREVNLSKGQVFTNKNLACSGDRVQSSCSPCQNVSCKESP
FT                   TPDGRYPDKQLGLKLLPNLPLPDPTAAHRGGTL"
FT   mRNA            join(<3922734..3923353,3924927..3925135,3926283..3926405,
FT                   3929372..3930416)
FT                   /locus_tag="mCG_12521"
FT                   /product="mCG12521, transcript variant mCT189818"
FT                   /note="gene_id=mCG12521.3 transcript_id=mCT189818.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3924989..3925135,3926283..3926405,3929372..3929626)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12521"
FT                   /product="mCG12521, isoform CRA_b"
FT                   /note="gene_id=mCG12521.3 transcript_id=mCT189818.0
FT                   protein_id=mCP110804.0 isoform=CRA_b"
FT                   /protein_id="EDL05281.1"
FT                   /translation="ILQAFGSLKKGDVLCSRHFKKTDFDRSTLNTKLKAGAIPSIFECP
FT                   YHLQEKREKLHCRKNFLLKTLPITHHGRQLVGASCIEEFEPQFIFEHSYSVMDSPKKLK
FT                   HKLDRVIIELENTKESLRNVLAREKHFQKSLRKTIMELKDESLISQETANSLGAFCWEC
FT                   YHESTAGGCSL"
FT   gene            complement(3931437..>3931967)
FT                   /locus_tag="mCG_1041450"
FT                   /note="gene_id=mCG1041450.1"
FT   mRNA            complement(3931437..>3931967)
FT                   /locus_tag="mCG_1041450"
FT                   /product="mCG1041450"
FT                   /note="gene_id=mCG1041450.1 transcript_id=mCT159154.1
FT                   created on 19-APR-2002"
FT   CDS             complement(3931813..>3931965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041450"
FT                   /product="mCG1041450"
FT                   /note="gene_id=mCG1041450.1 transcript_id=mCT159154.1
FT                   protein_id=mCP53041.1"
FT                   /protein_id="EDL05278.1"
FT                   /translation="CMRSFYFSQAILLNQGIKKTHNTLLDKIFIFQINGFHFSIISVKN
FT                   FTFKN"
FT   assembly_gap    3933106..3935503
FT                   /estimated_length=2398
FT                   /gap_type="unknown"
FT   assembly_gap    3938392..3938411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3939601..3939620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3947819..3950761)
FT                   /locus_tag="mCG_147144"
FT                   /note="gene_id=mCG147144.0"
FT   mRNA            complement(join(3947819..3948446,3948562..3950761))
FT                   /locus_tag="mCG_147144"
FT                   /product="mCG147144"
FT                   /note="gene_id=mCG147144.0 transcript_id=mCT187407.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(3948325..3948446,3948562..3948697))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147144"
FT                   /product="mCG147144"
FT                   /note="gene_id=mCG147144.0 transcript_id=mCT187407.0
FT                   protein_id=mCP109668.0"
FT                   /protein_id="EDL05277.1"
FT                   /translation="MQGPQVLLPIPFSYLPYLPLGRDLKSNVHAQSICRFSGEQGGGVQ
FT                   ACNMGCEGRMGAREKLVSLRKSAHLGRAKTQLIRYDSLKQ"
FT   assembly_gap    3948456..3948558
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    3959988..3960828
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   gene            complement(3966372..4003288)
FT                   /gene="Cdkl2"
FT                   /locus_tag="mCG_120402"
FT                   /note="gene_id=mCG120402.1"
FT   mRNA            complement(join(3966372..3968431,3977389..3977495,
FT                   3977649..3977772,3979647..3979740,3980286..3980581,
FT                   3982371..3982500,3985204..3985292,3991261..3991406,
FT                   3993388..3993500,3993843..3994021,3997440..3997634,
FT                   3999510..3999708,4002457..4002954))
FT                   /gene="Cdkl2"
FT                   /locus_tag="mCG_120402"
FT                   /product="cyclin-dependent kinase-like 2 (CDC2-related
FT                   kinase), transcript variant mCT168035"
FT                   /note="gene_id=mCG120402.1 transcript_id=mCT168035.0
FT                   created on 19-APR-2002"
FT   mRNA            complement(join(3966454..3968431,3969262..3969350,
FT                   3977389..3977495,3977649..3977772,3979647..3979740,
FT                   3980286..3980581,3982371..3982500,3985204..3985292,
FT                   3991261..3991406,3993388..3993500,3993843..3994021,
FT                   3997440..3997634,3999510..3999708,4003069..4003288))
FT                   /gene="Cdkl2"
FT                   /locus_tag="mCG_120402"
FT                   /product="cyclin-dependent kinase-like 2 (CDC2-related
FT                   kinase), transcript variant mCT121591"
FT                   /note="gene_id=mCG120402.1 transcript_id=mCT121591.0
FT                   created on 19-APR-2002"
FT   mRNA            complement(join(3966454..3968431,3977389..3977495,
FT                   3977649..3977772,3979647..3979740,3980286..3980581,
FT                   3982371..3982500,3985204..3985292,3991261..3991406,
FT                   3993388..3993500,3993843..3994021,3997440..3997634,
FT                   3999510..3999708,4003069..4003276))
FT                   /gene="Cdkl2"
FT                   /locus_tag="mCG_120402"
FT                   /product="cyclin-dependent kinase-like 2 (CDC2-related
FT                   kinase), transcript variant mCT168036"
FT                   /note="gene_id=mCG120402.1 transcript_id=mCT168036.0
FT                   created on 19-APR-2002"
FT   CDS             complement(join(3968378..3968431,3977389..3977495,
FT                   3977649..3977772,3979647..3979740,3980286..3980581,
FT                   3982371..3982500,3985204..3985292,3991261..3991406,
FT                   3993388..3993500,3993843..3994021,3997440..3997634,
FT                   3999510..3999677))
FT                   /codon_start=1
FT                   /gene="Cdkl2"
FT                   /locus_tag="mCG_120402"
FT                   /product="cyclin-dependent kinase-like 2 (CDC2-related
FT                   kinase), isoform CRA_b"
FT                   /note="gene_id=mCG120402.1 transcript_id=mCT168035.0
FT                   protein_id=mCP90986.0 isoform=CRA_b"
FT                   /protein_id="EDL05275.1"
FT                   /translation="MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVK
FT                   KIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQ
FT                   KYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVA
FT                   TRWYRAPELLVGDVKYGKAVDIWAIGCLVIEMLMGQPLFPGESDIDQLHHIMTCLGNLI
FT                   PRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPKLPEAVISLAKKCLHIDPDKRPFCA
FT                   DLLRHDFFQMDGFAERFSQELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQ
FT                   DTNADPKIKDSKVFKVKGSKIDVEKMEKGSRASNANCLHDNGTNHKGLASTSLRDCSNV
FT                   NIDHSRNPGTAIPPLTHNLSAVAPGINAGMGTIPGVQNYRVDEKTKKYCNPFVKPNQPP
FT                   PAGIYNMNVSTSVSGEKYLLQANKKRKEYPKADVRLPELNYNHLPELRALEGIARNSRL
FT                   IKKENKCLSESRIPSLAAIDLHVSSVASHQMLPALEMTSSCTRALIP"
FT   CDS             complement(join(3968378..3968431,3977389..3977495,
FT                   3977649..3977772,3979647..3979740,3980286..3980581,
FT                   3982371..3982500,3985204..3985292,3991261..3991406,
FT                   3993388..3993500,3993843..3994021,3997440..3997634,
FT                   3999510..3999677))
FT                   /codon_start=1
FT                   /gene="Cdkl2"
FT                   /locus_tag="mCG_120402"
FT                   /product="cyclin-dependent kinase-like 2 (CDC2-related
FT                   kinase), isoform CRA_b"
FT                   /note="gene_id=mCG120402.1 transcript_id=mCT168036.0
FT                   protein_id=mCP90994.0 isoform=CRA_b"
FT                   /protein_id="EDL05276.1"
FT                   /translation="MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVK
FT                   KIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQ
FT                   KYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVA
FT                   TRWYRAPELLVGDVKYGKAVDIWAIGCLVIEMLMGQPLFPGESDIDQLHHIMTCLGNLI
FT                   PRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPKLPEAVISLAKKCLHIDPDKRPFCA
FT                   DLLRHDFFQMDGFAERFSQELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQ
FT                   DTNADPKIKDSKVFKVKGSKIDVEKMEKGSRASNANCLHDNGTNHKGLASTSLRDCSNV
FT                   NIDHSRNPGTAIPPLTHNLSAVAPGINAGMGTIPGVQNYRVDEKTKKYCNPFVKPNQPP
FT                   PAGIYNMNVSTSVSGEKYLLQANKKRKEYPKADVRLPELNYNHLPELRALEGIARNSRL
FT                   IKKENKCLSESRIPSLAAIDLHVSSVASHQMLPALEMTSSCTRALIP"
FT   CDS             complement(join(3969285..3969350,3977389..3977495,
FT                   3977649..3977772,3979647..3979740,3980286..3980581,
FT                   3982371..3982500,3985204..3985292,3991261..3991406,
FT                   3993388..3993500,3993843..3994021,3997440..3997634,
FT                   3999510..3999677))
FT                   /codon_start=1
FT                   /gene="Cdkl2"
FT                   /locus_tag="mCG_120402"
FT                   /product="cyclin-dependent kinase-like 2 (CDC2-related
FT                   kinase), isoform CRA_a"
FT                   /note="gene_id=mCG120402.1 transcript_id=mCT121591.0
FT                   protein_id=mCP53089.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q149A0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1858227"
FT                   /db_xref="UniProtKB/TrEMBL:Q149A0"
FT                   /protein_id="EDL05274.1"
FT                   /translation="MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVK
FT                   KIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQ
FT                   KYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVA
FT                   TRWYRAPELLVGDVKYGKAVDIWAIGCLVIEMLMGQPLFPGESDIDQLHHIMTCLGNLI
FT                   PRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPKLPEAVISLAKKCLHIDPDKRPFCA
FT                   DLLRHDFFQMDGFAERFSQELQLKIEKDARNNSLPKKSQNRKKEKDDALGEERKTLVVQ
FT                   DTNADPKIKDSKVFKVKGSKIDVEKMEKGSRASNANCLHDNGTNHKGLASTSLRDCSNV
FT                   NIDHSRNPGTAIPPLTHNLSAVAPGINAGMGTIPGVQNYRVDEKTKKYCNPFVKPNQPP
FT                   PAGIYNMNVSTSVSGEKYLLQANKKRKEYPKADVRLPELNYNHLPELRALEGIARNSRL
FT                   IKKENKCLSESRIPSLAAIDLHVSSVASHQGAGSPLSDDSEADLPRMEHQH"
FT   assembly_gap    3987853..3987872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4003333..4016230
FT                   /locus_tag="mCG_145900"
FT                   /note="gene_id=mCG145900.0"
FT   mRNA            join(<4003333..4003499,4008019..4008149,4013393..4016230)
FT                   /locus_tag="mCG_145900"
FT                   /product="mCG145900"
FT                   /note="gene_id=mCG145900.0 transcript_id=mCT186008.0
FT                   created on 04-JUL-2003"
FT   gene            complement(4012059..4098239)
FT                   /gene="E430034L04Rik"
FT                   /locus_tag="mCG_12534"
FT                   /note="gene_id=mCG12534.2"
FT   mRNA            complement(join(4012059..4015323,4015654..4015772,
FT                   4016539..4016667,4018238..4018340,4023605..4023703,
FT                   4024593..4024773,4026021..4026123,4026761..4026851,
FT                   4028599..4028772,4030631..4030712,4033430..4033548,
FT                   4098158..4098239))
FT                   /gene="E430034L04Rik"
FT                   /locus_tag="mCG_12534"
FT                   /product="RIKEN cDNA E430034L04, transcript variant
FT                   mCT168046"
FT                   /note="gene_id=mCG12534.2 transcript_id=mCT168046.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4012059..4015323,4015654..4015772,
FT                   4016539..4016667,4018238..4018340,4023605..4023703,
FT                   4024593..4024773,4026021..4026123,4026761..4026851,
FT                   4028599..4028772,4030631..4030712,4033430..4033548,
FT                   4037293..4037334,4043870..4044045))
FT                   /gene="E430034L04Rik"
FT                   /locus_tag="mCG_12534"
FT                   /product="RIKEN cDNA E430034L04, transcript variant
FT                   mCT168047"
FT                   /note="gene_id=mCG12534.2 transcript_id=mCT168047.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4012059..4015323,4015654..4015772,
FT                   4016539..4016667,4018238..4018340,4024593..4024773,
FT                   4026021..4026123,4026761..4026851,4028599..4028772,
FT                   4030631..4030712,4033430..4033548,4043870..4044007))
FT                   /gene="E430034L04Rik"
FT                   /locus_tag="mCG_12534"
FT                   /product="RIKEN cDNA E430034L04, transcript variant
FT                   mCT13435"
FT                   /note="gene_id=mCG12534.2 transcript_id=mCT13435.2 created
FT                   on 19-APR-2002"
FT   CDS             <4015019..4015342
FT                   /codon_start=1
FT                   /locus_tag="mCG_145900"
FT                   /product="mCG145900"
FT                   /note="gene_id=mCG145900.0 transcript_id=mCT186008.0
FT                   protein_id=mCP107738.0"
FT                   /protein_id="EDL05273.1"
FT                   /translation="VPLPKLPTVGLQRRCPVKRPSICPVPLPEPSFCVMPPRGGGPLPS
FT                   RSRIIPPPTIPRGPPGPRSLRLISLRSSPPPLVSRSLAALVFFSSTFKRTSPRNIIGFK
FT                   TEK"
FT   CDS             complement(join(4015051..4015323,4015654..4015772,
FT                   4016539..4016667,4018238..4018340,4024593..4024773,
FT                   4026021..4026123,4026761..4026851,4028599..4028772,
FT                   4030631..4030712,4033430..4033524))
FT                   /codon_start=1
FT                   /gene="E430034L04Rik"
FT                   /locus_tag="mCG_12534"
FT                   /product="RIKEN cDNA E430034L04, isoform CRA_a"
FT                   /note="gene_id=mCG12534.2 transcript_id=mCT13435.2
FT                   protein_id=mCP10889.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q542W3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR034376"
FT                   /db_xref="InterPro:IPR034377"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:2442040"
FT                   /db_xref="UniProtKB/TrEMBL:Q542W3"
FT                   /protein_id="EDL05270.1"
FT                   /translation="MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGV
FT                   DASGKPQEAVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQP
FT                   ERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEDRQPS
FT                   PEPVQENANSAYYDAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKHLEELE
FT                   EKSATPPPAEPASLPQEPPKPRVDAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDM
FT                   EQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLPN
FT                   FGFVVFDDSEPVQRILIAKPIMFRGEVRLNVEEKKTRAARERETRGGGDDRRDIRRNDR
FT                   GPGGPRGIVGGGMMRDRDGRGPPPRGGMTQKLGSGRGTGQMEGRFTGQRR"
FT   CDS             complement(join(4015051..4015323,4015654..4015772,
FT                   4016539..4016667,4018238..4018340,4023605..4023703,
FT                   4024593..4024773,4026021..4026123,4026761..4026851,
FT                   4028599..4028772,4030631..4030712,4033430..4033524))
FT                   /codon_start=1
FT                   /gene="E430034L04Rik"
FT                   /locus_tag="mCG_12534"
FT                   /product="RIKEN cDNA E430034L04, isoform CRA_b"
FT                   /note="gene_id=mCG12534.2 transcript_id=mCT168046.0
FT                   protein_id=mCP90987.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U541"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR034376"
FT                   /db_xref="InterPro:IPR034377"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:2442040"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U541"
FT                   /protein_id="EDL05271.1"
FT                   /translation="MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGV
FT                   DASGKPQEAVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQP
FT                   ERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEDRQPS
FT                   PEPVQENANSAYYDAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKHLEELE
FT                   EKSATPPPAEPASLPQEPPKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRVDAK
FT                   PEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPH
FT                   DIDENELKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILIAKPIMFRGE
FT                   VRLNVEEKKTRAARERETRGGGDDRRDIRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRG
FT                   GMTQKLGSGRGTGQMEGRFTGQRR"
FT   CDS             complement(join(4015051..4015323,4015654..4015772,
FT                   4016539..4016667,4018238..4018340,4023605..4023703,
FT                   4024593..4024773,4026021..4026123,4026761..4026851,
FT                   4028599..4028772,4030631..4030712,4033430..4033524))
FT                   /codon_start=1
FT                   /gene="E430034L04Rik"
FT                   /locus_tag="mCG_12534"
FT                   /product="RIKEN cDNA E430034L04, isoform CRA_b"
FT                   /note="gene_id=mCG12534.2 transcript_id=mCT168047.0
FT                   protein_id=mCP90998.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U541"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR034376"
FT                   /db_xref="InterPro:IPR034377"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:2442040"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U541"
FT                   /protein_id="EDL05272.1"
FT                   /translation="MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGV
FT                   DASGKPQEAVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQP
FT                   ERKFMQTFVLAPEGSVPNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEDRQPS
FT                   PEPVQENANSAYYDAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKHLEELE
FT                   EKSATPPPAEPASLPQEPPKAFSWASVTSKNLPPSGTVSSSGIPPHVKAPVSQPRVDAK
FT                   PEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQLFVGNLPH
FT                   DIDENELKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILIAKPIMFRGE
FT                   VRLNVEEKKTRAARERETRGGGDDRRDIRRNDRGPGGPRGIVGGGMMRDRDGRGPPPRG
FT                   GMTQKLGSGRGTGQMEGRFTGQRR"
FT   assembly_gap    4038460..4038708
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    4065091..4065125
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   gene            4098546..4163389
FT                   /gene="Vdp"
FT                   /locus_tag="mCG_12523"
FT                   /note="gene_id=mCG12523.1"
FT   mRNA            join(4098546..4098769,4113085..4113171,4113496..4113560,
FT                   4119019..4119095,4127146..4127246,4127641..4127743,
FT                   4127893..4127948,4131288..4131408,4134541..4134719,
FT                   4138027..4138167,4141099..4141187,4141897..4142051,
FT                   4142455..4142666,4147792..4147902,4148275..4148393,
FT                   4148520..4148701,4149806..4149927,4153296..4153434,
FT                   4154595..4154758,4155931..4156017,4158919..4159017,
FT                   4160400..4160507,4161718..4161933,4162440..4163389)
FT                   /gene="Vdp"
FT                   /locus_tag="mCG_12523"
FT                   /product="vesicle docking protein"
FT                   /note="gene_id=mCG12523.1 transcript_id=mCT13425.2 created
FT                   on 19-APR-2002"
FT   CDS             join(4098704..4098769,4113085..4113171,4113496..4113560,
FT                   4119019..4119095,4127146..4127246,4127641..4127743,
FT                   4127893..4127948,4131288..4131408,4134541..4134719,
FT                   4138027..4138167,4141099..4141187,4141897..4142051,
FT                   4142455..4142666,4147792..4147902,4148275..4148393,
FT                   4148520..4148701,4149806..4149927,4153296..4153434,
FT                   4154595..4154758,4155931..4156017,4158919..4159017,
FT                   4160400..4160507,4161718..4161933,4162440..4162520)
FT                   /codon_start=1
FT                   /gene="Vdp"
FT                   /locus_tag="mCG_12523"
FT                   /product="vesicle docking protein"
FT                   /note="gene_id=mCG12523.1 transcript_id=mCT13425.2
FT                   protein_id=mCP10914.2"
FT                   /protein_id="EDL05269.1"
FT                   /translation="MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRA
FT                   LKSLSKKYRLEVGIQAMEHLIHVLQTDRSDSEIIAYALDTLYNIISNDEEEELEENSTR
FT                   QSEDLGSQFTEIFIKQPENVTLLLSLLEEFDFHVRWPGVRLLTSLLKQLGPPVQQIILV
FT                   SPMGVSRLMDLLADSREIIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIITEEGN
FT                   SDGGIVVEDCLILLQNLLKTNNSNQNFFKEGSYIQRMKPWFEVGEENSGWSAQKVTNLH
FT                   LMLQLVRVLVSPTNPPGATSSCQKAMFQCGLLQQLCTILMATGIPADILTETINTVSEV
FT                   IRGCQVNQDYFASVNAPSNPPRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNEKG
FT                   QGEIVATLLPSTIDATGNSVSAGQLLCGGLFSTDSLSNWCAAVALAHALQGNATQKEQL
FT                   LRVQLATSIGNPPVSLLQQCTNILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSA
FT                   NVPFLTGQIAENLGEEEQLVQGLCALLLGISIYFNDNSLENYTKEKLKQLIEKRIGKEN
FT                   FIEKLGFISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEED
FT                   KKEEEVKKTLEQHDNIVTHYKNMIREQDLQLEELKQQVSTLKCQNEQLQTAVTQQASQI
FT                   QQHKDQYNLLKVQLGKDNHHQGSHGDGAQVNGIQPEEISRLREEIEELKSQQALLQGQL
FT                   AEKDSLIENLKSSQASGMSEQASATCPPRDPEQVAELKQELTALKSQLCSQSLEITRLQ
FT                   TENCELLQRAETLAKSVPVEGESEHVSAAKTTDVEGRLSALLQETKELKNEIKALSEER
FT                   TAIQKQLDSSNSTIAILQTEKDKLDLEVTDSKKEQDDLLVLLADQDQKILSLKSKLKDL
FT                   GHPVEEEDESGDQEDDDDEIDDGDKDQDI"
FT   gene            complement(4100852..4101581)
FT                   /pseudo
FT                   /locus_tag="mCG_12519"
FT                   /note="gene_id=mCG12519.2"
FT   mRNA            complement(4100852..4101581)
FT                   /pseudo
FT                   /locus_tag="mCG_12519"
FT                   /note="gene_id=mCG12519.2 transcript_id=mCT13420.2 created
FT                   on 19-FEB-2003"
FT   assembly_gap    4116146..4116457
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    4136298..4136512
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    4138680..4138810
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   gene            complement(4170488..4176001)
FT                   /locus_tag="mCG_12520"
FT                   /note="gene_id=mCG12520.1"
FT   mRNA            complement(join(4170488..4170740,4171691..4171726,
FT                   4172614..4172667,4173378..4173441,4175887..4176001))
FT                   /locus_tag="mCG_12520"
FT                   /product="mCG12520, transcript variant mCT13421"
FT                   /note="gene_id=mCG12520.1 transcript_id=mCT13421.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4170488..4170740,4171691..4171726,
FT                   4172614..4172943))
FT                   /locus_tag="mCG_12520"
FT                   /product="mCG12520, transcript variant mCT168039"
FT                   /note="gene_id=mCG12520.1 transcript_id=mCT168039.0 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4170621..4170740,4171691..4171726,
FT                   4172614..4172667,4173378..4173431))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12520"
FT                   /product="mCG12520, isoform CRA_a"
FT                   /note="gene_id=mCG12520.1 transcript_id=mCT13421.0
FT                   protein_id=mCP10907.1 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1930915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YUP7"
FT                   /protein_id="EDL05267.1"
FT                   /translation="MKVVILMALLVLTAHCVPVSRFPGKIFLYCPFFNRKHCQRFCEFF
FT                   KICRKPPLSRRTTVVPSFPLTTEADLSLTGGPLTPDRRGDSR"
FT   CDS             complement(4172746..4172925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12520"
FT                   /product="mCG12520, isoform CRA_b"
FT                   /note="gene_id=mCG12520.1 transcript_id=mCT168039.0
FT                   protein_id=mCP90995.0 isoform=CRA_b"
FT                   /protein_id="EDL05268.1"
FT                   /translation="MDMKWSEPEAGQSRPYSPDCHCRERRERLSLRLTVVSNLRLAAHW
FT                   HLRATLDRAQHTCR"
FT   assembly_gap    4177682..4177749
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    4183877..4183896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4184629..>4185052)
FT                   /locus_tag="mCG_1041449"
FT                   /note="gene_id=mCG1041449.0"
FT   mRNA            complement(4184629..>4185052)
FT                   /locus_tag="mCG_1041449"
FT                   /product="mCG1041449"
FT                   /note="gene_id=mCG1041449.0 transcript_id=mCT159153.1
FT                   created on 19-APR-2002"
FT   CDS             complement(4184727..>4185050)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041449"
FT                   /product="mCG1041449"
FT                   /note="gene_id=mCG1041449.0 transcript_id=mCT159153.1
FT                   protein_id=mCP53123.1"
FT                   /protein_id="EDL05266.1"
FT                   /translation="IEPIKVSFIRLRCLLFKAYISGNMGGVKGELYKEQRSGHLLTWGP
FT                   KSGARQRALWILSLEHRSSLTALGVRLGSGVTHVLGWHGNSGRDREEGTIIQLLQPQVP
FT                   GKE"
FT   assembly_gap    4186017..4186569
FT                   /estimated_length=553
FT                   /gap_type="unknown"
FT   gene            complement(4187086..>4214100)
FT                   /gene="Ppef2"
FT                   /locus_tag="mCG_12524"
FT                   /note="gene_id=mCG12524.2"
FT   mRNA            complement(join(4187086..4188062,4189541..4189628,
FT                   4191297..4191460,4192612..4192718,4195127..4195269,
FT                   4196683..4196868,4205665..4205814,4205890..4205926,
FT                   4206444..4206610,4207796..4207842,4208821..4208935,
FT                   4210161..4210336,4211233..4211290,4211419..4211546,
FT                   4214046..>4214100))
FT                   /gene="Ppef2"
FT                   /locus_tag="mCG_12524"
FT                   /product="protein phosphatase, EF hand calcium-binding
FT                   domain 2, transcript variant mCT168045"
FT                   /note="gene_id=mCG12524.2 transcript_id=mCT168045.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4187086..4188062,4189541..4189628,
FT                   4191297..4191460,4192612..4192709,4195118..4195269,
FT                   4196683..4196868,4199726..4199812,4205665..4205814,
FT                   4205890..4205926,4206444..4206610,4207796..4207842,
FT                   4208821..4208935,4210161..4210336,4211233..4211290,
FT                   4211419..4211546,4214046..>4214100))
FT                   /gene="Ppef2"
FT                   /locus_tag="mCG_12524"
FT                   /product="protein phosphatase, EF hand calcium-binding
FT                   domain 2, transcript variant mCT168044"
FT                   /note="gene_id=mCG12524.2 transcript_id=mCT168044.0 created
FT                   on 19-APR-2002"
FT   mRNA            complement(join(4187086..4188062,4189541..4189628,
FT                   4191297..4191460,4192612..4192718,4195127..4195269,
FT                   4196683..4196868,4199726..4200124,4205665..4205814,
FT                   4205890..4205926,4206444..4206610,4207796..4207842,
FT                   4208821..4208935,4210161..4210336,4211233..4211290,
FT                   4211419..4211546,4214046..>4214100))
FT                   /gene="Ppef2"
FT                   /locus_tag="mCG_12524"
FT                   /product="protein phosphatase, EF hand calcium-binding
FT                   domain 2, transcript variant mCT13426"
FT                   /note="gene_id=mCG12524.2 transcript_id=mCT13426.2 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4187809..4188062,4189541..4189628,
FT                   4191297..4191460,4192612..4192718,4195127..4195269,
FT                   4196683..4196868,4205665..4205814,4205890..4205926,
FT                   4206444..4206610,4207796..4207842,4208821..4208935,
FT                   4210161..4210336,4211233..4211290,4211419..4211546,
FT                   4214046..4214100))
FT                   /codon_start=1
FT                   /gene="Ppef2"
FT                   /locus_tag="mCG_12524"
FT                   /product="protein phosphatase, EF hand calcium-binding
FT                   domain 2, isoform CRA_c"
FT                   /note="gene_id=mCG12524.2 transcript_id=mCT168045.0
FT                   protein_id=mCP91000.0 isoform=CRA_c"
FT                   /protein_id="EDL05265.1"
FT                   /translation="MGSSSSTQHHFAFQNAEKAFKAAALIQRWYRRYMARLEMRRRCTW
FT                   NIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFAQDVETEEGGD
FT                   FESIEVPDSYTGPRLSFPLLPDHATALVEAFRLRQQLHARYVLNLLYETRKHLAQLPNI
FT                   NRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMV
FT                   LFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLA
FT                   TLVDEKVLVLHGGVSDKTDLELLAKLDRHKVVDILWSDPAAQEGCKANAVRGGGCYFGP
FT                   DVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPA
FT                   LTPHIVQYQANKATHRLTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKRDPDESGV
FT                   ITLSDWATAVESVLHLGLPWRMLRPQLVNSSADNVLEYRSWLDSLAKEQLSRENIQSSL
FT                   LEKLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSIDITDDGICDLARSID
FT                   FNKDGHIDINEFLEAFRLVEQSCLEGHASACLQSTDTAESGHSSPGPC"
FT   CDS             complement(join(4187809..4188062,4189541..4189628,
FT                   4191297..4191460,4192612..4192709,4195118..4195269,
FT                   4196683..4196868,4199726..4199812,4205665..4205814,
FT                   4205890..4205926,4206444..4206610,4207796..4207842,
FT                   4208821..4208935,4210161..4210336,4211233..4211290,
FT                   4211419..4211546,4214046..4214100))
FT                   /codon_start=1
FT                   /gene="Ppef2"
FT                   /locus_tag="mCG_12524"
FT                   /product="protein phosphatase, EF hand calcium-binding
FT                   domain 2, isoform CRA_b"
FT                   /note="gene_id=mCG12524.2 transcript_id=mCT168044.0
FT                   protein_id=mCP90996.0 isoform=CRA_b"
FT                   /protein_id="EDL05264.1"
FT                   /translation="MGSSSSTQHHFAFQNAEKAFKAAALIQRWYRRYMARLEMRRRCTW
FT                   NIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFAQDVETEEGGD
FT                   FESIEVPDSYTGPRLSFPLLPDHATALVEAFRLRQQLHARYVLNLLYETRKHLAQLPNI
FT                   NRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMV
FT                   LFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLA
FT                   TLVDEKVLVLHGGVSDKTDLELLAKLDRHKGESLPLAPDADCVADGGGVLEPTPEEWKQ
FT                   VVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCH
FT                   NRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKATHRLTMRQRQDLVEESA
FT                   LRALRQKLFAHSSDLLVEFRKRDPDESGVITLSDWATAVESVLHLGLPWRMLRPQLVNS
FT                   SADNVLEYRSWLDSLAKEQLSRENIQSSLLEKLYRNRSNLETIFRIIDSDHSGFISLDE
FT                   FRQTWKLFSSHMSIDITDDGICDLARSIDFNKDGHIDINEFLEAFRLVEQSCLEGHASA
FT                   CLQSTDTAESGHSSPGPC"
FT   CDS             complement(join(4187809..4188062,4189541..4189628,
FT                   4191297..4191460,4192612..4192718,4195127..4195269,
FT                   4196683..4196868,4199726..4200124,4205665..4205814,
FT                   4205890..4205926,4206444..4206610,4207796..4207842,
FT                   4208821..4208935,4210161..4210336,4211233..4211290,
FT                   4211419..4211546,4214046..4214100))
FT                   /codon_start=1
FT                   /gene="Ppef2"
FT                   /locus_tag="mCG_12524"
FT                   /product="protein phosphatase, EF hand calcium-binding
FT                   domain 2, isoform CRA_a"
FT                   /note="gene_id=mCG12524.2 transcript_id=mCT13426.2
FT                   protein_id=mCP10921.1 isoform=CRA_a"
FT                   /protein_id="EDL05263.1"
FT                   /translation="MGSSSSTQHHFAFQNAEKAFKAAALIQRWYRRYMARLEMRRRCTW
FT                   NIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFAQDVETEEGGD
FT                   FESIEVPDSYTGPRLSFPLLPDHATALVEAFRLRQQLHARYVLNLLYETRKHLAQLPNI
FT                   NRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMV
FT                   LFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLA
FT                   TLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRKESENREEQKRKDNQTSSG
FT                   QKPTPWFLPQSRSLPSSPFHLGSGFKAYKAGRSCSIPCGSPNSKELSRRGQVRRSVDLE
FT                   LEQCRQQAGFLGIREKGESLPLAPDADCVADGGGVLEPTPEEWKQVVDILWSDPAAQEG
FT                   CKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYY
FT                   EVGSNRGAYVKLGPALTPHIVQYQANKATHRLTMRQRISRVEESALRALRQKLFAHSSD
FT                   LLVEFRKRDPDESGVITLSDWATAVESVLHLGLPWRMLRPQLVNSSADNVLEYRSWLDS
FT                   LAKEQLSRENIQSSLLEKLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSI
FT                   DITDDGICDLARSIDFNKDGHIDINEFLEAFRLVEQSCLEGHASACLQSTDTAESGHSS
FT                   PGPC"
FT   assembly_gap    4188488..4188507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4194583..4194716
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    4197539..4198278
FT                   /estimated_length=740
FT                   /gap_type="unknown"
FT   assembly_gap    4201438..4201633
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    4210351..4210971
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   assembly_gap    4215112..4215171
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    4217166..4217338
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   gene            complement(4218634..4239267)
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /note="gene_id=mCG120408.1"
FT   mRNA            complement(join(4218634..4219921,4220532..4220609,
FT                   4222289..4222317,4223843..4223909,4224744..4224806,
FT                   4224925..4225089,4225353..4225425,4229115..4229205,
FT                   4233525..4233651,4237995..4238153,4238996..4239267))
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /product="N-acylsphingosine amidohydrolase (acid
FT                   ceramidase)-like, transcript variant mCT168037"
FT                   /note="gene_id=mCG120408.1 transcript_id=mCT168037.0
FT                   created on 06-FEB-2003"
FT   mRNA            complement(join(4218634..4219921,4220532..4220609,
FT                   4222289..4222317,4223843..4223909,4224744..4224806,
FT                   4224925..4225097,4226415..4226491,4229115..4229205,
FT                   4233525..4233651,4237995..4238153,4238996..4239267))
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /product="N-acylsphingosine amidohydrolase (acid
FT                   ceramidase)-like, transcript variant mCT179782"
FT                   /note="gene_id=mCG120408.1 transcript_id=mCT179782.0
FT                   created on 06-FEB-2003"
FT   mRNA            complement(join(4218634..4219921,4220532..4220609,
FT                   4222289..4222317,4223843..4223909,4224744..4224806,
FT                   4224925..4225097,4226415..4226491,4229115..4229236,
FT                   4229428..4229523,4237995..4238159,4238996..4239267))
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /product="N-acylsphingosine amidohydrolase (acid
FT                   ceramidase)-like, transcript variant mCT168038"
FT                   /note="gene_id=mCG120408.1 transcript_id=mCT168038.0
FT                   created on 06-FEB-2003"
FT   mRNA            complement(join(4218634..4219921,4220532..4220609,
FT                   4222289..4222317,4223843..4223909,4224744..4224806,
FT                   4224925..4225097,4226415..4226491,4229115..4229205,
FT                   4233525..4233651,4237995..4238159,4238996..4239267))
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /product="N-acylsphingosine amidohydrolase (acid
FT                   ceramidase)-like, transcript variant mCT121597"
FT                   /note="gene_id=mCG120408.1 transcript_id=mCT121597.2
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(4220534..4220609,4222289..4222317,
FT                   4223843..4223909,4224744..4224806,4224925..4225089,
FT                   4225353..4225425,4229115..4229205,4233525..4233651,
FT                   4237995..4238153,4238996..4239216))
FT                   /codon_start=1
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /product="N-acylsphingosine amidohydrolase (acid
FT                   ceramidase)-like, isoform CRA_d"
FT                   /note="gene_id=mCG120408.1 transcript_id=mCT168037.0
FT                   protein_id=mCP91005.0 isoform=CRA_d"
FT                   /protein_id="EDL05262.1"
FT                   /translation="MGTLATRAACHGAHLALALLLLLSLSGPWLSAVVPGTPPLFNVSL
FT                   DAAPEQRWLPMLRHYDPDFLRTAVAQVIGVPQWVLGMVGEIVSKVESFLPQPFTDEIRS
FT                   ICDSLNLSLADGILVNLAYEASAFCTSIVAQDSQGHIYHGRNLDYPFGKILRKLTANVQ
FT                   FIKNGQIAFTGTTFVGYVGLWTGQSPHKFTISGDEREQCFKQWLWGEPMTGRCGLSNAK
FT                   ASESESFEAAVYTLAKTPLIADVYYIVGGTSPKEGVVITRDRGGPADIWPLDPLNGEWF
FT                   RVETNYDHWKPAPKVDDRRTPAIKALNATGQAHLNLETLFQVLSLFPVYNNYTIYTTVM
FT                   SAAEPDKYLTMIRNPS"
FT   CDS             complement(join(4220534..4220609,4222289..4222317,
FT                   4223843..4223909,4224744..4224806,4224925..4225097,
FT                   4226415..4226491,4229115..4229205,4233525..4233651,
FT                   4237995..4238153,4238996..4239216))
FT                   /codon_start=1
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /product="N-acylsphingosine amidohydrolase (acid
FT                   ceramidase)-like, isoform CRA_a"
FT                   /note="gene_id=mCG120408.1 transcript_id=mCT179782.0
FT                   protein_id=mCP102704.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA18"
FT                   /db_xref="InterPro:IPR016699"
FT                   /db_xref="InterPro:IPR029130"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="MGI:MGI:1914361"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA18"
FT                   /protein_id="EDL05259.1"
FT                   /translation="MGTLATRAACHGAHLALALLLLLSLSGPWLSAVVPGTPPLFNVSL
FT                   DAAPEQRWLPMLRHYDPDFLRTAVAQVIGVPQWVLGMVGEIVSKVESFLPQPFTDEIRS
FT                   ICDSLNLSLADGILVNLAYEASAFCTSIVAQDSQGHIYHGRNLDYPFGKILRKLTANVQ
FT                   FIKNGQIAFTGTTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPISWL
FT                   IRKTLSESESFEAAVYTLAKTPLIADVYYIVGGTSPKEGVVITRDRGGPADIWPLDPLN
FT                   GEWFRVETNYDHWKPAPKVDDRRTPAIKALNATGQAHLNLETLFQVLSLFPVYNNYTIY
FT                   TTVMSAAEPDKYLTMIRNPS"
FT   CDS             complement(join(4220534..4220609,4222289..4222317,
FT                   4223843..4223909,4224744..4224806,4224925..4225097,
FT                   4226415..4226491,4229115..4229236,4229428..4229523,
FT                   4237995..4238159,4238996..4239216))
FT                   /codon_start=1
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /product="N-acylsphingosine amidohydrolase (acid
FT                   ceramidase)-like, isoform CRA_c"
FT                   /note="gene_id=mCG120408.1 transcript_id=mCT168038.0
FT                   protein_id=mCP90991.0 isoform=CRA_c"
FT                   /protein_id="EDL05261.1"
FT                   /translation="MGTLATRAACHGAHLALALLLLLSLSGPWLSAVVPGTPPLFNVSL
FT                   DAAPEQRWLPMLRHYDPDFLRTAVAQVIGDRVPQWVLGMVGEIVSKVESFLPQPFTDEI
FT                   RSICDSLNLSLADGILVNLAYEASAVSFYYVQTSLKKIQEARYGGIQFNPSTQKRQSNA
FT                   FFFFSQFQIAFTGTTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPIS
FT                   WLIRKTLSESESFEAAVYTLAKTPLIADVYYIVGGTSPKEGVVITRDRGGPADIWPLDP
FT                   LNGEWFRVETNYDHWKPAPKVDDRRTPAIKALNATGQAHLNLETLFQVLSLFPVYNNYT
FT                   IYTTVMSAAEPDKYLTMIRNPS"
FT   CDS             complement(join(4220534..4220609,4222289..4222317,
FT                   4223843..4223909,4224744..4224806,4224925..4225097,
FT                   4226415..4226491,4229115..4229205,4233525..4233651,
FT                   4237995..4238159,4238996..4239216))
FT                   /codon_start=1
FT                   /gene="Asahl"
FT                   /locus_tag="mCG_120408"
FT                   /product="N-acylsphingosine amidohydrolase (acid
FT                   ceramidase)-like, isoform CRA_b"
FT                   /note="gene_id=mCG120408.1 transcript_id=mCT121597.2
FT                   protein_id=mCP53052.1 isoform=CRA_b"
FT                   /protein_id="EDL05260.1"
FT                   /translation="MGTLATRAACHGAHLALALLLLLSLSGPWLSAVVPGTPPLFNVSL
FT                   DAAPEQRWLPMLRHYDPDFLRTAVAQVIGDRVPQWVLGMVGEIVSKVESFLPQPFTDEI
FT                   RSICDSLNLSLADGILVNLAYEASAFCTSIVAQDSQGHIYHGRNLDYPFGKILRKLTAN
FT                   VQFIKNGQIAFTGTTFVGYVGLWTGQSPHKFTISGDERDKGWWWENMIAALSLGHSPIS
FT                   WLIRKTLSESESFEAAVYTLAKTPLIADVYYIVGGTSPKEGVVITRDRGGPADIWPLDP
FT                   LNGEWFRVETNYDHWKPAPKVDDRRTPAIKALNATGQAHLNLETLFQVLSLFPVYNNYT
FT                   IYTTVMSAAEPDKYLTMIRNPS"
FT   assembly_gap    4221417..4221458
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    4222472..4222839
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    4228492..4228626
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    4241604..4245174
FT                   /estimated_length=3571
FT                   /gap_type="unknown"
FT   assembly_gap    4246672..4246691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4248376..4248395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4250196..4250215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<4251175..4270827)
FT                   /locus_tag="mCG_12535"
FT                   /note="gene_id=mCG12535.3"
FT   mRNA            complement(join(<4251175..4251244,4253604..4253705,
FT                   4255354..4255428,4256193..4256250,4257223..4257323,
FT                   4257466..4257537,4259555..4259665,4265942..4266046,
FT                   4270593..4270827))
FT                   /locus_tag="mCG_12535"
FT                   /product="mCG12535"
FT                   /note="gene_id=mCG12535.3 transcript_id=mCT13436.3 created
FT                   on 21-JUL-2003"
FT   CDS             complement(join(<4251175..4251244,4253604..4253705,
FT                   4255354..4255428,4256193..4256250,4257223..4257323,
FT                   4257466..4257537,4259555..4259665,4265942..4266046,
FT                   4270593..4270682))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12535"
FT                   /product="mCG12535"
FT                   /note="gene_id=mCG12535.3 transcript_id=mCT13436.3
FT                   protein_id=mCP10926.3"
FT                   /protein_id="EDL05258.1"
FT                   /translation="MSGRNNNKLPSNLPQLQNLIKRDPPAYVEEFLQQYNHYKSNMEIF
FT                   KLQPNKPSKELAELVMFMAQTFCKALILLRNKNLINPSSLLELFFELLRCHDKLLRKTL
FT                   YTHIVTDIKNINAKHKNNKVNVVLQNFMYTMLRDSNATAAKMSLDVMIELYRRNIWNDA
FT                   KTVNVITTACFSKITKILVAALTFFLGKDEEEKQDSDSESEEDGPTARDLLVQYATGKK
FT                   GSKNKKKLEKAMKVLKKQKKKKKPEVFNFSAIHLIHDPQ"
FT   assembly_gap    4252726..4252745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4257876..4257895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4259833..4259852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4262934..4263463
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    4264611..4264630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4265633..4265652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4266679..4269313
FT                   /estimated_length=2635
FT                   /gap_type="unknown"
FT   assembly_gap    4283571..4283590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4283596..4289246)
FT                   /gene="Cxcl9"
FT                   /locus_tag="mCG_12528"
FT                   /note="gene_id=mCG12528.2"
FT   mRNA            complement(join(4283596..4285035,4286193..4286277,
FT                   4287879..4288005,4289092..4289246))
FT                   /gene="Cxcl9"
FT                   /locus_tag="mCG_12528"
FT                   /product="chemokine (C-X-C motif) ligand 9"
FT                   /note="gene_id=mCG12528.2 transcript_id=mCT13430.2 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(4284928..4285035,4286193..4286277,
FT                   4287879..4288005,4289092..4289152))
FT                   /codon_start=1
FT                   /gene="Cxcl9"
FT                   /locus_tag="mCG_12528"
FT                   /product="chemokine (C-X-C motif) ligand 9"
FT                   /note="gene_id=mCG12528.2 transcript_id=mCT13430.2
FT                   protein_id=mCP10883.1"
FT                   /db_xref="GOA:P18340"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="InterPro:IPR027225"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:1352449"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18340"
FT                   /protein_id="EDL05257.1"
FT                   /translation="MKSAVLFLLGIIFLEQCGVRGTLVIRNARCSCISTSRGTIHYKSL
FT                   KDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKH
FT                   QKNMKNRKPKTPQSRRRSRKTT"
FT   assembly_gap    4290462..4290765
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   gene            4292702..4380176
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /note="gene_id=mCG15622.2"
FT   mRNA            join(4292702..4292797,4293733..4293867,4348990..4349067,
FT                   4353304..4354012,4367958..4367990,4369557..4369589,
FT                   4370799..4370828,4375233..4375265,4378107..4378157,
FT                   4379793..4380176)
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, transcript variant
FT                   mCT19058"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT19058.2 created
FT                   on 19-APR-2002"
FT   mRNA            join(4293634..4293867,4348990..4349067,4353304..4354012,
FT                   4367958..4367990,4369557..4369589,4370799..4370828,
FT                   4375233..4375265,4377105..4377158,4379793..4380176)
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, transcript variant
FT                   mCT168051"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT168051.0 created
FT                   on 19-APR-2002"
FT   gene            complement(4307499..4309752)
FT                   /gene="Cxcl10"
FT                   /locus_tag="mCG_12531"
FT                   /note="gene_id=mCG12531.2"
FT   mRNA            complement(join(4307499..4308268,4308683..4308772,
FT                   4308967..4309093,4309632..4309752))
FT                   /gene="Cxcl10"
FT                   /locus_tag="mCG_12531"
FT                   /product="chemokine (C-X-C motif) ligand 10"
FT                   /note="gene_id=mCG12531.2 transcript_id=mCT13432.1 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4308250..4308268,4308683..4308772,
FT                   4308967..4309093,4309632..4309692))
FT                   /codon_start=1
FT                   /gene="Cxcl10"
FT                   /locus_tag="mCG_12531"
FT                   /product="chemokine (C-X-C motif) ligand 10"
FT                   /note="gene_id=mCG12531.2 transcript_id=mCT13432.1
FT                   protein_id=mCP10885.1"
FT                   /db_xref="GOA:Q548V9"
FT                   /db_xref="InterPro:IPR001089"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR018048"
FT                   /db_xref="InterPro:IPR033899"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:1352450"
FT                   /db_xref="UniProtKB/TrEMBL:Q548V9"
FT                   /protein_id="EDL05256.1"
FT                   /translation="MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAI
FT                   GKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP"
FT   assembly_gap    4311728..4312316
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   gene            complement(4320284..>4324038)
FT                   /gene="Cxcl11"
FT                   /locus_tag="mCG_12536"
FT                   /note="gene_id=mCG12536.2"
FT   mRNA            complement(join(4320284..4321543,4321780..4321852,
FT                   4321945..4322071,4323896..>4324038))
FT                   /gene="Cxcl11"
FT                   /locus_tag="mCG_12536"
FT                   /product="chemokine (C-X-C motif) ligand 11"
FT                   /note="gene_id=mCG12536.2 transcript_id=mCT13437.2 created
FT                   on 19-APR-2002"
FT   CDS             complement(join(4321502..4321543,4321780..4321852,
FT                   4321945..4322071,4323896..>4323917))
FT                   /codon_start=1
FT                   /gene="Cxcl11"
FT                   /locus_tag="mCG_12536"
FT                   /product="chemokine (C-X-C motif) ligand 11"
FT                   /note="gene_id=mCG12536.2 transcript_id=mCT13437.2
FT                   protein_id=mCP10895.1"
FT                   /protein_id="EDL05255.1"
FT                   /translation="IWATAAQGFLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCD
FT                   KVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM"
FT   assembly_gap    4335369..4335388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4343561..4343686
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    4347113..4347301
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   mRNA            join(4348990..4349067,4353304..4354012,4367958..4367990,
FT                   4369557..4369589,4370799..4370828,4372096..4372180,
FT                   4378099..4378157,4379793..4380176)
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, transcript variant
FT                   mCT168049"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT168049.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4348990..4349067,4353304..4354012,4367958..4367990,
FT                   4369557..4369589,4370799..4370828,4375233..4375265,
FT                   4377105..4377158,4378128..4378157,4379793..4380176)
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, transcript variant
FT                   mCT168048"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT168048.0 created
FT                   on 19-APR-2002"
FT   mRNA            join(4348990..4349067,4353304..4354012,4367958..4367990,
FT                   4369557..4369589,4370799..4370828,4379694..4380176)
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, transcript variant
FT                   mCT168050"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT168050.0 created
FT                   on 19-APR-2002"
FT   CDS             join(4348999..4349067,4353304..4354012,4367958..4367990,
FT                   4369557..4369589,4370799..4370828,4372096..4372180,
FT                   4378099..4378157,4379793..4379917)
FT                   /codon_start=1
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, isoform CRA_b"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT168049.0
FT                   protein_id=mCP91006.0 isoform=CRA_b"
FT                   /protein_id="EDL05251.1"
FT                   /translation="MKMGHFEMVTTLLAAAVLMDIFQVKAEVLDMAENAFDDEYLKCKS
FT                   RMESKYIPQMKREEWANDALLRMVWDNAEIQWEARKAQLFLPRNFKDTYGIALTAYVNE
FT                   AQEQTSFYHTFSSAVKMAGLSRRRYIYNFPFKAFHFYLVRALQLLRRPCEKSYKTVVYS
FT                   TSPDISFTFGEQNQARLGNFTLAYSAKPETADNQRVLTIQTCFGVAVGKFLNKEDDSVV
FT                   LIPLSEVFQVSRKGTSNDLVLQSINSTCSYYECAFLGGLKTENCIANAEYIDPRYLYNP
FT                   DMDNQKLEDSVITWKLAQHRDLERQAVASCWKHHQQGFCNSESLYVVKDRSRGKANNPT
FT                   PGLVPGPKSHPSASSGNTLLPSVMASTILLVASAVNFIEL"
FT   CDS             join(4348999..4349067,4353304..4354012,4367958..4367990,
FT                   4369557..4369589,4370799..4370828,4375233..4375265,
FT                   4377105..4377158,4378128..4378157,4379793..4379917)
FT                   /codon_start=1
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, isoform CRA_a"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT168048.0
FT                   protein_id=mCP91001.0 isoform=CRA_a"
FT                   /protein_id="EDL05250.1"
FT                   /translation="MKMGHFEMVTTLLAAAVLMDIFQVKAEVLDMAENAFDDEYLKCKS
FT                   RMESKYIPQMKREEWANDALLRMVWDNAEIQWEARKAQLFLPRNFKDTYGIALTAYVNE
FT                   AQEQTSFYHTFSSAVKMAGLSRRRYIYNFPFKAFHFYLVRALQLLRRPCEKSYKTVVYS
FT                   TSPDISFTFGEQNQARLGNFTLAYSAKPETADNQRVLTIQTCFGVAVGKFLNKEDDSVV
FT                   LIPLSEVFQVSRKGTSNDLVLQSINSTCSYYECAFLGGLKTENCIANAEYIDPRYLYNP
FT                   DMDNQKLEDSGRNNLDPDRMPEIKVLQTEENPLLPDEKPDRSRGKANNPTPGLVPGPKS
FT                   HPSASSGNTLLPSVMASTILLVASAVNFIEL"
FT   CDS             join(4348999..4349067,4353304..4354012,4367958..4367990,
FT                   4369557..4369589,4370799..4370828,4375233..4375265,
FT                   4377105..4377158,4379793..4379917)
FT                   /codon_start=1
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, isoform CRA_d"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT168051.0
FT                   protein_id=mCP90997.0 isoform=CRA_d"
FT                   /protein_id="EDL05253.1"
FT                   /translation="MKMGHFEMVTTLLAAAVLMDIFQVKAEVLDMAENAFDDEYLKCKS
FT                   RMESKYIPQMKREEWANDALLRMVWDNAEIQWEARKAQLFLPRNFKDTYGIALTAYVNE
FT                   AQEQTSFYHTFSSAVKMAGLSRRRYIYNFPFKAFHFYLVRALQLLRRPCEKSYKTVVYS
FT                   TSPDISFTFGEQNQARLGNFTLAYSAKPETADNQRVLTIQTCFGVAVGKFLNKEDDSVV
FT                   LIPLSEVFQVSRKGTSNDLVLQSINSTCSYYECAFLGGLKTENCIANAEYIDPRYLYNP
FT                   DMDNQKLEDSGRNNLDPDRMPEIKVLQTEENPLLPDEKPAPGLVPGPKSHPSASSGNTL
FT                   LPSVMASTILLVASAVNFIEL"
FT   CDS             join(4348999..4349067,4353304..4354012,4367958..4367990,
FT                   4369557..4369589,4370799..4370828,4375233..4375265,
FT                   4378107..4378157,4379793..4379917)
FT                   /codon_start=1
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, isoform CRA_e"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT19058.2
FT                   protein_id=mCP10908.2 isoform=CRA_e"
FT                   /protein_id="EDL05254.1"
FT                   /translation="MKMGHFEMVTTLLAAAVLMDIFQVKAEVLDMAENAFDDEYLKCKS
FT                   RMESKYIPQMKREEWANDALLRMVWDNAEIQWEARKAQLFLPRNFKDTYGIALTAYVNE
FT                   AQEQTSFYHTFSSAVKMAGLSRRRYIYNFPFKAFHFYLVRALQLLRRPCEKSYKTVVYS
FT                   TSPDISFTFGEQNQARLGNFTLAYSAKPETADNQRVLTIQTCFGVAVGKFLNKEDDSVV
FT                   LIPLSEVFQVSRKGTSNDLVLQSINSTCSYYECAFLGGLKTENCIANAEYIDPRYLYNP
FT                   DMDNQKLEDSGRNNLDPDRMPESLYVVKDRSRGKANNPTPGLVPGPKSHPSASSGNTLL
FT                   PSVMASTILLVASAVNFIEL"
FT   CDS             join(4348999..4349067,4353304..4354012,4367958..4367990,
FT                   4369557..4369589,4370799..4370828,4379694..4379917)
FT                   /codon_start=1
FT                   /gene="Art3"
FT                   /locus_tag="mCG_15622"
FT                   /product="ADP-ribosyltransferase 3, isoform CRA_c"
FT                   /note="gene_id=mCG15622.2 transcript_id=mCT168050.0
FT                   protein_id=mCP90990.0 isoform=CRA_c"
FT                   /protein_id="EDL05252.1"
FT                   /translation="MKMGHFEMVTTLLAAAVLMDIFQVKAEVLDMAENAFDDEYLKCKS
FT                   RMESKYIPQMKREEWANDALLRMVWDNAEIQWEARKAQLFLPRNFKDTYGIALTAYVNE
FT                   AQEQTSFYHTFSSAVKMAGLSRRRYIYNFPFKAFHFYLVRALQLLRRPCEKSYKTVVYS
FT                   TSPDISFTFGEQNQARLGNFTLAYSAKPETADNQRVLTIQTCFGVAVGKFLNKEDDSVV
FT                   LIPLSEVFQVSRKGTSNDLVLQSINSTCSYYECAFLGGLKTENCIANAEYIDPRYLYNP
FT                   DMDNQKLEDSGCCCCSHHCTACSRGRIPNTDQSDVPMSVFFSTAPGLVPGPKSHPSASS
FT                   GNTLLPSVMASTILLVASAVNFIEL"
FT   assembly_gap    4351556..4351575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4357287..4363882
FT                   /estimated_length=6596
FT                   /gap_type="unknown"
FT   gene            complement(4381095..4400738)
FT                   /locus_tag="mCG_15625"
FT                   /note="gene_id=mCG15625.1"
FT   mRNA            complement(join(4381095..4381889,4382996..4383106,
FT                   4383324..4383443,4385060..4385167,4388029..4388122,
FT                   4388529..4388583,4389826..4390022,4391175..4391362,
FT                   4393652..4393878,4396353..4396505,4396591..4396674,
FT                   4400556..4400738))
FT                   /locus_tag="mCG_15625"
FT                   /product="mCG15625"
FT                   /note="gene_id=mCG15625.1 transcript_id=mCT19061.2 created
FT                   on 18-APR-2002"
FT   CDS             complement(join(4381761..4381889,4382996..4383106,
FT                   4383324..4383443,4385060..4385167,4388029..4388122,
FT                   4388529..4388583,4389826..4390022,4391175..4391362,
FT                   4393652..4393878,4396353..4396505,4396591..4396674,
FT                   4400556..4400622))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15625"
FT                   /product="mCG15625"
FT                   /note="gene_id=mCG15625.1 transcript_id=mCT19061.2
FT                   protein_id=mCP10925.2"
FT                   /protein_id="EDL05249.1"
FT                   /translation="MAFNFGAPSGTSGTSTATAAPAGGFGGFGTTTTTAGSAFSFSAPT
FT                   NTGSTGLLGGTQNKGFGFGTGFGTTTGTGTGLGTGLGTGLGFGGFNTQQQQQQQQTSLG
FT                   GLFSQPTQAPAQSTQLINTASALSAPTLLGDERDAILAKWNQLQAFWGTGKGYFNNNIP
FT                   PVEFTQENPFCRFKAVGYSCMPNNKDEDGLVVLIFNKKETDIRSQQQQLVESLHKVLGG
FT                   NQTLTVNVEGIKTLPDDQTEVVIYVVERSPNGTSRRVPATTLYAHFEQANIKAQLQQLG
FT                   VTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRL
FT                   KVQDQMTKQHQTRLDIISEDISELQKNQTTTMAKIAQYKRKLMELSHRTLQVLIKQEIQ
FT                   RKSGYAIQADEEQLRVQLDTIQGELNAPTQFKGRLNELMSQIRMQNHFGAVKSEEKYYI
FT                   DADLLREIKQHLKQQQEGLSHLISIIKDDLEDIKLVEHGLNETIHSRGGVFS"
FT   gene            complement(4409479..4473809)
FT                   /gene="Scarb2"
FT                   /locus_tag="mCG_140098"
FT                   /note="gene_id=mCG140098.0"
FT   mRNA            complement(join(4409479..4409837,4411857..4412015,
FT                   4414098..4414149,4415424..4415497,4416900..4417018,
FT                   4419557..4419726,4420248..4420367,4425508..4425599,
FT                   4426220..4426408,4427402..4427549,4453400..4453557,
FT                   4473359..4473809))
FT                   /gene="Scarb2"
FT                   /locus_tag="mCG_140098"
FT                   /product="scavenger receptor class B, member 2"
FT                   /note="gene_id=mCG140098.0 transcript_id=mCT168034.0
FT                   created on 18-APR-2002"
FT   CDS             complement(join(4409799..4409837,4411857..4412015,
FT                   4414098..4414149,4415424..4415497,4416900..4417018,
FT                   4419557..4419726,4420248..4420367,4425508..4425599,
FT                   4426220..4426408,4427402..4427549,4453400..4453557,
FT                   4473359..4473475))
FT                   /codon_start=1
FT                   /gene="Scarb2"
FT                   /locus_tag="mCG_140098"
FT                   /product="scavenger receptor class B, member 2"
FT                   /note="gene_id=mCG140098.0 transcript_id=mCT168034.0
FT                   protein_id=mCP91004.0"
FT                   /protein_id="EDL05248.1"
FT                   /translation="MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQTIEKNMVLQN
FT                   GTKVFNSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANIQFGE
FT                   NGTTISAVTNKAYVFERNQSVGDPNVDLIRTINIPLLTVVDLAQLTLLRELIEAMLKAY
FT                   QQKLFVIHTVHELLWGYKDEILSLVHIFKPDVSPNFGLFYERNGTNDGEYVFLTGEDNY
FT                   LNFSKIVEWNGKTSLDWWTTDTCNMINGTDGDSFHPLISKDEVLYLFPSDLCRSVHITF
FT                   SSFENVEGLPAFRYKVPAEILANTSENAGFCIPEGNCMDSGVLNISICKNGAPIIMSFP
FT                   HFYQADEKFVSAIKGMHPNKEEHESFVDINPLTGIILRGAKRFQINTYVRKLDDFVETG
FT                   DIRTMVFPVMYLNESVLIDKETANQLKSVINTTLVVTNIPYIIMALGVFFGLVFTWLAC
FT                   RGQGSMDEGTADERAPLIRT"
FT   assembly_gap    4418926..4418945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4424791..4424890
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    4428691..4428710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4441482..4441501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4442531..4442550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4443559..4443578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4445110..4446798
FT                   /estimated_length=1689
FT                   /gap_type="unknown"
FT   assembly_gap    4453016..4453035
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4473136..4473252
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    4474817..4475160
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    4482877..4484982
FT                   /estimated_length=2106
FT                   /gap_type="unknown"
FT   assembly_gap    4487301..4487320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4495719..4509819
FT                   /estimated_length=14101
FT                   /gap_type="unknown"
FT   gene            <4513667..4549237
FT                   /locus_tag="mCG_15626"
FT                   /note="gene_id=mCG15626.2"
FT   mRNA            join(<4513667..4513743,4520817..4521153,4524533..4524666,
FT                   4533186..4533330,4537050..4537151,4538182..4538262,
FT                   4543831..4543986,4546091..4546168,4549091..4549237)
FT                   /locus_tag="mCG_15626"
FT                   /product="mCG15626, transcript variant mCT19062"
FT                   /note="gene_id=mCG15626.2 transcript_id=mCT19062.2 created
FT                   on 18-APR-2002"
FT   mRNA            join(4513667..4513743,4524533..4524666,4533186..4533330,
FT                   4538182..4538262,4543831..4543986,4549091..4549237)
FT                   /locus_tag="mCG_15626"
FT                   /product="mCG15626, transcript variant mCT168053"
FT                   /note="gene_id=mCG15626.2 transcript_id=mCT168053.0 created
FT                   on 18-APR-2002"
FT   CDS             join(4513667..4513743,4520817..4521153,4524533..4524666,
FT                   4533186..4533330,4537050..4537151,4538182..4538262,
FT                   4543831..4543986,4546091..4546168,4549091..4549189)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15626"
FT                   /product="mCG15626, isoform CRA_b"
FT                   /note="gene_id=mCG15626.2 transcript_id=mCT19062.2
FT                   protein_id=mCP10932.2 isoform=CRA_b"
FT                   /db_xref="GOA:D3YWC7"
FT                   /db_xref="InterPro:IPR032743"
FT                   /db_xref="MGI:MGI:2686227"
FT                   /db_xref="UniProtKB/TrEMBL:D3YWC7"
FT                   /protein_id="EDL05246.1"
FT                   /translation="MAECGQRLQPTTLAPRLLRERQNCGWYLGNLPPKRFIRRNRLTCQ
FT                   GFLNSRHWVFVKEDNFRKDCPPHQSPKDAFLPLIHRGAPSATPEKRQSTLLKGATLLSK
FT                   LSKAGKAFLEDVEAEAAQHPLTLYPQLTEALPAELLLQVLEVLDPERKLEDVWAYCQDT
FT                   RKPMKEPTELVGKRSSQERPPKKTLISRSGQWLCEEKSSKVDSLYKDRLLHDDVHRGVT
FT                   DFCHWAEDLGSSAIEEEFVLQQFDIGYQTRRSCDALLRLRLNQDKLFINRPPSLREHCG
FT                   HWSEPRSSGRANPQKPKRVKMRYGAWYLNTSLWKRQRADEPLVDPMVSHKAQDSTFKEQ
FT                   LQEQGELLAGLRGTAAFKDFILSRGYRMPRFLEKIYAEEKNKSENIKAPKKLTQTEKNP
FT                   GSR"
FT   assembly_gap    4522754..4522792
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   CDS             join(4524617..4524666,4533186..4533330,4538182..4538262,
FT                   4543831..4543986,4549091..4549189)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15626"
FT                   /product="mCG15626, isoform CRA_a"
FT                   /note="gene_id=mCG15626.2 transcript_id=mCT168053.0
FT                   protein_id=mCP90993.0 isoform=CRA_a"
FT                   /protein_id="EDL05245.1"
FT                   /translation="MKEPTELVGKRSSQERPPKKTLISRSGQWLCEEKSSKVDSLYKDR
FT                   LLHDDVHRGVTDFCHWAEDLDKLFINRPPSLREHCGHWSEPRSSGRANPQKPKRVKMRY
FT                   GAWYLNTSLWKRQRADEPLVDPMVSHKAQDSTFKEQLQEQFLEKIYAEEKNKSENIKAP
FT                   KKLTQTEKNPGSR"
FT   mRNA            join(<4530173..4530327,4533186..4533330,4543831..4543986,
FT                   4546091..4546168,4549091..4549237)
FT                   /locus_tag="mCG_15626"
FT                   /product="mCG15626, transcript variant mCT168054"
FT                   /note="gene_id=mCG15626.2 transcript_id=mCT168054.0 created
FT                   on 18-APR-2002"
FT   CDS             join(<4530173..4530327,4533186..4533330,4543831..4543986,
FT                   4546091..4546168,4549091..4549189)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15626"
FT                   /product="mCG15626, isoform CRA_c"
FT                   /note="gene_id=mCG15626.2 transcript_id=mCT168054.0
FT                   protein_id=mCP91002.0 isoform=CRA_c"
FT                   /protein_id="EDL05247.1"
FT                   /translation="LQQRDSLCRNWMLSCIQPLPTLHFLCIIREHLACDCLPRCLSPSC
FT                   IAEATQRPKKTLISRSGQWLCEEKSSKVDSLYKDRLLHDDVHRGVTDFCHWAEDLNPQK
FT                   PKRVKMRYGAWYLNTSLWKRQRADEPLVDPMVSHKAQDSTFKEQLQEQGELLAGLRGTA
FT                   AFKDFILSRGYRMPRFLEKIYAEEKNKSENIKAPKKLTQTEKNPGSR"
FT   assembly_gap    4535416..4535435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4550079..4550240
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            4561613..4565079
FT                   /gene="D5Ertd593e"
FT                   /locus_tag="mCG_15623"
FT                   /note="gene_id=mCG15623.2"
FT   mRNA            join(4561613..4561911,4563375..4565079)
FT                   /gene="D5Ertd593e"
FT                   /locus_tag="mCG_15623"
FT                   /product="DNA segment, Chr 5, ERATO Doi 593, expressed,
FT                   transcript variant mCT19060"
FT                   /note="gene_id=mCG15623.2 transcript_id=mCT19060.2 created
FT                   on 18-APR-2002"
FT   mRNA            join(4561613..4561911,4563087..4563308)
FT                   /gene="D5Ertd593e"
FT                   /locus_tag="mCG_15623"
FT                   /product="DNA segment, Chr 5, ERATO Doi 593, expressed,
FT                   transcript variant mCT168052"
FT                   /note="gene_id=mCG15623.2 transcript_id=mCT168052.0 created
FT                   on 18-APR-2002"
FT   CDS             join(4561683..4561911,4563375..4564162)
FT                   /codon_start=1
FT                   /gene="D5Ertd593e"
FT                   /locus_tag="mCG_15623"
FT                   /product="DNA segment, Chr 5, ERATO Doi 593, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15623.2 transcript_id=mCT19060.2
FT                   protein_id=mCP10909.1 isoform=CRA_b"
FT                   /protein_id="EDL05244.1"
FT                   /translation="MGAVWSALLVGGGLAGALILWLLRGDSGAPGKDGVAEPPQKGAPP
FT                   GEAAAPGDGPGGGGSGGLSPEPSDRELVSKAEHLRESNGHLISESKDLGNLPEAQRLQN
FT                   VGADWVNAREFVPVGKIPDTHSRADSEAARNQSPGSHGGEWRLPKGQETAVKVAGSVAA
FT                   KLPSSSLLVDRAKAVSQDQAGHEDWEVVSRHSSWGSVGLGGSLEASRLSLNQRMDDSTN
FT                   SLVGGRGWEVDGKVASLKPQQVSIQFQVHYTTNTDVQFIAVTGDHESLGRWNTYIPLHY
FT                   CKDGLWSHSVFLPADTVVEWKFVLVENKEVTRWEECSNRFLQTGHEDKVVHGWWGIH"
FT   CDS             join(4561683..4561911,4563087..4563097)
FT                   /codon_start=1
FT                   /gene="D5Ertd593e"
FT                   /locus_tag="mCG_15623"
FT                   /product="DNA segment, Chr 5, ERATO Doi 593, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15623.2 transcript_id=mCT168052.0
FT                   protein_id=mCP90989.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0J9YUR6"
FT                   /db_xref="MGI:MGI:1261768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YUR6"
FT                   /protein_id="EDL05243.1"
FT                   /translation="MGAVWSALLVGGGLAGALILWLLRGDSGAPGKDGVAEPPQKGAPP
FT                   GEAAAPGDGPGGGGSGGLSPEPSDRELVSKAGAK"
FT   assembly_gap    4562491..4562703
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   gene            complement(4566746..>4591254)
FT                   /locus_tag="mCG_114051"
FT                   /note="gene_id=mCG114051.1"
FT   mRNA            complement(join(4566746..4566986,4568452..4568559,
FT                   4570939..4571097,4581860..4581927,4591097..>4591254))
FT                   /locus_tag="mCG_114051"
FT                   /product="mCG114051"
FT                   /note="gene_id=mCG114051.1 transcript_id=mCT115145.1
FT                   created on 16-OCT-2002"
FT   CDS             complement(join(4566910..4566986,4568452..4568559,
FT                   4570939..4571097,4581860..4581927,4591097..>4591254))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114051"
FT                   /product="mCG114051"
FT                   /note="gene_id=mCG114051.1 transcript_id=mCT115145.1
FT                   protein_id=mCP53070.1"
FT                   /protein_id="EDL05242.1"
FT                   /translation="FTQHSIKTNTPKEDPTRDLKQLLQELRTVINEEPAMALSKTEEDG
FT                   RTPSLGALEPVPLHPGDLEDPSSCFTFTSTASPSGKMSASRSFSSSPKKSPVHSLLTSS
FT                   AEESVNSTPQYRSTKPIHSPTSAKDSQSPSLETTGKTCQKLQNRLESLQTLVEDLQLKN
FT                   QAMSSMIRNQEKRIQKVKDQEKMLLK"
FT   assembly_gap    4576347..4577568
FT                   /estimated_length=1222
FT                   /gap_type="unknown"
FT   assembly_gap    4585486..4588921
FT                   /estimated_length=3436
FT                   /gap_type="unknown"
FT   gene            complement(4592035..>4622022)
FT                   /locus_tag="mCG_114049"
FT                   /note="gene_id=mCG114049.1"
FT   mRNA            complement(join(4592035..4592103,4592918..4593010,
FT                   4594873..4595031,4599679..4599791,4604032..4604221,
FT                   4607915..4608399,4609612..4609809,4610370..4610489,
FT                   4617581..4617695,4619395..4619505,4621301..4621377,
FT                   4621693..>4622022))
FT                   /locus_tag="mCG_114049"
FT                   /product="mCG114049, transcript variant mCT174613"
FT                   /note="gene_id=mCG114049.1 transcript_id=mCT174613.0
FT                   created on 16-OCT-2002"
FT   assembly_gap    4597367..4597386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4603557..4603576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4604767..4605756
FT                   /estimated_length=990
FT                   /gap_type="unknown"
FT   assembly_gap    4607048..4607331
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   CDS             complement(join(4608043..4608399,4609612..4609809,
FT                   4610370..4610489,4617581..4617695,4619395..4619505,
FT                   4621301..4621377,4621693..>4622022))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114049"
FT                   /product="mCG114049, isoform CRA_b"
FT                   /note="gene_id=mCG114049.1 transcript_id=mCT174613.0
FT                   protein_id=mCP97532.0 isoform=CRA_b"
FT                   /protein_id="EDL05241.1"
FT                   /translation="RRRESQSQEESRNQLQNTVRELEAAKCLKEDMLKDSSTQIEQLRK
FT                   MMLSHEGVLQEIRSILVDFEEASGKKICEHDSMSTMHFRSLGSAISKILRELDTEISFL
FT                   KGRIFPVEDQLETLKSESQNKIELLLQQHQDRIEQLISEHEVEITGLTEKASSARSQAN
FT                   SVQSQLEIIQEQARNQNSMYMRQLSDLESTVSQLRSELRESKRMYEDKIEELEKQLVLA
FT                   NSELTEARTERDQFSQESGNLDDQLQKLLADLHKREKELSLEKEQNKRLWDRDTGNSIT
FT                   IDHLRRELDDRNMEVQRLEALLKAMKSECQGQMERQMAAIQGKNESLEKVSSLTAQLES
FT                   TKEMLRKVVEELTAKKMNLESSERTVSDLTASLQEKERAIEATNAEITKLRSRVDLKLQ
FT                   ELQHLKNEGRSPQKRADGNVRRSNSRWRKRTRSLRF"
FT   assembly_gap    4609239..4609452
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    4613061..4613080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4613212..4613884,4617581..4617695,
FT                   4619395..4619505,4621301..4621377,4621818..>4622022))
FT                   /locus_tag="mCG_114049"
FT                   /product="mCG114049, transcript variant mCT115143"
FT                   /note="gene_id=mCG114049.1 transcript_id=mCT115143.1
FT                   created on 16-OCT-2002"
FT   CDS             complement(join(4621361..4621377,4621818..>4622022))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114049"
FT                   /product="mCG114049, isoform CRA_a"
FT                   /note="gene_id=mCG114049.1 transcript_id=mCT115143.1
FT                   protein_id=mCP53022.1 isoform=CRA_a"
FT                   /protein_id="EDL05240.1"
FT                   /translation="RRRESQSQEESRNQLQNTVRELEAAKCLKEDMLKDSSTQIEQLRK
FT                   MMLSHEGVLQEIRSILVDFEEASGRGSA"
FT   assembly_gap    4622369..4623184
FT                   /estimated_length=816
FT                   /gap_type="unknown"
FT   gene            complement(<4626186..4634888)
FT                   /locus_tag="mCG_1041434"
FT                   /note="gene_id=mCG1041434.1"
FT   mRNA            complement(join(<4626186..4626404,4628178..4628314,
FT                   4632438..4632481,4634823..4634888))
FT                   /locus_tag="mCG_1041434"
FT                   /product="mCG1041434"
FT                   /note="gene_id=mCG1041434.1 transcript_id=mCT159138.1
FT                   created on 18-APR-2002"
FT   CDS             complement(join(<4626186..4626404,4628178..4628244))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041434"
FT                   /product="mCG1041434"
FT                   /note="gene_id=mCG1041434.1 transcript_id=mCT159138.1
FT                   protein_id=mCP53059.1"
FT                   /protein_id="EDL05239.1"
FT                   /translation="MESKACESKNEDLLPSGITSKGGSSSPFFVTSTHGTIIENTSSTG
FT                   TLTQMPFFPKYEVELDSPRKSTPYPGKEHIERVLEEYSHQVKDLQRRLNE"
FT   assembly_gap    4629017..4629683
FT                   /estimated_length=667
FT                   /gap_type="unknown"
FT   gene            4642548..4932645
FT                   /gene="Shroom3"
FT                   /locus_tag="mCG_140064"
FT                   /note="gene_id=mCG140064.0"
FT   mRNA            join(4642548..4643593,4740353..4740507,4886740..4886871,
FT                   4900863..4900994,4907089..4910251,4915526..4915599,
FT                   4917608..4918444,4919663..4920154,4922385..4922535,
FT                   4929216..4929488,4931508..4932645)
FT                   /gene="Shroom3"
FT                   /locus_tag="mCG_140064"
FT                   /product="shroom family member 3"
FT                   /note="gene_id=mCG140064.0 transcript_id=mCT167874.0
FT                   created on 12-APR-2002"
FT   CDS             join(4643429..4643593,4740353..4740507,4886740..4886871,
FT                   4900863..4900994,4907089..4910251,4915526..4915599,
FT                   4917608..4918444,4919663..4920154,4922385..4922535,
FT                   4929216..4929488,4931508..4931876)
FT                   /codon_start=1
FT                   /gene="Shroom3"
FT                   /locus_tag="mCG_140064"
FT                   /product="shroom family member 3"
FT                   /note="gene_id=mCG140064.0 transcript_id=mCT167874.0
FT                   protein_id=mCP90783.0"
FT                   /protein_id="EDL05236.1"
FT                   /translation="MKTPENLEEPSATPNPSRTPTERFVYLEALLEGGAPWGFTLKGGL
FT                   ERGEPLIISKIEEGGKADSVSSGLQAGDEVIHINEVALSSSRREAVSLVKGSYKTLRLV
FT                   VRRDVCAAPGHADPGTSKSLSSELLTCSPQHRKATWSGGVKLRLKQRCSEPATRPHSWH
FT                   TTKFGETQPDVSMMQISQGTMGPPWHQSYHSSSSTSDLSNYDHAYLRRSPDQCSSQGSM
FT                   ESLEPSGGYPPCHLLSPAKSTSSIDQLGHLHNKRDSAYSSFSTSSSIFEYPPPGGSARE
FT                   RSGSMDVISARGGLLEGMRQADIRYVKTVYDTRRGVSSEYEVNPSALLLQGRDAHASAD
FT                   SQGCAKWHSIPRGKGTPSPSWSQQCSGSLETATDNLPQKAGAPLPPTRSDSYAAFRHRE
FT                   RPSSWSSLDQKRFCRPQTNSSGSQKTPFAEDQLHTVPERSPENSPPVKSKHNYTQKAQP
FT                   GQPLLPTGIYPVPSPEPHFAQVPQPSVSSNGTVYPALVKESGYTAAQGTCNKMATLDEN
FT                   GNQNEASRPGFAFCQPLEHNSVTPVEKRPEPTAKYIYKVHFSSVPENEDSSLKRHITPP
FT                   HGHSPYPSERKNIHGGSRACSNHHSLSSPQAQALHVGDDRRPSRLSQPWEGDFQEDHNA
FT                   NLRQKVEREGQGQGLSGNSGRTRSAFSSLQNIPESLRRQSNVELGEAPEVHPGGRSKVE
FT                   DPGRKAGASDIRGYLDRSVSYPRPEGKMNAVDSVHSADSRYEESPAPALPQTSGASQRR
FT                   LSSSSSAAPQYRKPHCSVLEKVSRIEEREQGRHRPLSVGSSAYGPGYRPGRTGPTPSTS
FT                   SSDLDDPKAGSVHFSESTEHLRNGEQNPPNGEAKQEEASRPQCSHLIRRAPADGRGPPA
FT                   RGGEPSRPEARLLRSQSTFQLYSEAEREASWSEDRPGTPESPLLDAPFSRAYRNSIKDA
FT                   QSRVLGATSFRRRDLEPGTPATSRPWRPRPASAHVGMRSPEAAVPSSSPHTPRERHSVT
FT                   PAAPQAARRGPRRRLTVEQKKRSYSEPEKMNEVGVSEEAEPTPCGPPRPAQPRFSESTV
FT                   ADRRRIFERDGKACSTLSLSGPELKQFQQSALADYIQRKTGKRPTGAACTPEAGLRERA
FT                   QSAYLQAGPAAPDGPGLASACSLSSLREPEALPRKEHTHPSAADGPQAPRDRSSSFASG
FT                   RLVGERRRWDPQVPRQLLSGANCEPRGVQRMDGAPGGPPSWGMVAGKAGKSKSAEDLLE
FT                   RSDTLAVPVHVRSRSSPTSDKKGQDVLLREGSNFGFVKDPCCLAGPGPRSLSCSDKGQN
FT                   ELALPLHHPTPCWNGSGCKATVASSAPPESSGAADHLKQRRAPGPRPLSAGMHGHFPDA
FT                   RAASLSSPLPSPVPSSYRSQLAMDQQTGQQPPSSPASAVTQPTSPRSPELSSPAYGLGE
FT                   GMWKRTSLPQRPPPPWVKWAHAVREDGLAEDTLAPEFANLKHYRNQPSRPSSCSTSDPD
FT                   TPGRISLRISESALQPSPPPRGDYDDEVFMKDLHPKVTSSPTFEALPPPPPPSPPSEEP
FT                   LVNGTDDFPPPPPPQALCEVLLDGEASTEAGSGPCRIPRVMVTREGHVPGAAHSEGSQI
FT                   MTATPPQTSAKGSEAESNTPSSASAQPQLNGSPGKQLCPSQTRNLTYEPVERTQDLGKK
FT                   THAEPQKTSEDIRTEALAKEIVHQDKSLADILDPDSRMKTTMDLMEGLFPGDASVLMDS
FT                   GAKRKALDITARRAGCEAKASDHKEAVSVLVNCPAYYSVSAAKAELLNKIKDMPEELQE
FT                   EEGQEDVNEKKAELIGSLTHKLESLQEAKGSLLTDIKLNNALGEEVEALISELCKPNEF
FT                   DKYKMFIGDLDKVVNLLLSLSGRLARVENVLRGLGEDASKEERSSLNEKRKVLAGQHED
FT                   ARELKENLDRRERVVLDILANYLSAEQLQDYQHFVKMKSTLLIEQRKLDDKIKLGQEQV
FT                   RCLLESLPSDFRPKAGAISLPPALTGHGTPGGTSVFGGVFPTLTSPL"
FT   assembly_gap    4665010..4665053
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    4669342..4669361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4676323..4676342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4685008..>4690821)
FT                   /locus_tag="mCG_1041447"
FT                   /note="gene_id=mCG1041447.0"
FT   mRNA            complement(join(4685008..4685533,4690778..>4690821))
FT                   /locus_tag="mCG_1041447"
FT                   /product="mCG1041447"
FT                   /note="gene_id=mCG1041447.0 transcript_id=mCT159151.0
FT                   created on 18-APR-2002"
FT   CDS             complement(join(4685471..4685533,4690778..>4690819))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041447"
FT                   /product="mCG1041447"
FT                   /note="gene_id=mCG1041447.0 transcript_id=mCT159151.0
FT                   protein_id=mCP53120.1"
FT                   /protein_id="EDL05238.1"
FT                   /translation="IQCVSPFKDQCVAQVLVCLVFMNSWIRPRKELLC"
FT   assembly_gap    4697384..4697649
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    4710296..4710327
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4728458..4728477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4744461..4744480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4745655..4745674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4755015..4755034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4756592..4756611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4760358..4760579
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    4764057..4764127
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    4771611..4771630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4777649..4778935
FT                   /estimated_length=1287
FT                   /gap_type="unknown"
FT   assembly_gap    4782463..4782482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4784121..4784140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4785253..4785272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4793177..4793196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4794300..4794319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4798585..4798613
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    4800200..4800237
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    4806416..4806435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4809327..4809346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4813446..>4813683)
FT                   /locus_tag="mCG_1041446"
FT                   /note="gene_id=mCG1041446.0"
FT   mRNA            complement(join(4813446..4813568,4813640..>4813683))
FT                   /locus_tag="mCG_1041446"
FT                   /product="mCG1041446"
FT                   /note="gene_id=mCG1041446.0 transcript_id=mCT159150.0
FT                   created on 28-MAY-2002"
FT   CDS             complement(join(4813459..4813568,4813640..>4813682))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041446"
FT                   /product="mCG1041446"
FT                   /note="gene_id=mCG1041446.0 transcript_id=mCT159150.0
FT                   protein_id=mCP53117.0"
FT                   /protein_id="EDL05237.1"
FT                   /translation="ETGFLCVALAVLELTACLCLPVLGLKAFATTSSFRVVSLLHYFFV
FT                   KNSVI"
FT   assembly_gap    4813569..4813639
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    4838201..4838261
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    4844479..4844498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4853737..4853756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4929992..4930011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4943361..4943569
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    4950043..4950151
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    4956046..4956065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4964759..4964778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4975453..4976147
FT                   /pseudo
FT                   /locus_tag="mCG_8720"
FT                   /note="gene_id=mCG8720.2"
FT   mRNA            4975453..4976147
FT                   /pseudo
FT                   /locus_tag="mCG_8720"
FT                   /note="gene_id=mCG8720.2 transcript_id=mCT7339.2 created on
FT                   12-APR-2002"
FT   assembly_gap    4981048..4981067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4985359..4985378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4988784..4988803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4990368..4990387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4993423..4993442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4994942..4995774
FT                   /estimated_length=833
FT                   /gap_type="unknown"
FT   assembly_gap    4996813..4996832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4997955..4997974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4999278..4999297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5001681..5001700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5003728..5003747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5011177..5015002)
FT                   /locus_tag="mCG_114044"
FT                   /note="gene_id=mCG114044.0"
FT   mRNA            complement(join(5011177..5013260,5014287..5015002))
FT                   /locus_tag="mCG_114044"
FT                   /product="mCG114044"
FT                   /note="gene_id=mCG114044.0 transcript_id=mCT115135.0
FT                   created on 11-APR-2002"
FT   CDS             complement(join(5012624..5013260,5014287..5014906))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114044"
FT                   /product="mCG114044"
FT                   /note="gene_id=mCG114044.0 transcript_id=mCT115135.0
FT                   protein_id=mCP53125.1"
FT                   /protein_id="EDL05235.1"
FT                   /translation="MAGELSQEALLDFLCQAGGRVRNAELLSHFKSFLRDPHVSPGQLQ
FT                   ERRERFKGFVNSVAAVRQDPDGTKYVVLKRRYRDLLGEEGLQRPGPVDGKPRGHRRRDP
FT                   EPQKPPAGAGTQVDVGGSAQKVAGPDPSPEDSPNQRTPEPEAAQARGRCAAVGTRGRCC
FT                   WECQQNGWGQSTGQPLPEDLGDPAVACEKPERAAPARDDLGAPGPSEHRSPLVPLDTRE
FT                   HEWIVRLASGSWLHVLTLFWEDPQLALHRDFLTGYTALHWIAKHGDLCALQDLVSGAQK
FT                   AGIALDVNVRSSCGYTPLHLAAIHGHQGVIKLLVQRLASRVNIRDCSGKKPWQYLNSNV
FT                   SGETWQLLGAPRGKPIFPVYSLVQSSSPARKVKSREVSRNVTRKTSLAALLKTQHNKWK
FT                   LASQYEKIHTSKEREEYSD"
FT   assembly_gap    5026305..5026664
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    5034047..5034066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5036945..5036964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5038686..5038705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5042005..5042024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5043409..5043428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5051141..5051160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5057681..5057700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5064439..5145728
FT                   /gene="Sept11"
FT                   /locus_tag="mCG_8719"
FT                   /note="gene_id=mCG8719.2"
FT   mRNA            join(5064439..5064585,5110307..5110421,5119010..5119205,
FT                   5125749..5125935,5127730..5127891,5132040..5132136,
FT                   5133014..5133182,5136139..5136271,5138390..5138577,
FT                   5142012..5145728)
FT                   /gene="Sept11"
FT                   /locus_tag="mCG_8719"
FT                   /product="septin 11, transcript variant mCT167875"
FT                   /note="gene_id=mCG8719.2 transcript_id=mCT167875.0 created
FT                   on 11-APR-2002"
FT   mRNA            join(5064439..5064585,5110307..5110421,5119010..5119205,
FT                   5125749..5125935,5127730..5127891,5132040..5132136,
FT                   5133014..5133182,5136139..5136271,5138390..5138577,
FT                   5144143..5145728)
FT                   /gene="Sept11"
FT                   /locus_tag="mCG_8719"
FT                   /product="septin 11, transcript variant mCT7338"
FT                   /note="gene_id=mCG8719.2 transcript_id=mCT7338.2 created on
FT                   11-APR-2002"
FT   CDS             join(5064559..5064585,5110307..5110421,5119010..5119205,
FT                   5125749..5125935,5127730..5127891,5132040..5132136,
FT                   5133014..5133182,5136139..5136271,5138390..5138577,
FT                   5144143..5144167)
FT                   /codon_start=1
FT                   /gene="Sept11"
FT                   /locus_tag="mCG_8719"
FT                   /product="septin 11, isoform CRA_b"
FT                   /note="gene_id=mCG8719.2 transcript_id=mCT7338.2
FT                   protein_id=mCP16828.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0J9YUL3"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030379"
FT                   /db_xref="MGI:MGI:1277214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J9YUL3"
FT                   /protein_id="EDL05234.1"
FT                   /translation="MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNIL
FT                   CVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGF
FT                   GDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKS
FT                   LDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVA
FT                   EINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVN
FT                   MEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEE
FT                   MRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKK
FT                   AAAQLLQSQAQQSGAQQTKKDKDKKNSPWLCTE"
FT   CDS             join(5064559..5064585,5110307..5110421,5119010..5119205,
FT                   5125749..5125935,5127730..5127891,5132040..5132136,
FT                   5133014..5133182,5136139..5136271,5138390..5138577,
FT                   5142012..5142027)
FT                   /codon_start=1
FT                   /gene="Sept11"
FT                   /locus_tag="mCG_8719"
FT                   /product="septin 11, isoform CRA_a"
FT                   /note="gene_id=mCG8719.2 transcript_id=mCT167875.0
FT                   protein_id=mCP90784.0 isoform=CRA_a"
FT                   /protein_id="EDL05233.1"
FT                   /translation="MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNIL
FT                   CVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGF
FT                   GDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKS
FT                   LDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVA
FT                   EINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVN
FT                   MEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEE
FT                   MRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKK
FT                   AAAQLLQSQAQQSGAQQTKKDKDKKNASFA"
FT   assembly_gap    5065007..5065275
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    5066194..5066390
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    5122401..5122420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5150927..5153013
FT                   /locus_tag="mCG_1041445"
FT                   /note="gene_id=mCG1041445.2"
FT   mRNA            5150927..5153013
FT                   /locus_tag="mCG_1041445"
FT                   /product="mCG1041445"
FT                   /note="gene_id=mCG1041445.2 transcript_id=mCT159149.2
FT                   created on 16-JUN-2003"
FT   CDS             5151790..5151909
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041445"
FT                   /product="mCG1041445"
FT                   /note="gene_id=mCG1041445.2 transcript_id=mCT159149.2
FT                   protein_id=mCP53115.2"
FT                   /protein_id="EDL05232.1"
FT                   /translation="MSRKIMRTCDFYKNTYLCEANPLHTTLCSWLSQTPSLHT"
FT   gene            complement(5152610..>5177164)
FT                   /gene="Ccni"
FT                   /locus_tag="mCG_8717"
FT                   /note="gene_id=mCG8717.3"
FT   mRNA            complement(join(5152610..5154094,5158261..5158491,
FT                   5158753..5158893,5159820..5159894,5160237..5160365,
FT                   5172974..5173131,5176582..5176910,5176984..5177014))
FT                   /gene="Ccni"
FT                   /locus_tag="mCG_8717"
FT                   /product="cyclin I, transcript variant mCT7336"
FT                   /note="gene_id=mCG8717.3 transcript_id=mCT7336.1 created on
FT                   11-APR-2002"
FT   mRNA            complement(join(5152610..5154094,5158261..5158491,
FT                   5158753..5158893,5159820..5159894,5160237..5160365,
FT                   5172974..5173131,5173936..5174036))
FT                   /gene="Ccni"
FT                   /locus_tag="mCG_8717"
FT                   /product="cyclin I, transcript variant mCT167873"
FT                   /note="gene_id=mCG8717.3 transcript_id=mCT167873.0 created
FT                   on 11-APR-2002"
FT   mRNA            complement(join(5153367..5154094,5158261..5158491,
FT                   5158753..5158893,5159820..5159894,5160237..5160365,
FT                   5172974..5173131,5176582..>5177164))
FT                   /gene="Ccni"
FT                   /locus_tag="mCG_8717"
FT                   /product="cyclin I, transcript variant mCT189815"
FT                   /note="gene_id=mCG8717.3 transcript_id=mCT189815.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(5153651..5154094,5158261..5158491,
FT                   5158753..5158893,5159820..5159894,5160237..5160365,
FT                   5172974..5173131,5176582..>5176636))
FT                   /codon_start=1
FT                   /gene="Ccni"
FT                   /locus_tag="mCG_8717"
FT                   /product="cyclin I, isoform CRA_a"
FT                   /note="gene_id=mCG8717.3 transcript_id=mCT189815.0
FT                   protein_id=mCP110809.0 isoform=CRA_a"
FT                   /protein_id="EDL05229.1"
FT                   /translation="GLQLCRGGGGGGRGGEEEGSYIKLGGRQIQRDTMKFPGPLENQRL
FT                   SSLLERAISREAQMWKVNVPKIPTNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASS
FT                   LLDRFLATVKAHPKYLNCIAISCFFLAAKTVEEDEKIPVLKVLARDSFCGCSSSEILRM
FT                   ERIILDKLNWDLHTATPLDFLHIFHAIAVSARPQLLFSLPKLSPSQHLAVLTKQLLHCM
FT                   ACNQLLQFKGSMLALAMVSLEMEKLIPDWLPLTIELLQKAQMDSSQLIHCRELVAYHLS
FT                   ALQSALPLNSVYVYRPLKHTLVTCDKGAFKLHPSSVSGPDFSKDNSKPEVPVRGPAAFH
FT                   LHLPAASGCKQTSAKRKVEEMEVDDFYDGIKRLYNEDNGPENVGSVCGTDLSRQEGHAS
FT                   PCPPLQPVSVM"
FT   CDS             complement(join(5153651..5154094,5158261..5158491,
FT                   5158753..5158893,5159820..5159894,5160237..5160365,
FT                   5172974..5173087))
FT                   /codon_start=1
FT                   /gene="Ccni"
FT                   /locus_tag="mCG_8717"
FT                   /product="cyclin I, isoform CRA_b"
FT                   /note="gene_id=mCG8717.3 transcript_id=mCT167873.0
FT                   protein_id=mCP90785.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9Z2V9"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028856"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="MGI:MGI:1341077"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2V9"
FT                   /protein_id="EDL05230.1"
FT                   /translation="MKFPGPLENQRLSSLLERAISREAQMWKVNVPKIPTNQNVSPSQR
FT                   DEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLNCIAISCFFLAAKTVEE
FT                   DEKIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLHIFHAIAVSARP
FT                   QLLFSLPKLSPSQHLAVLTKQLLHCMACNQLLQFKGSMLALAMVSLEMEKLIPDWLPLT
FT                   IELLQKAQMDSSQLIHCRELVAYHLSALQSALPLNSVYVYRPLKHTLVTCDKGAFKLHP
FT                   SSVSGPDFSKDNSKPEVPVRGPAAFHLHLPAASGCKQTSAKRKVEEMEVDDFYDGIKRL
FT                   YNEDNGPENVGSVCGTDLSRQEGHASPCPPLQPVSVM"
FT   CDS             complement(join(5153651..5154094,5158261..5158491,
FT                   5158753..5158893,5159820..5159894,5160237..5160365,
FT                   5172974..5173087))
FT                   /codon_start=1
FT                   /gene="Ccni"
FT                   /locus_tag="mCG_8717"
FT                   /product="cyclin I, isoform CRA_b"
FT                   /note="gene_id=mCG8717.3 transcript_id=mCT7336.1
FT                   protein_id=mCP16831.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9Z2V9"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028856"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="MGI:MGI:1341077"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2V9"
FT                   /protein_id="EDL05231.1"
FT                   /translation="MKFPGPLENQRLSSLLERAISREAQMWKVNVPKIPTNQNVSPSQR
FT                   DEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLNCIAISCFFLAAKTVEE
FT                   DEKIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLHIFHAIAVSARP
FT                   QLLFSLPKLSPSQHLAVLTKQLLHCMACNQLLQFKGSMLALAMVSLEMEKLIPDWLPLT
FT                   IELLQKAQMDSSQLIHCRELVAYHLSALQSALPLNSVYVYRPLKHTLVTCDKGAFKLHP
FT                   SSVSGPDFSKDNSKPEVPVRGPAAFHLHLPAASGCKQTSAKRKVEEMEVDDFYDGIKRL
FT                   YNEDNGPENVGSVCGTDLSRQEGHASPCPPLQPVSVM"
FT   gene            5177182..5184262
FT                   /locus_tag="mCG_1041431"
FT                   /note="gene_id=mCG1041431.0"
FT   mRNA            join(5177182..5177391,5178767..5178862,5183878..5184262)
FT                   /locus_tag="mCG_1041431"
FT                   /product="mCG1041431"
FT                   /note="gene_id=mCG1041431.0 transcript_id=mCT159135.0
FT                   created on 11-APR-2002"
FT   CDS             join(5177348..5177391,5178767..5178862,5183878..5184097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041431"
FT                   /product="mCG1041431"
FT                   /note="gene_id=mCG1041431.0 transcript_id=mCT159135.0
FT                   protein_id=mCP53044.1"
FT                   /db_xref="GOA:Q9D875"
FT                   /db_xref="MGI:MGI:1922860"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D875"
FT                   /protein_id="EDL05228.1"
FT                   /translation="MKRESAFCVHKEKESLKSMAFLHNLSWHNYCDTVESFLPLISSRK
FT                   TGIKFLSESLKIMLDIERKKIASEICGERNQSVCENNSPPPQISDVLYHVSWRWPLIDF
FT                   YWSTETITQEVTAHV"
FT   assembly_gap    5192002..5192021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5199708..5199727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5200960..5200979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5239599..5248568
FT                   /gene="Ccng2"
FT                   /locus_tag="mCG_8716"
FT                   /note="gene_id=mCG8716.3"
FT   mRNA            join(5239599..5240142,5240969..5241106,5241612..5241749,
FT                   5243147..5243397,5243554..5243632,5243716..5243814,
FT                   5245688..5245893,5247218..5248568)
FT                   /gene="Ccng2"
FT                   /locus_tag="mCG_8716"
FT                   /product="cyclin G2, transcript variant mCT7335"
FT                   /note="gene_id=mCG8716.3 transcript_id=mCT7335.3 created on
FT                   11-JUN-2003"
FT   mRNA            join(5239599..5240142,5240969..5241106,5241612..5241749,
FT                   5241847..5242063)
FT                   /gene="Ccng2"
FT                   /locus_tag="mCG_8716"
FT                   /product="cyclin G2, transcript variant mCT167872"
FT                   /note="gene_id=mCG8716.3 transcript_id=mCT167872.1 created
FT                   on 11-JUN-2003"
FT   mRNA            join(<5240047..5240142,5240969..5241106,5241612..5241749,
FT                   5243147..5245893,5247218..5248568)
FT                   /gene="Ccng2"
FT                   /locus_tag="mCG_8716"
FT                   /product="cyclin G2, transcript variant mCT189814"
FT                   /note="gene_id=mCG8716.3 transcript_id=mCT189814.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5240068..5240142,5240969..5241106,5241612..5241749,
FT                   5243147..5243401)
FT                   /codon_start=1
FT                   /gene="Ccng2"
FT                   /locus_tag="mCG_8716"
FT                   /product="cyclin G2, isoform CRA_b"
FT                   /note="gene_id=mCG8716.3 transcript_id=mCT189814.0
FT                   protein_id=mCP110808.0 isoform=CRA_b"
FT                   /protein_id="EDL05226.1"
FT                   /translation="GGWSLSSETGPDAPAAPVRDAGADTMKDLGAKHLAGGEGVQLFGL
FT                   LNFYLEQEQRYQPREKGLILMEATPENDNTLCSRLRNAKVEDLRSLTNFFGSGTETFVL
FT                   AVNILDRFLALMKVKPKHLSCIGVCCFLLAARLAEEEGDVPPTHDVIRISQCKCTASDI
FT                   KRMEKIISEKLHYELEATTALNFLHLYHAIVFCHTSER"
FT   CDS             join(5240969..5241106,5241612..5241749,5243147..5243397,
FT                   5243554..5243632,5243716..5243814,5245688..5245893,
FT                   5247218..5247341)
FT                   /codon_start=1
FT                   /gene="Ccng2"
FT                   /locus_tag="mCG_8716"
FT                   /product="cyclin G2, isoform CRA_c"
FT                   /note="gene_id=mCG8716.3 transcript_id=mCT7335.3
FT                   protein_id=mCP16830.3 isoform=CRA_c"
FT                   /db_xref="GOA:Q5HZK4"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028895"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="MGI:MGI:1095734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5HZK4"
FT                   /protein_id="EDL05227.1"
FT                   /translation="MKDLGAKHLAGGEGVQLFGLLNFYLEQEQRYQPREKGLILMEATP
FT                   ENDNTLCSRLRNAKVEDLRSLTNFFGSGTETFVLAVNILDRFLALMKVKPKHLSCIGVC
FT                   CFLLAARLAEEEGDVPPTHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLH
FT                   LYHAIVFCHTSERKEILSLDKLEAQLKACNCRVVFSKARPSVLALCLLNLEIETIKSVE
FT                   LLEILLLVKKHLKLSDTEFFYWRELVSKCLAEYSSPRCCKPDLKKLVWIVSRRTAQNLH
FT                   SSYYSVPELPTIPEGGCFDGSESEDSGEDMSCGEESLSSSPPSDQECTFFFDFQVAQTL
FT                   CFPP"
FT   CDS             join(5240969..5241106,5241612..5241749,5241847..5241852)
FT                   /codon_start=1
FT                   /gene="Ccng2"
FT                   /locus_tag="mCG_8716"
FT                   /product="cyclin G2, isoform CRA_a"
FT                   /note="gene_id=mCG8716.3 transcript_id=mCT167872.1
FT                   protein_id=mCP90786.1 isoform=CRA_a"
FT                   /protein_id="EDL05225.1"
FT                   /translation="MKDLGAKHLAGGEGVQLFGLLNFYLEQEQRYQPREKGLILMEATP
FT                   ENDNTLCSRLRNAKVEDLRSLTNFFGSGTETFVLAVNILDRFLALMKL"
FT   assembly_gap    5281975..5284932
FT                   /estimated_length=2958
FT                   /gap_type="unknown"
FT   assembly_gap    5288227..5288246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5332958..5332977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5340113..5340302
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   gene            complement(5344079..>5347852)
FT                   /locus_tag="mCG_114052"
FT                   /note="gene_id=mCG114052.1"
FT   mRNA            complement(join(5344079..5344610,5346622..5347213,
FT                   5347678..>5347852))
FT                   /locus_tag="mCG_114052"
FT                   /product="mCG114052"
FT                   /note="gene_id=mCG114052.1 transcript_id=mCT115146.1
FT                   created on 11-APR-2002"
FT   CDS             complement(join(5344085..5344610,5346622..>5346755))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114052"
FT                   /product="mCG114052"
FT                   /note="gene_id=mCG114052.1 transcript_id=mCT115146.1
FT                   protein_id=mCP53073.1"
FT                   /protein_id="EDL05224.1"
FT                   /translation="PNRTRVTEVKCINTFTSQFSKFNCLQHLFMFCIHFLRFQMNQVLG
FT                   CLMTPLKTLSITYSLISQRDLDSFACCQSLFQLKHLELRGVVLLDLDLMHLRGLLMKVA
FT                   GTLETLDLQGCRMKDSQLSVLLPAFKQCSQISNVNYYNNDFSTPFLKDLLQHTANWSKM
FT                   NVEQYPAPLECYDEFPQVSVERFAQLCQDLMDTLRAIRQPKTSYFATDICHTCGEC"
FT   assembly_gap    5344829..5345260
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    5347875..5347894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5350295..5353017
FT                   /estimated_length=2723
FT                   /gap_type="unknown"
FT   gene            complement(5356699..>5359457)
FT                   /locus_tag="mCG_4405"
FT                   /note="gene_id=mCG4405.2"
FT   mRNA            complement(5356699..>5359457)
FT                   /locus_tag="mCG_4405"
FT                   /product="mCG4405"
FT                   /note="gene_id=mCG4405.2 transcript_id=mCT3456.2 created on
FT                   11-APR-2002"
FT   CDS             complement(5357016..5359457)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4405"
FT                   /product="mCG4405"
FT                   /note="gene_id=mCG4405.2 transcript_id=mCT3456.2
FT                   protein_id=mCP9525.1"
FT                   /protein_id="EDL05223.1"
FT                   /translation="MVEAGRAGPPALPPAPPHGSPWTLATTAGSSASCGPATTVAAAGM
FT                   SKGPGGGDSAWIAEKKAQLHSAPLAKKLEKLSVYSACKAEESCKCNGWKNPNPSPIPPR
FT                   GDLQQLIVNLTESCRSCSHALDAHVSHLDNVSEEEMNRLLGIVVDVEYLLTCVHKEDDA
FT                   DTKQVYFYLFKLLRRSVLQRGKPVVEGFLEKKPPFEQPSIEQGVNNFVQYKFSHLPSKE
FT                   RQTTIQLAKMFLNRINYWHLEAPSQRRLQAPNDDISGYKENYTRWLCYCNVPQFCDSLP
FT                   RYETTKVFGRTLLRSIFTIMRRQLLEQARQEKDKLPLEERTLILTHFPKFLYMLEEEVY
FT                   SQNSPIWDQDFLSASSRTSSLGIQTVVCPPVTRKALFSSNSTSHEQINGGRTSPGCRSS
FT                   SGLEANPGKKRKMNNSHVPKETKRSRVMGDIPVELINEVMSTITDPAGMLGPETNFLSA
FT                   LSARDEAARLEERRGVIEFHVVSNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITR
FT                   LVFDPKHKTLALIKDGRVIGGICFQMFPSQGFTEIVFCAVTSEEQVKGYGTHLMNHLKE
FT                   YHVKHEILNFLTYADDHAIGYFKKQGFSKEIKIPKTKYAGYIKDYEGATLMGCELNPHI
FT                   PYTEFSVIIKKQKEITKKLTERKQAQIGKVYPGLSCFKDGVRQIPIESIPGIRETGWKP
FT                   SRKEKSKEPKDPEQLYSTLKNILQQVKSHQSAWPFLEPVKRTEAPGYYEVIRFPMDLKT
FT                   MSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEVYKCASILEKFFFSKIKEAGLID
FT                   K"
FT   assembly_gap    5366434..5366661
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    5367585..5368011
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    5371864..5373448
FT                   /estimated_length=1585
FT                   /gap_type="unknown"
FT   assembly_gap    5374514..5375068
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   gene            5375216..5388959
FT                   /pseudo
FT                   /locus_tag="mCG_114048"
FT                   /note="gene_id=mCG114048.2"
FT   mRNA            join(5375216..5375290,5376225..5376437,5376892..5377482,
FT                   5388389..5388959)
FT                   /pseudo
FT                   /locus_tag="mCG_114048"
FT                   /note="gene_id=mCG114048.2 transcript_id=mCT115142.2
FT                   created on 11-JUN-2004"
FT   assembly_gap    5381889..5381925
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    5386023..5386042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5394991..5395820
FT                   /estimated_length=830
FT                   /gap_type="unknown"
FT   assembly_gap    5406001..5406020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5407124..5407143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5408410..5408429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5415085..5415104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5417122..5417141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5420168..5420653
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    5421981..5422000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5423204..5423278
FT                   /estimated_length=75
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01046561.1:1..1943),gap(20),
CO   complement(AAHY01046562.1:1..44870),gap(518),
CO   complement(AAHY01046563.1:1..2087),gap(1062),
CO   complement(AAHY01046564.1:1..986),gap(415),
CO   complement(AAHY01046565.1:1..88170),gap(20),
CO   complement(AAHY01046566.1:1..2626),gap(20),
CO   complement(AAHY01046567.1:1..3911),gap(20),
CO   complement(AAHY01046568.1:1..3344),gap(1017),AAHY01046569.1:1..3019,
CO   gap(21),complement(AAHY01046570.1:1..58849),gap(20),
CO   complement(AAHY01046571.1:1..17467),gap(1746),
CO   complement(AAHY01046572.1:1..1656),gap(1169),
CO   complement(AAHY01046573.1:1..19596),gap(20),
CO   complement(AAHY01046574.1:1..41389),gap(58),
CO   complement(AAHY01046575.1:1..1785),gap(20),
CO   complement(AAHY01046576.1:1..6975),gap(370),
CO   complement(AAHY01046577.1:1..1158),gap(1407),
CO   complement(AAHY01046578.1:1..25718),gap(273),
CO   complement(AAHY01046579.1:1..44652),gap(9760),
CO   complement(AAHY01046580.1:1..1451),gap(20),
CO   complement(AAHY01046581.1:1..2162),gap(20),
CO   complement(AAHY01046582.1:1..1026),gap(20),AAHY01046583.1:1..1339,gap(20),
CO   complement(AAHY01046584.1:1..1184),gap(20),AAHY01046585.1:1..1021,gap(20),
CO   AAHY01046586.1:1..1928,gap(20),complement(AAHY01046587.1:1..5442),gap(557),
CO   complement(AAHY01046588.1:1..2288),gap(20),
CO   complement(AAHY01046589.1:1..1568),gap(20),
CO   complement(AAHY01046590.1:1..1382),gap(20),
CO   complement(AAHY01046591.1:1..1775),gap(1371),
CO   complement(AAHY01046592.1:1..2220),gap(826),AAHY01046593.1:1..16381,
CO   gap(145),complement(AAHY01046594.1:1..9162),gap(349),
CO   AAHY01046595.1:1..54374,gap(368),AAHY01046596.1:1..11593,gap(20),
CO   AAHY01046597.1:1..3918,gap(6122),complement(AAHY01046598.1:1..5477),
CO   gap(20),complement(AAHY01046599.1:1..6186),gap(1214),
CO   complement(AAHY01046600.1:1..1604),gap(1481),AAHY01046601.1:1..5233,
CO   gap(99),complement(AAHY01046602.1:1..22762),gap(20),
CO   complement(AAHY01046603.1:1..7556),gap(82),
CO   complement(AAHY01046604.1:1..5004),gap(461),
CO   complement(AAHY01046605.1:1..11227),gap(82),
CO   complement(AAHY01046606.1:1..14512),gap(41),
CO   complement(AAHY01046607.1:1..40609),gap(213),
CO   complement(AAHY01046608.1:1..5933),gap(391),
CO   complement(AAHY01046609.1:1..29228),gap(160),
CO   complement(AAHY01046610.1:1..38665),gap(413),
CO   complement(AAHY01046611.1:1..49921),gap(217),
CO   complement(AAHY01046612.1:1..15595),gap(20),
CO   complement(AAHY01046613.1:1..24701),gap(20),
CO   complement(AAHY01046614.1:1..20066),gap(352),
CO   complement(AAHY01046615.1:1..8097),gap(3833),
CO   complement(AAHY01046616.1:1..9494),gap(20),AAHY01046617.1:1..3895,
CO   gap(4805),complement(AAHY01046618.1:1..7473),gap(20),
CO   complement(AAHY01046619.1:1..17370),gap(20),
CO   complement(AAHY01046620.1:1..1916),gap(292),
CO   complement(AAHY01046621.1:1..3132),gap(145),
CO   complement(AAHY01046622.1:1..29191),gap(184),
CO   complement(AAHY01046623.1:1..26280),gap(20),
CO   complement(AAHY01046624.1:1..1817),gap(20),
CO   complement(AAHY01046625.1:1..8936),gap(617),
CO   complement(AAHY01046626.1:1..14121),gap(20),
CO   complement(AAHY01046627.1:1..13801),gap(29),AAHY01046628.1:1..61692,
CO   gap(427),AAHY01046629.1:1..1391,gap(60),AAHY01046630.1:1..1315,gap(367),
CO   AAHY01046631.1:1..25776,gap(109),complement(AAHY01046632.1:1..2851),
CO   gap(809),complement(AAHY01046633.1:1..19365),gap(168),
CO   complement(AAHY01046634.1:1..42370),gap(201),
CO   complement(AAHY01046635.1:1..38851),gap(25),AAHY01046636.1:1..42722,
CO   gap(20),complement(AAHY01046637.1:1..12774),gap(351),
CO   complement(AAHY01046638.1:1..28453),gap(3340),
CO   complement(AAHY01046639.1:1..4554),gap(1898),
CO   complement(AAHY01046640.1:1..342),gap(20),
CO   complement(AAHY01046641.1:1..8230),gap(824),AAHY01046642.1:1..1120,
CO   gap(1939),complement(AAHY01046643.1:1..4145),gap(20),
CO   complement(AAHY01046644.1:1..31043),gap(1585),
CO   complement(AAHY01046645.1:1..16616),gap(20),
CO   complement(AAHY01046646.1:1..1243),gap(456),AAHY01046647.1:1..2152,
CO   gap(657),AAHY01046648.1:1..2805,gap(20),complement(AAHY01046649.1:1..4482),
CO   gap(285),complement(AAHY01046650.1:1..2015),gap(1970),
CO   AAHY01046651.1:1..5799,gap(314),complement(AAHY01046652.1:1..20631),
CO   gap(6675),complement(AAHY01046653.1:1..24985),gap(203),
CO   AAHY01046654.1:1..24051,gap(20),complement(AAHY01046655.1:1..7296),gap(20),
CO   complement(AAHY01046656.1:1..10337),gap(20),AAHY01046657.1:1..8123,gap(20),
CO   complement(AAHY01046658.1:1..1961),gap(1666),
CO   complement(AAHY01046659.1:1..11814),gap(1449),AAHY01046660.1:1..4185,
CO   gap(20),AAHY01046661.1:1..740,gap(223),complement(AAHY01046662.1:1..3983),
CO   gap(110),complement(AAHY01046663.1:1..30288),gap(20),
CO   complement(AAHY01046664.1:1..48690),gap(20),
CO   complement(AAHY01046665.1:1..2277),gap(683),
CO   complement(AAHY01046666.1:1..42241),gap(189),
CO   complement(AAHY01046667.1:1..4069),gap(430),
CO   complement(AAHY01046668.1:1..45681),gap(20),
CO   complement(AAHY01046669.1:1..94201),gap(20),AAHY01046670.1:1..1748,
CO   gap(2473),complement(AAHY01046671.1:1..1154),gap(20),
CO   AAHY01046672.1:1..17734,gap(20),AAHY01046673.1:1..2609,gap(20),
CO   AAHY01046674.1:1..2851,gap(20),AAHY01046675.1:1..831,gap(2879),
CO   complement(AAHY01046676.1:1..1753),gap(20),AAHY01046677.1:1..1735,gap(20),
CO   complement(AAHY01046678.1:1..19923),gap(84),AAHY01046679.1:1..2923,gap(20),
CO   complement(AAHY01046680.1:1..1279),gap(298),
CO   complement(AAHY01046681.1:1..25230),gap(59),
CO   complement(AAHY01046682.1:1..35676),gap(80),
CO   complement(AAHY01046683.1:1..37719),gap(1961),
CO   complement(AAHY01046684.1:1..8750),gap(3967),
CO   complement(AAHY01046685.1:1..15365),gap(788),
CO   complement(AAHY01046686.1:1..6456),gap(158),
CO   complement(AAHY01046687.1:1..14011),gap(706),
CO   complement(AAHY01046688.1:1..23081),gap(20),
CO   complement(AAHY01046689.1:1..8970),gap(20),
CO   complement(AAHY01046690.1:1..1014),gap(20),AAHY01046691.1:1..8400,gap(20),
CO   complement(AAHY01046692.1:1..1723),gap(20),
CO   complement(AAHY01046693.1:1..13100),gap(858),
CO   complement(AAHY01046694.1:1..2577),gap(34),
CO   complement(AAHY01046695.1:1..4537),gap(20),
CO   complement(AAHY01046696.1:1..1076),gap(20),
CO   complement(AAHY01046697.1:1..1676),gap(20),AAHY01046698.1:1..1171,gap(20),
CO   complement(AAHY01046699.1:1..1393),gap(20),AAHY01046700.1:1..1375,gap(20),
CO   complement(AAHY01046701.1:1..3937),gap(2562),
CO   complement(AAHY01046702.1:1..13062),gap(20),
CO   complement(AAHY01046703.1:1..8553),gap(3956),
CO   complement(AAHY01046704.1:1..8749),gap(72),
CO   complement(AAHY01046705.1:1..10131),gap(33),
CO   complement(AAHY01046706.1:1..16576),gap(84),
CO   complement(AAHY01046707.1:1..1261),gap(89),
CO   complement(AAHY01046708.1:1..2934),gap(20),
CO   complement(AAHY01046709.1:1..8325),gap(71),
CO   complement(AAHY01046710.1:1..16112),gap(20),
CO   complement(AAHY01046711.1:1..5807),gap(69),
CO   complement(AAHY01046712.1:1..6558),gap(20),
CO   complement(AAHY01046713.1:1..5906),gap(20),
CO   complement(AAHY01046714.1:1..1567),gap(20),
CO   complement(AAHY01046715.1:1..1029),gap(1787),
CO   complement(AAHY01046716.1:1..2583),gap(20),
CO   complement(AAHY01046717.1:1..9981),gap(286),
CO   complement(AAHY01046718.1:1..3486),gap(162),
CO   complement(AAHY01046719.1:1..2535),gap(770),
CO   complement(AAHY01046720.1:1..45997),gap(20),
CO   complement(AAHY01046721.1:1..8416),gap(20),AAHY01046722.1:1..1060,gap(20),
CO   AAHY01046723.1:1..7550,gap(20),AAHY01046724.1:1..66944,gap(232),
CO   complement(AAHY01046725.1:1..32611),gap(20),
CO   complement(AAHY01046726.1:1..12210),gap(20),AAHY01046727.1:1..8655,
CO   gap(544),AAHY01046728.1:1..1695,gap(20),AAHY01046729.1:1..22300,gap(80),
CO   complement(AAHY01046730.1:1..25830),gap(1094),AAHY01046731.1:1..6549,
CO   gap(20),complement(AAHY01046732.1:1..1817),gap(20),AAHY01046733.1:1..12703,
CO   gap(20),complement(AAHY01046734.1:1..58271),gap(450),
CO   complement(AAHY01046735.1:1..3471),gap(392),
CO   complement(AAHY01046736.1:1..31299),gap(191),AAHY01046737.1:1..17014,
CO   gap(20),complement(AAHY01046738.1:1..7151),gap(65),
CO   complement(AAHY01046739.1:1..3754),gap(491),
CO   complement(AAHY01046740.1:1..68190),gap(393),
CO   complement(AAHY01046741.1:1..13430),gap(20),
CO   complement(AAHY01046742.1:1..44122),gap(20),AAHY01046743.1:1..8046,gap(20),
CO   complement(AAHY01046744.1:1..20119),gap(20),
CO   complement(AAHY01046745.1:1..45364),gap(20),
CO   complement(AAHY01046746.1:1..21032),gap(438),
CO   complement(AAHY01046747.1:1..534),gap(20),
CO   complement(AAHY01046748.1:1..2723),gap(35),
CO   complement(AAHY01046749.1:1..1168),gap(548),AAHY01046750.1:1..939,
CO   gap(3381),complement(AAHY01046751.1:1..7664),gap(651),
CO   complement(AAHY01046752.1:1..8373),gap(20),
CO   complement(AAHY01046753.1:1..9161),gap(20),
CO   complement(AAHY01046754.1:1..30929),gap(640),
CO   complement(AAHY01046755.1:1..31429),gap(2865),
CO   complement(AAHY01046756.1:1..25792),gap(309),
CO   complement(AAHY01046757.1:1..9740),gap(189),AAHY01046758.1:1..10520,
CO   gap(20),complement(AAHY01046759.1:1..17587),gap(5351),
CO   AAHY01046760.1:1..3391,gap(163),AAHY01046761.1:1..19572,gap(20),
CO   AAHY01046762.1:1..6011,gap(20),complement(AAHY01046763.1:1..4639),gap(230),
CO   complement(AAHY01046764.1:1..20622),gap(666),
CO   complement(AAHY01046765.1:1..1836),gap(20),
CO   complement(AAHY01046766.1:1..1404),gap(20),
CO   complement(AAHY01046767.1:1..2691),gap(20),AAHY01046768.1:1..1020,gap(20),
CO   complement(AAHY01046769.1:1..2688),gap(20),
CO   complement(AAHY01046770.1:1..5076),gap(1440),
CO   complement(AAHY01046771.1:1..1950),gap(20),AAHY01046772.1:1..38176,gap(20),
CO   complement(AAHY01046773.1:1..11962),gap(20),
CO   complement(AAHY01046774.1:1..18391),gap(524),
CO   complement(AAHY01046775.1:1..32957),gap(354),
CO   complement(AAHY01046776.1:1..11728),gap(268),
CO   complement(AAHY01046777.1:1..19168),gap(212),
CO   complement(AAHY01046778.1:1..40661),gap(20),
CO   complement(AAHY01046779.1:1..16073),gap(44),
CO   complement(AAHY01046780.1:1..90598),gap(20),
CO   complement(AAHY01046781.1:1..2698),gap(38),AAHY01046782.1:1..2229,gap(20),
CO   complement(AAHY01046783.1:1..7109),gap(131),
CO   complement(AAHY01046784.1:1..25484),gap(29),
CO   complement(AAHY01046785.1:1..11236),gap(135),AAHY01046786.1:1..1774,
CO   gap(20),complement(AAHY01046787.1:1..16278),gap(3993),
CO   complement(AAHY01046788.1:1..13995),gap(20),
CO   complement(AAHY01046789.1:1..17153),gap(377),
CO   complement(AAHY01046790.1:1..25912),gap(43),
CO   complement(AAHY01046791.1:1..866),gap(336),
CO   complement(AAHY01046792.1:1..5938),gap(20),
CO   complement(AAHY01046793.1:1..24370),gap(91),AAHY01046794.1:1..1236,gap(69),
CO   complement(AAHY01046795.1:1..13146),gap(126),
CO   complement(AAHY01046796.1:1..16254),gap(317),
CO   complement(AAHY01046797.1:1..19056),gap(122),AAHY01046798.1:1..19587,
CO   gap(70),complement(AAHY01046799.1:1..50023),gap(20),
CO   complement(AAHY01046800.1:1..22283),gap(20),
CO   complement(AAHY01046801.1:1..10959),gap(20),
CO   complement(AAHY01046802.1:1..3675),gap(201),
CO   complement(AAHY01046803.1:1..9345),gap(3974),
CO   complement(AAHY01046804.1:1..7951),gap(373),
CO   complement(AAHY01046805.1:1..364),gap(415),
CO   complement(AAHY01046806.1:1..1491),gap(46),
CO   complement(AAHY01046807.1:1..2510),gap(20),
CO   complement(AAHY01046808.1:1..30549),gap(573),
CO   complement(AAHY01046809.1:1..36351),gap(56),AAHY01046810.1:1..2638,
CO   gap(1224),AAHY01046811.1:1..3886,gap(440),
CO   complement(AAHY01046812.1:1..4555),gap(552),
CO   complement(AAHY01046813.1:1..9141),gap(355),
CO   complement(AAHY01046814.1:1..27879),gap(20),
CO   complement(AAHY01046815.1:1..9546),gap(89),
CO   complement(AAHY01046816.1:1..7996),gap(992),
CO   complement(AAHY01046817.1:1..12226),gap(253),AAHY01046818.1:1..6762,
CO   gap(20),complement(AAHY01046819.1:1..4651),gap(20),
CO   complement(AAHY01046820.1:1..29977),gap(249),AAHY01046821.1:1..2447,
CO   gap(956),complement(AAHY01046822.1:1..28353),gap(435),
CO   AAHY01046823.1:1..4055,gap(20),complement(AAHY01046824.1:1..1951),
CO   gap(4418),complement(AAHY01046825.1:1..8396),gap(20),
CO   AAHY01046826.1:1..1111,gap(134),AAHY01046827.1:1..1659,gap(355),
CO   AAHY01046828.1:1..4329,gap(20),complement(AAHY01046829.1:1..7094),
CO   gap(1603),complement(AAHY01046830.1:1..24616),gap(2398),
CO   complement(AAHY01046831.1:1..2888),gap(20),
CO   complement(AAHY01046832.1:1..1189),gap(20),
CO   complement(AAHY01046833.1:1..8835),gap(103),
CO   complement(AAHY01046834.1:1..11429),gap(841),
CO   complement(AAHY01046835.1:1..27024),gap(20),AAHY01046836.1:1..50587,
CO   gap(249),complement(AAHY01046837.1:1..26382),gap(35),
CO   complement(AAHY01046838.1:1..51020),gap(312),AAHY01046839.1:1..19840,
CO   gap(215),AAHY01046840.1:1..2167,gap(131),AAHY01046841.1:1..38871,gap(68),
CO   AAHY01046842.1:1..6127,gap(20),AAHY01046843.1:1..2120,gap(553),
CO   complement(AAHY01046844.1:1..1918),gap(20),
CO   complement(AAHY01046845.1:1..6075),gap(134),
CO   complement(AAHY01046846.1:1..2822),gap(740),AAHY01046847.1:1..3159,
CO   gap(196),complement(AAHY01046848.1:1..8717),gap(621),
CO   AAHY01046849.1:1..4140,gap(60),complement(AAHY01046850.1:1..1994),gap(173),
CO   AAHY01046851.1:1..4078,gap(42),AAHY01046852.1:1..1013,gap(368),
CO   complement(AAHY01046853.1:1..5652),gap(135),
CO   complement(AAHY01046854.1:1..12977),gap(3571),
CO   complement(AAHY01046855.1:1..1497),gap(20),AAHY01046856.1:1..1684,gap(20),
CO   complement(AAHY01046857.1:1..1800),gap(20),AAHY01046858.1:1..2510,gap(20),
CO   complement(AAHY01046859.1:1..5130),gap(20),AAHY01046860.1:1..1937,gap(20),
CO   complement(AAHY01046861.1:1..3081),gap(530),
CO   complement(AAHY01046862.1:1..1147),gap(20),AAHY01046863.1:1..1002,gap(20),
CO   AAHY01046864.1:1..1026,gap(2635),complement(AAHY01046865.1:1..14257),
CO   gap(20),complement(AAHY01046866.1:1..6871),gap(304),
CO   complement(AAHY01046867.1:1..20962),gap(589),
CO   complement(AAHY01046868.1:1..23052),gap(20),AAHY01046869.1:1..8172,
CO   gap(126),complement(AAHY01046870.1:1..3426),gap(189),
CO   AAHY01046871.1:1..4254,gap(20),complement(AAHY01046872.1:1..5711),
CO   gap(6596),complement(AAHY01046873.1:1..55043),gap(20),
CO   complement(AAHY01046874.1:1..5845),gap(100),AAHY01046875.1:1..3800,gap(20),
CO   complement(AAHY01046876.1:1..12771),gap(20),
CO   complement(AAHY01046877.1:1..1029),gap(20),
CO   complement(AAHY01046878.1:1..1008),gap(20),
CO   complement(AAHY01046879.1:1..1531),gap(1689),
CO   complement(AAHY01046880.1:1..6217),gap(20),
CO   complement(AAHY01046881.1:1..20100),gap(117),AAHY01046882.1:1..1564,
CO   gap(344),complement(AAHY01046883.1:1..7716),gap(2106),
CO   complement(AAHY01046884.1:1..2318),gap(20),
CO   complement(AAHY01046885.1:1..8398),gap(14101),
CO   complement(AAHY01046886.1:1..12934),gap(39),
CO   complement(AAHY01046887.1:1..12623),gap(20),AAHY01046888.1:1..14643,
CO   gap(162),complement(AAHY01046889.1:1..12250),gap(213),
CO   complement(AAHY01046890.1:1..13643),gap(1222),
CO   complement(AAHY01046891.1:1..7917),gap(3436),
CO   complement(AAHY01046892.1:1..8445),gap(20),
CO   complement(AAHY01046893.1:1..6170),gap(20),AAHY01046894.1:1..1190,gap(990),
CO   AAHY01046895.1:1..1291,gap(284),complement(AAHY01046896.1:1..1907),
CO   gap(214),complement(AAHY01046897.1:1..3608),gap(20),
CO   complement(AAHY01046898.1:1..9288),gap(816),
CO   complement(AAHY01046899.1:1..5832),gap(667),
CO   complement(AAHY01046900.1:1..35326),gap(44),AAHY01046901.1:1..4288,gap(20),
CO   AAHY01046902.1:1..6961,gap(20),complement(AAHY01046903.1:1..21041),
CO   gap(266),complement(AAHY01046904.1:1..12646),gap(32),
CO   complement(AAHY01046905.1:1..18130),gap(20),
CO   complement(AAHY01046906.1:1..15983),gap(20),AAHY01046907.1:1..1174,gap(20),
CO   complement(AAHY01046908.1:1..9340),gap(20),
CO   complement(AAHY01046909.1:1..1557),gap(20),
CO   complement(AAHY01046910.1:1..3746),gap(222),
CO   complement(AAHY01046911.1:1..3477),gap(71),
CO   complement(AAHY01046912.1:1..7483),gap(20),
CO   complement(AAHY01046913.1:1..6018),gap(1287),
CO   complement(AAHY01046914.1:1..3527),gap(20),
CO   complement(AAHY01046915.1:1..1638),gap(20),
CO   complement(AAHY01046916.1:1..1112),gap(20),AAHY01046917.1:1..7904,gap(20),
CO   complement(AAHY01046918.1:1..1103),gap(20),AAHY01046919.1:1..4265,gap(29),
CO   complement(AAHY01046920.1:1..1586),gap(38),AAHY01046921.1:1..6178,gap(20),
CO   AAHY01046922.1:1..2891,gap(20),complement(AAHY01046923.1:1..4222),gap(71),
CO   complement(AAHY01046924.1:1..24561),gap(61),
CO   complement(AAHY01046925.1:1..6217),gap(20),
CO   complement(AAHY01046926.1:1..9238),gap(20),AAHY01046927.1:1..76235,gap(20),
CO   complement(AAHY01046928.1:1..13349),gap(209),
CO   complement(AAHY01046929.1:1..6473),gap(109),
CO   complement(AAHY01046930.1:1..5894),gap(20),
CO   complement(AAHY01046931.1:1..8693),gap(20),
CO   complement(AAHY01046932.1:1..16269),gap(20),AAHY01046933.1:1..4291,gap(20),
CO   complement(AAHY01046934.1:1..3405),gap(20),
CO   complement(AAHY01046935.1:1..1564),gap(20),
CO   complement(AAHY01046936.1:1..3035),gap(20),
CO   complement(AAHY01046937.1:1..1499),gap(833),
CO   complement(AAHY01046938.1:1..1038),gap(20),AAHY01046939.1:1..1122,gap(20),
CO   complement(AAHY01046940.1:1..1303),gap(20),AAHY01046941.1:1..2383,gap(20),
CO   AAHY01046942.1:1..2027,gap(20),complement(AAHY01046943.1:1..22557),
CO   gap(360),complement(AAHY01046944.1:1..7382),gap(20),AAHY01046945.1:1..2878,
CO   gap(20),AAHY01046946.1:1..1721,gap(20),AAHY01046947.1:1..3299,gap(20),
CO   complement(AAHY01046948.1:1..1384),gap(20),
CO   complement(AAHY01046949.1:1..7712),gap(20),
CO   complement(AAHY01046950.1:1..6520),gap(20),
CO   complement(AAHY01046951.1:1..7306),gap(269),
CO   complement(AAHY01046952.1:1..918),gap(197),
CO   complement(AAHY01046953.1:1..56010),gap(20),
CO   complement(AAHY01046954.1:1..69581),gap(20),AAHY01046955.1:1..7686,gap(20),
CO   complement(AAHY01046956.1:1..1232),gap(20),
CO   complement(AAHY01046957.1:1..80995),gap(2958),
CO   complement(AAHY01046958.1:1..3294),gap(20),
CO   complement(AAHY01046959.1:1..44711),gap(20),
CO   complement(AAHY01046960.1:1..7135),gap(190),
CO   complement(AAHY01046961.1:1..4526),gap(432),
CO   complement(AAHY01046962.1:1..2614),gap(20),
CO   complement(AAHY01046963.1:1..2400),gap(2723),
CO   complement(AAHY01046964.1:1..13416),gap(228),
CO   complement(AAHY01046965.1:1..923),gap(427),
CO   complement(AAHY01046966.1:1..3852),gap(1585),
CO   complement(AAHY01046967.1:1..1065),gap(555),
CO   complement(AAHY01046968.1:1..6820),gap(37),
CO   complement(AAHY01046969.1:1..4097),gap(20),
CO   complement(AAHY01046970.1:1..8948),gap(830),
CO   complement(AAHY01046971.1:1..10180),gap(20),
CO   complement(AAHY01046972.1:1..1103),gap(20),
CO   complement(AAHY01046973.1:1..1266),gap(20),AAHY01046974.1:1..6655,gap(20),
CO   complement(AAHY01046975.1:1..2017),gap(20),
CO   complement(AAHY01046976.1:1..3026),gap(486),AAHY01046977.1:1..1327,gap(20),
CO   complement(AAHY01046978.1:1..1203),gap(75),AAHY01046979.1:1..2165)
//