Dbfetch

ID   CH466615; SV 1; linear; genomic DNA; CON; MUS; 5702828 BP.
XX
AC   CH466615;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009767945 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5702828
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-5702828
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 454cb290bae00993e4c00c6b014931af.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000212.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000006215; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006218; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006219; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006221; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006445; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025329; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028737; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028741; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028745; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028750; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028751; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028753; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028914; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041025; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041120; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041161; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041193; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041202; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041805; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047799; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057322; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070637; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073733; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078515; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097880; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019356; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028999; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029001; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029003; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029004; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029006; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029007; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029010; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029011; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029013; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029019; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029021; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029031; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029041; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029043; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029044; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029046; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029047; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029048; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029050; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029068; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029069; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029070; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019325; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028958; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028960; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028962; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028963; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028965; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028966; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028969; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028970; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028972; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028978; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0028990; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029000; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029002; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029003; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029005; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029006; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029007; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029008; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029010; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029014; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029015; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029028; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029029; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029030; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019293; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028910; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028912; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028914; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028915; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028917; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028918; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028921; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028922; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028924; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028930; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028932; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028942; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028952; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028954; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028955; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028957; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028958; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028959; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028960; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028962; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028980; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028981; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0028982; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019298; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028982; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028984; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028986; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028987; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028989; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028990; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028993; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028994; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028996; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029002; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029004; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029014; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029024; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029026; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029027; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029029; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029030; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029031; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029032; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029034; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029052; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029053; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029054; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019107; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028696; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028698; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028700; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028701; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028703; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028704; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028707; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028708; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028710; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028716; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028718; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028728; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028738; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028740; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028741; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028743; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028744; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028745; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028746; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028748; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028766; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028767; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028768; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029423; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029425; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029427; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029428; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029430; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029431; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029434; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029435; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029437; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029443; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029445; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029455; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029465; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029467; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029468; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029470; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029472; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029473; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029475; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029493; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029494; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029495; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018661; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028130; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028132; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028134; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028136; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028139; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028140; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028142; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028148; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028150; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028160; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028170; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028172; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028173; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028175; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028176; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028177; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028178; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028180; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028198; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028199; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028200; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019077; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028661; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028663; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028665; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028666; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028668; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028671; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028672; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028674; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028680; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028682; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028692; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028702; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028704; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028705; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028707; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028708; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028709; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028710; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028712; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028730; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028731; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028732; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0034166; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019189; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028810; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028812; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028814; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028815; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028817; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028818; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028821; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028822; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028824; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028830; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028832; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028842; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028852; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028854; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028855; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028857; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028858; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028859; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028860; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028862; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028880; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028881; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028882; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028777; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028779; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028781; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028782; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028784; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028785; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028788; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028789; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028797; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028799; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028809; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028819; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028821; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028822; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028824; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028825; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028826; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028827; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028829; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028833; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028834; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028847; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028848; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028849; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019259; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028909; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028911; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028913; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028914; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028916; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028917; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028920; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028921; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028923; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028929; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028931; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028941; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028951; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028953; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028954; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028956; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028957; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028958; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028959; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028961; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028979; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028980; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0028981; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028803; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028805; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028807; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028808; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028810; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028811; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028814; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028815; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028817; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028823; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028825; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028835; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028845; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028847; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028848; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028850; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028851; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028853; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028855; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028859; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028860; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028873; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028874; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028875; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019786; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029461; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029463; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029465; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029466; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029468; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029469; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029472; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029473; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029481; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029483; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029493; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029503; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029505; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029506; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029508; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029509; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029510; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029511; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029513; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029531; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029532; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029533; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018426; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027851; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027853; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027854; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027856; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027857; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027860; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027861; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027863; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027869; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027871; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027881; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027891; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027893; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027894; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027896; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027897; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027898; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027899; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027901; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027920; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027921; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027922; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018713; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028208; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028210; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028211; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028213; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028214; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028217; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028218; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028220; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028226; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028228; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028238; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028248; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028250; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028251; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028253; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028254; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028255; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028256; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028258; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028276; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028277; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028278; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000006377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006380; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006614; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030524; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030528; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030747; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037356; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040023; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042675; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094544; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102508; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102512; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105784; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105788; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105802; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106599; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123827; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181019; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068830; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068839; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068844; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068846; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068856; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068859; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068865; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068867; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068874; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068914; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068916; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068951; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0068997; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069008; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069012; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069017; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069021; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069022; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069035; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069107; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069108; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069113; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0033269; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068882; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068896; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068898; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068908; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068911; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068917; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068919; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068926; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068967; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0068969; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069004; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069050; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069061; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069065; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069070; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069074; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069075; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069076; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069088; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069113; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069115; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069159; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069160; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069165; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0033252; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068790; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068799; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068804; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068806; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068816; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068819; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068825; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068827; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068834; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068875; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068877; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068912; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068958; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068969; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068973; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068978; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068982; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068983; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068984; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0068996; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069067; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069068; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069073; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033255; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068804; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068813; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068818; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068820; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068830; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068833; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068840; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068842; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068849; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068890; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068892; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068927; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068976; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068987; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068991; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0068996; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069000; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069001; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069002; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069014; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069085; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069086; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033041; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068473; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068482; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068487; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068499; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068502; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068508; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068510; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068517; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068558; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068561; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068596; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068642; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068653; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068657; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068662; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068666; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068667; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068668; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068680; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068751; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068752; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068757; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0033755; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069293; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069302; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069307; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069309; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069319; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069322; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069328; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069330; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069337; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069378; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069381; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069416; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069466; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069477; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069481; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069486; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069490; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069491; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069492; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069505; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069576; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069577; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069582; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0032891; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068963; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068968; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068976; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068979; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068987; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068989; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0068996; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069035; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069038; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069074; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069125; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069136; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069140; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069145; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069150; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069151; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069152; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069169; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069241; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069242; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069247; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0032954; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068418; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068427; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068432; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068434; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068444; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068450; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068452; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068459; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068501; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068503; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068538; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068584; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068595; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068599; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068604; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068608; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068609; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068610; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068622; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068693; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068694; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068699; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0091095; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0033099; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068553; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068562; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068567; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068569; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068578; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068581; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068587; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068589; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068596; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068637; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068639; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068674; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068723; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068734; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068738; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068743; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068747; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068748; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068749; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068760; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068831; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068832; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068837; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0033086; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068460; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068469; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068474; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068476; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068486; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068489; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068497; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068541; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068543; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068577; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068624; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068635; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068639; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068644; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068648; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068649; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068650; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068663; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068688; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068690; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068734; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068735; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068740; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0033222; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068650; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068659; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068664; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068666; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068676; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068679; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068685; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068687; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068694; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068735; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068737; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068772; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068818; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068829; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068833; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068838; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068842; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068843; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068844; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068857; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068928; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068929; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0068934; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033090; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068466; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068475; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068480; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068482; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068492; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068495; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068501; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068503; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068510; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068550; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068552; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068586; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068632; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068643; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068647; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068652; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068656; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068657; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068658; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068672; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068697; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068699; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068743; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068744; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068749; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0033793; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069478; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069487; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069492; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069494; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069504; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069507; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069513; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069515; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069563; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069601; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069650; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069661; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069665; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069670; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069674; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069675; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069676; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069689; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069760; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069761; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069766; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032591; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068449; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068454; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068455; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068465; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068468; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068474; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068477; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068484; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068526; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068528; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068564; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068615; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068626; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068630; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068640; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068641; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068642; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068658; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068733; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068734; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068739; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032506; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067668; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067673; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067675; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067685; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067688; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067694; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067696; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067703; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067741; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067743; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067778; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067827; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067838; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067842; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067847; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067851; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067852; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067853; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067866; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067937; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067938; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067943; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5702828
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    1312..1858
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    3496..8413
FT                   /estimated_length=4918
FT                   /gap_type="unknown"
FT   assembly_gap    9258..10086
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   assembly_gap    15621..18271
FT                   /estimated_length=2651
FT                   /gap_type="unknown"
FT   assembly_gap    19215..19319
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    26890..27353
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   gene            33096..204379
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /note="gene_id=mCG14542.1"
FT   mRNA            join(33096..33176,75030..75125,79675..79707,88841..89020,
FT                   89331..89445,95360..95457,97323..97445,112533..112641,
FT                   117976..118800,142101..142189,147382..147628,
FT                   152398..152531,154232..154351,159303..159473,
FT                   161571..161768,166604..166750,167181..167417,
FT                   168700..168804,172149..172281,173236..173330,
FT                   174214..174307,176797..176914,179435..179652,
FT                   180959..181074,184378..184550,187834..187959,
FT                   189186..189267,195544..195693,199389..199470,
FT                   200663..200809,203291..204379)
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, transcript variant mCT18419"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT18419.2 created
FT                   on 23-MAY-2002"
FT   mRNA            join(33096..33176,75030..75125,88841..89020,89331..89445,
FT                   95360..95457,97323..97445,112533..112641,117976..118800,
FT                   142101..142189,147382..147628,152398..152531,
FT                   154232..154351,159303..159473,161571..161768,
FT                   166604..166750,167181..167417,168700..168804,
FT                   172149..172281,173236..173330,174214..174307,
FT                   176854..176914,179435..179652,180959..181074,
FT                   184378..184550,187834..187959,189186..189267,
FT                   195547..195693,199389..199470,200663..200809,
FT                   203291..204379)
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, transcript variant mCT169241"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT169241.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(33097..33176,75030..75125,76394..76507,88841..89020,
FT                   89331..89445,95360..95457,97323..97445,112533..112641,
FT                   117976..118800,142101..142189,147382..147628,
FT                   152398..152531,154232..154351,159303..159473,
FT                   161571..161768,166604..166750,167181..167417,
FT                   168700..168804,172149..172281,173236..173330,
FT                   174214..174307,176797..176914,179435..179652,
FT                   180959..181074,184378..184550,187834..187959,
FT                   189186..189267,195544..195693,199389..199470,
FT                   200663..200809,203291..204379)
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, transcript variant mCT169239"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT169239.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(33101..33176,36629..36705,75030..75125,88841..89020,
FT                   89331..89445,95360..95457,97323..97445,112533..112641,
FT                   117976..118800,142101..142189,147382..147628,
FT                   152398..152531,154232..154351,159303..159473,
FT                   161571..161768,166604..166750,167181..167417,
FT                   168700..168804,172149..172281,173236..173330,
FT                   174214..174307,176854..176914,179435..179652,
FT                   180959..181074,184378..184550,187834..187959,
FT                   189186..189267,195547..195693,199389..199470,
FT                   200663..200809,203291..204379)
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, transcript variant mCT169238"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT169238.0 created
FT                   on 23-MAY-2002"
FT   assembly_gap    33469..33488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    36756..37346
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    38751..39999
FT                   /estimated_length=1249
FT                   /gap_type="unknown"
FT   assembly_gap    47341..48347
FT                   /estimated_length=1007
FT                   /gap_type="unknown"
FT   assembly_gap    50027..51997
FT                   /estimated_length=1971
FT                   /gap_type="unknown"
FT   assembly_gap    59916..60330
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   CDS             join(75096..75125,76394..76507,88841..89020,89331..89445,
FT                   95360..95457,97323..97445,112533..112641,117976..118800,
FT                   142101..142189,147382..147628,152398..152531,
FT                   154232..154351,159303..159473,161571..161768,
FT                   166604..166750,167181..167417,168700..168804,
FT                   172149..172281,173236..173330,174214..174307,
FT                   176797..176914,179435..179652,180959..181074,
FT                   184378..184550,187834..187959,189186..189267,
FT                   195544..195693,199389..199470,200663..200809,
FT                   203291..203472)
FT                   /codon_start=1
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, isoform CRA_b"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT169239.0
FT                   protein_id=mCP92061.0 isoform=CRA_b"
FT                   /protein_id="EDL13240.1"
FT                   /translation="MNSQPQARSPPGRTVPIHCTDTWKRRKVLEQSPVYRSLAGRGWIK
FT                   YYIFFQRPQIQPPRAAIPNSSPSIRPGVQTPTAVYQANQHIMMVNHLPMPYPVTQGHQY
FT                   CIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFANAYGTPFYPSQPVYQSAPII
FT                   VPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPASTPTPPQQL
FT                   PSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVFQSPSTVLRLVLSGEK
FT                   KEQAGQMPETAAGEPTPEPPRTSSPTSLPPLARSSLPSPMSAALSSQPLFTAEDKCELP
FT                   SSKEEDAPPVPSPTSCTAASGPSLTDNSDICKKPCSVAPHDSQLISSTILINEMNGVGE
FT                   KLSAKENTVGMLRQEVLPLTLELEILEHPQEELKVECTPTPIAPSMLPAFSPAPPTPPT
FT                   SPPCPPVVLSAAIARSPAVATEVQRVADEGESLRTCLSKDAKEMQDKAESESDGQAEET
FT                   ADPQSLHSGRSPAPVQTATTAPKSWKKTKEQTRTPDEVLEAEAEPKAEEELAVDSVLEP
FT                   EQEKMSQGFPSERDPSALKRGKAEEGNGEEAEPVRNGAESASEGEGGDGNSGSADSSAD
FT                   GLTFPFKAESWKPADTEGKKQYDREFLLDIQFMPACIQKPEGLPPISDVVLDKINQPRL
FT                   SMRTLDPRILPRGPDFTPAFADFPRQTPGGRGVPLLNVGPRRSQPGQRREPRKIITVSV
FT                   KEDVHLRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSA
FT                   LTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLL
FT                   NRCQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIG
FT                   ELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQM
FT                   EKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQ
FT                   QLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGS
FT                   WGKGSSGGAKASESDALRSSASSLNRFSPLQPPAPSGSPSATPLEFDSRRALTSRGSMG
FT                   REKSDKPIPAGTARPNTFLRGSSKDLLDNQSQEEQRREMLETVKQLTGGLDAERASTEA
FT                   DRSKTRELAKSEMCAVPAPDKPALSEEEVERKSKSIIDEFLHINDFKEATQCIEELSAQ
FT                   GPLHVFVKVGVEFTLERSQITRDHMGHLLYQLVQSEKLSKQDFFKGFSETLELADDMAI
FT                   DIPHIWLYLAELVTPMLKEGGISMRELIVEFSKPLLPVGRAGVLLSEILHLLCRQMQKL
FT                   DFTESEGPCSSEALSKKELSAEELSQRLEKLIMEEKADDERIFDWVEANLDESQMSSPT
FT                   FLRALMTAVCKAAIIADCSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVK
FT                   LDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQAGKGVALKSVTAFFTWLREAE
FT                   EESEDN"
FT   CDS             join(75096..75125,79675..79707,88841..89020,89331..89445,
FT                   95360..95457,97323..97445,112533..112641,117976..118800,
FT                   142101..142189,147382..147628,152398..152531,
FT                   154232..154351,159303..159473,161571..161768,
FT                   166604..166750,167181..167417,168700..168804,
FT                   172149..172281,173236..173330,174214..174307,
FT                   176797..176914,179435..179652,180959..181074,
FT                   184378..184550,187834..187959,189186..189267,
FT                   195544..195693,199389..199470,200663..200809,
FT                   203291..203472)
FT                   /codon_start=1
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, isoform CRA_d"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT18419.2
FT                   protein_id=mCP4873.2 isoform=CRA_d"
FT                   /protein_id="EDL13243.1"
FT                   /translation="MNSQPQARSPFAAGPRPAHHQFFQRPQIQPPRAAIPNSSPSIRPG
FT                   VQTPTAVYQANQHIMMVNHLPMPYPVTQGHQYCIPQYRHSGPPYVGPPQQYPVQPPGPG
FT                   PFYPGPGPGDFANAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKKTIRIRDPNQGGK
FT                   DITEEIMSGGGSRNPTPPIGRPASTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPVT
FT                   AASDQKQEEKPKPDPVFQSPSTVLRLVLSGEKKEQAGQMPETAAGEPTPEPPRTSSPTS
FT                   LPPLARSSLPSPMSAALSSQPLFTAEDKCELPSSKEEDAPPVPSPTSCTAASGPSLTDN
FT                   SDICKKPCSVAPHDSQLISSTILINEMNGVGEKLSAKENTVGMLRQEVLPLTLELEILE
FT                   HPQEELKVECTPTPIAPSMLPAFSPAPPTPPTSPPCPPVVLSAAIARSPAVATEVQRVA
FT                   DEGESLRTCLSKDAKEMQDKAESESDGQAEETADPQSLHSGRSPAPVQTATTAPKSWKK
FT                   TKEQTRTPDEVLEAEAEPKAEEELAVDSVLEPEQEKMSQGFPSERDPSALKRGKAEEGN
FT                   GEEAEPVRNGAESASEGEGGDGNSGSADSSADGLTFPFKAESWKPADTEGKKQYDREFL
FT                   LDIQFMPACIQKPEGLPPISDVVLDKINQPRLSMRTLDPRILPRGPDFTPAFADFPRQT
FT                   PGGRGVPLLNVGPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHADDPE
FT                   SIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFS
FT                   VAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAA
FT                   SAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE
FT                   SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCN
FT                   WVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAK
FT                   NSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASESDALRSSASSLNRF
FT                   SPLQPPAPSGSPSATPLEFDSRRALTSRGSMGREKSDKPIPAGTARPNTFLRGSSKDLL
FT                   DNQSQEEQRREMLETVKQLTGGLDAERASTEADRSKTRELAKSEMCAVPAPDKPALSEE
FT                   EVERKSKSIIDEFLHINDFKEATQCIEELSAQGPLHVFVKVGVEFTLERSQITRDHMGH
FT                   LLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPMLKEGGISMREL
FT                   IVEFSKPLLPVGRAGVLLSEILHLLCRQMQKLDFTESEGPCSSEALSKKELSAEELSQR
FT                   LEKLIMEEKADDERIFDWVEANLDESQMSSPTFLRALMTAVCKAAIIADCSTFRVDTAV
FT                   IKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFY
FT                   KWESSKDPAEQAGKGVALKSVTAFFTWLREAEEESEDN"
FT   CDS             join(75096..75125,88841..89020,89331..89445,95360..95457,
FT                   97323..97445,112533..112641,117976..118800,142101..142189,
FT                   147382..147628,152398..152531,154232..154351,
FT                   159303..159473,161571..161768,166604..166750,
FT                   167181..167417,168700..168804,172149..172281,
FT                   173236..173330,174214..174307,176854..176914,
FT                   179435..179652,180959..181074,184378..184550,
FT                   187834..187959,189186..189267,195547..195693,
FT                   199389..199470,200663..200809,203291..203472)
FT                   /codon_start=1
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, isoform CRA_a"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT169238.0
FT                   protein_id=mCP92070.0 isoform=CRA_a"
FT                   /protein_id="EDL13239.1"
FT                   /translation="MNSQPQARSPFFQRPQIQPPRAAIPNSSPSIRPGVQTPTAVYQAN
FT                   QHIMMVNHLPMPYPVTQGHQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDF
FT                   ANAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGG
FT                   SRNPTPPIGRPASTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKP
FT                   KPDPVFQSPSTVLRLVLSGEKKEQAGQMPETAAGEPTPEPPRTSSPTSLPPLARSSLPS
FT                   PMSAALSSQPLFTAEDKCELPSSKEEDAPPVPSPTSCTAASGPSLTDNSDICKKPCSVA
FT                   PHDSQLISSTILINEMNGVGEKLSAKENTVGMLRQEVLPLTLELEILEHPQEELKVECT
FT                   PTPIAPSMLPAFSPAPPTPPTSPPCPPVVLSAAIARSPAVATEVQRVADEGESLRTCLS
FT                   KDAKEMQDKAESESDGQAEETADPQSLHSGRSPAPVQTATTAPKSWKKTKEQTRTPDEV
FT                   LEAEAEPKAEEELAVDSVLEPEQEKMSQGFPSERDPSALKRGKAEEGNGEEAEPVRNGA
FT                   ESASEGEGGDGNSGSADSSADGLTFPFKAESWKPADTEGKKQYDREFLLDIQFMPACIQ
FT                   KPEGLPPISDVVLDKINQPRLSMRTLDPRILPRGPDFTPAFADFPRQTPGGRGVPLLNV
FT                   GPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHADDPESIKTQELFRKV
FT                   RSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLV
FT                   TLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHD
FT                   ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTT
FT                   IGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPK
FT                   TIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFL
FT                   KITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASESAPSGSPSATPLEFDSRRALTSRGS
FT                   MGREKSDKPIPAGTARPNTFLRGSSKDLLDNQSQEEQRREMLETVKQLTGGLDAERAST
FT                   EADRSKTRELAKSEMCAVPAPDKPALSEEEVERKSKSIIDEFLHINDFKEATQCIEELS
FT                   AQGPLHVFVKVGVEFTLERSQITRDHMGHLLYQLVQSEKLSKQDFFKGFSETLELADDM
FT                   AIDIPHIWLYLAELVTPMLKEGGISMRELIVEFSKPLLPVGRAGVLLSEILHLLCRQMK
FT                   LDFTESEGPCSSEALSKKELSAEELSQRLEKLIMEEKADDERIFDWVEANLDESQMSSP
FT                   TFLRALMTAVCKAAIIADCSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIV
FT                   KLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQAGKGVALKSVTAFFTWLREA
FT                   EEESEDN"
FT   CDS             join(75096..75125,88841..89020,89331..89445,95360..95457,
FT                   97323..97445,112533..112641,117976..118800,142101..142189,
FT                   147382..147628,152398..152531,154232..154351,
FT                   159303..159473,161571..161768,166604..166750,
FT                   167181..167417,168700..168804,172149..172281,
FT                   173236..173330,174214..174307,176854..176914,
FT                   179435..179652,180959..181074,184378..184550,
FT                   187834..187959,189186..189267,195547..195693,
FT                   199389..199470,200663..200809,203291..203472)
FT                   /codon_start=1
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, isoform CRA_a"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT169241.0
FT                   protein_id=mCP92031.0 isoform=CRA_a"
FT                   /protein_id="EDL13242.1"
FT                   /translation="MNSQPQARSPFFQRPQIQPPRAAIPNSSPSIRPGVQTPTAVYQAN
FT                   QHIMMVNHLPMPYPVTQGHQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDF
FT                   ANAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGG
FT                   SRNPTPPIGRPASTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKP
FT                   KPDPVFQSPSTVLRLVLSGEKKEQAGQMPETAAGEPTPEPPRTSSPTSLPPLARSSLPS
FT                   PMSAALSSQPLFTAEDKCELPSSKEEDAPPVPSPTSCTAASGPSLTDNSDICKKPCSVA
FT                   PHDSQLISSTILINEMNGVGEKLSAKENTVGMLRQEVLPLTLELEILEHPQEELKVECT
FT                   PTPIAPSMLPAFSPAPPTPPTSPPCPPVVLSAAIARSPAVATEVQRVADEGESLRTCLS
FT                   KDAKEMQDKAESESDGQAEETADPQSLHSGRSPAPVQTATTAPKSWKKTKEQTRTPDEV
FT                   LEAEAEPKAEEELAVDSVLEPEQEKMSQGFPSERDPSALKRGKAEEGNGEEAEPVRNGA
FT                   ESASEGEGGDGNSGSADSSADGLTFPFKAESWKPADTEGKKQYDREFLLDIQFMPACIQ
FT                   KPEGLPPISDVVLDKINQPRLSMRTLDPRILPRGPDFTPAFADFPRQTPGGRGVPLLNV
FT                   GPRRSQPGQRREPRKIITVSVKEDVHLRKAENAWKPSQKRDSHADDPESIKTQELFRKV
FT                   RSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLV
FT                   TLKVPMADKPGNTVNFRKLLLNRCQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHD
FT                   ELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTT
FT                   IGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPK
FT                   TIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFL
FT                   KITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASESAPSGSPSATPLEFDSRRALTSRGS
FT                   MGREKSDKPIPAGTARPNTFLRGSSKDLLDNQSQEEQRREMLETVKQLTGGLDAERAST
FT                   EADRSKTRELAKSEMCAVPAPDKPALSEEEVERKSKSIIDEFLHINDFKEATQCIEELS
FT                   AQGPLHVFVKVGVEFTLERSQITRDHMGHLLYQLVQSEKLSKQDFFKGFSETLELADDM
FT                   AIDIPHIWLYLAELVTPMLKEGGISMRELIVEFSKPLLPVGRAGVLLSEILHLLCRQMK
FT                   LDFTESEGPCSSEALSKKELSAEELSQRLEKLIMEEKADDERIFDWVEANLDESQMSSP
FT                   TFLRALMTAVCKAAIIADCSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIV
FT                   KLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQAGKGVALKSVTAFFTWLREA
FT                   EEESEDN"
FT   assembly_gap    91397..91440
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    97188..97207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    105756..106125
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    114373..114392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    120256..120275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    122746..122765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    123936..123955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    125057..125076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    126104..126690
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    131318..131470
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   gene            complement(133424..134348)
FT                   /locus_tag="mCG_147458"
FT                   /note="gene_id=mCG147458.0"
FT   mRNA            complement(join(133424..133537,133726..134348))
FT                   /locus_tag="mCG_147458"
FT                   /product="mCG147458"
FT                   /note="gene_id=mCG147458.0 transcript_id=mCT187721.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(134107..134277)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147458"
FT                   /product="mCG147458"
FT                   /note="gene_id=mCG147458.0 transcript_id=mCT187721.0
FT                   protein_id=mCP108140.0"
FT                   /protein_id="EDL13244.1"
FT                   /translation="MRSLLSPCPSVGTIPASSHSQASTGFLLAADTPLTFCFFHFRNSH
FT                   RNLEKKSCQFL"
FT   assembly_gap    147664..148234
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    152701..153498
FT                   /estimated_length=798
FT                   /gap_type="unknown"
FT   assembly_gap    170937..171107
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   mRNA            join(184413..184550,187312..187381,187834..187959,
FT                   189186..189267,195547..195693,199389..199470,
FT                   200663..200809,203291..204379)
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, transcript variant mCT169240"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT169240.0 created
FT                   on 23-MAY-2002"
FT   assembly_gap    185952..185971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(187353..187381,187834..187959,189186..189267,
FT                   195547..195693,199389..199470,200663..200809,
FT                   203291..203472)
FT                   /codon_start=1
FT                   /gene="Eif4g3"
FT                   /locus_tag="mCG_14542"
FT                   /product="eukaryotic translation initiation factor 4 gamma,
FT                   3, isoform CRA_c"
FT                   /note="gene_id=mCG14542.1 transcript_id=mCT169240.0
FT                   protein_id=mCP92063.0 isoform=CRA_c"
FT                   /protein_id="EDL13241.1"
FT                   /translation="MAIDIPHIWFFSETLELADDMAIDIPHIWLYLAELVTPMLKEGGI
FT                   SMRELIVEFSKPLLPVGRAGVLLSEILHLLCRQMKLDFTESEGPCSSEALSKKELSAEE
FT                   LSQRLEKLIMEEKADDERIFDWVEANLDESQMSSPTFLRALMTAVCKAAIIADCSTFRV
FT                   DTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISE
FT                   DAFYKWESSKDPAEQAGKGVALKSVTAFFTWLREAEEESEDN"
FT   assembly_gap    187385..187404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    190753..190772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    191805..191824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            212980..213456
FT                   /locus_tag="mCG_147452"
FT                   /note="gene_id=mCG147452.0"
FT   mRNA            join(212980..213106,213183..213456)
FT                   /locus_tag="mCG_147452"
FT                   /product="mCG147452"
FT                   /note="gene_id=mCG147452.0 transcript_id=mCT187715.0
FT                   created on 13-JAN-2004"
FT   CDS             213255..213413
FT                   /codon_start=1
FT                   /locus_tag="mCG_147452"
FT                   /product="mCG147452"
FT                   /note="gene_id=mCG147452.0 transcript_id=mCT187715.0
FT                   protein_id=mCP108134.0"
FT                   /protein_id="EDL13245.1"
FT                   /translation="MPPIESASSHWALGAGDGTQGFLQTRHILTTKLLLQPQELQFSKA
FT                   VVCTLHE"
FT   assembly_gap    213852..214112
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   gene            214121..241793
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /note="gene_id=mCG14538.2"
FT   mRNA            join(214121..214252,218498..218695,219061..219160,
FT                   220462..220621,224355..224514,227094..227237,
FT                   228122..228199,228806..228957,232870..232960,
FT                   235774..235933,238115..238226,239200..239316,
FT                   240023..241793)
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant mCT18416"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT18416.2 created
FT                   on 06-FEB-2003"
FT   mRNA            join(214123..214252,218498..218695,219061..219160,
FT                   220462..220621,224355..224518,227094..227237,
FT                   228122..228199,228806..228957,232870..232960,
FT                   235774..235933,238115..238226,239200..239316,
FT                   240023..241067)
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant mCT179560"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT179560.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(214164..214252,219061..219160,220462..220621,
FT                   224355..224514,227094..227237,228122..228199,
FT                   228806..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..241735)
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant mCT179559"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT179559.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(214234..214252,219061..219160,220501..220621,
FT                   224355..224514,227094..227237,228122..228199,
FT                   228806..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..241733)
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant mCT179558"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT179558.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(214247..214338,218498..218695,219061..219160,
FT                   220462..220621,224355..224514,227094..227237,
FT                   228122..228199,228806..228957,232870..232960,
FT                   235774..235933,238115..238226,239200..239316,
FT                   240023..241718)
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant mCT169235"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT169235.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(216357..216485,218498..218695,219061..219160,
FT                   220462..220621,224355..224514,227094..227237,
FT                   228122..228199,228806..228957,232870..232960,
FT                   235774..235933,238115..238226,239200..239316,
FT                   240023..241718)
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant mCT169237"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT169237.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(218486..218695,219061..219160,220462..220621,
FT                   224355..224514,227094..227237,228122..228199,
FT                   228809..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..241728)
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant mCT190701"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT190701.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(218486..218695,219061..219160,220462..220621,
FT                   224355..224517,227097..227237,228122..228199,
FT                   228806..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..241718)
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   transcript variant mCT169236"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT169236.0 created
FT                   on 06-FEB-2003"
FT   CDS             join(218600..218695,219061..219160,220462..220621,
FT                   224355..224517,227097..227237,228122..228199,
FT                   228806..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..240317)
FT                   /codon_start=1
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT169236.0
FT                   protein_id=mCP92041.0 isoform=CRA_e"
FT                   /protein_id="EDL13252.1"
FT                   /translation="MATDMSQGELIHPKALPLIVGAQLIHADKLGEKAEDTTMPIRRAV
FT                   NSTRETPPKSKLAEGEEEKPEPDGSSEESISTVEEQENETPPATSSEAEQPKGEPESGE
FT                   KEENNSKSAEEPKKDEKDQSKEKEKKVKKTIPAWATLSASQLARAQRQTPMASSPRPKM
FT                   DAILTEAIKACFQKTGASVVAIRKYIIHKYPSLGLERRGYLLKQALKRELNRGVIRQVK
FT                   GKGASGSFVVVQKSKPPQKSKNRKKGSALDPEPQVKLEDVLPLAFTRLCEPKEASYSLI
FT                   RKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGS
FT                   LMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGANSNYQMHLLKKTLQKCEKNGWLEQ
FT                   ISGKGFSGTFQLSFPYYPSPGVLFPKKESGGSDDEDDDDDDDESSEDSEDEEPPPKRSL
FT                   QKKTPAKSQGKTASMKQRGSKPARKVPAAQRGKVRPLPKKAPPKAKTPARKARPSPSVI
FT                   KKPSGSSSRKPIASARKEAKLPGKGKSAMKKSFKTKK"
FT   CDS             join(218600..218695,219061..219160,220462..220621,
FT                   224355..224514,227094..227237,228122..228199,
FT                   228806..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..240317)
FT                   /codon_start=1
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT169237.0
FT                   protein_id=mCP92060.0 isoform=CRA_a"
FT                   /protein_id="EDL13246.1"
FT                   /translation="MATDMSQGELIHPKALPLIVGAQLIHADKLGEKAEDTTMPIRRAV
FT                   NSTRETPPKSKLAEGEEEKPEPDGSSEESISTVEEQENETPPATSSEAEQPKGEPESGE
FT                   KEENNSKSAEEPKKDEKDQSKEKEKKVKKTIPAWATLSASQLARAQRQTPMASSPRPKM
FT                   DAILTEAIKACFQKTGASVVAIRKYIIHKYPSLGLERRGYLLKQALKRELNRGVIRQVK
FT                   GKGASGSFVVVQKSKPPQKSKNRKKGSALDPEPQVKLEDVLPLAFTRLCEPKEASYSLI
FT                   RKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGS
FT                   LMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGANSNYQMHLLKKTLQKCEKNGWLEQ
FT                   ISGKGFSGTFQLSFPYYPSPGVLFPKKESGGSDDEDDDDDDDESSEDSEDEEPPPKRSL
FT                   QKKTPAKSQGKTASMKQRGSKPARKVPAAQRGKVRPLPKKAPPKAKTPARKARPSPSVI
FT                   KKPSGSSSRKPIASARKEAKLPGKGKSAMKKSFKTKK"
FT   CDS             join(218600..218695,219061..219160,220462..220621,
FT                   224355..224514,227094..227237,228122..228199,
FT                   228806..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..240317)
FT                   /codon_start=1
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT18416.2
FT                   protein_id=mCP4884.2 isoform=CRA_a"
FT                   /protein_id="EDL13249.1"
FT                   /translation="MATDMSQGELIHPKALPLIVGAQLIHADKLGEKAEDTTMPIRRAV
FT                   NSTRETPPKSKLAEGEEEKPEPDGSSEESISTVEEQENETPPATSSEAEQPKGEPESGE
FT                   KEENNSKSAEEPKKDEKDQSKEKEKKVKKTIPAWATLSASQLARAQRQTPMASSPRPKM
FT                   DAILTEAIKACFQKTGASVVAIRKYIIHKYPSLGLERRGYLLKQALKRELNRGVIRQVK
FT                   GKGASGSFVVVQKSKPPQKSKNRKKGSALDPEPQVKLEDVLPLAFTRLCEPKEASYSLI
FT                   RKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGS
FT                   LMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGANSNYQMHLLKKTLQKCEKNGWLEQ
FT                   ISGKGFSGTFQLSFPYYPSPGVLFPKKESGGSDDEDDDDDDDESSEDSEDEEPPPKRSL
FT                   QKKTPAKSQGKTASMKQRGSKPARKVPAAQRGKVRPLPKKAPPKAKTPARKARPSPSVI
FT                   KKPSGSSSRKPIASARKEAKLPGKGKSAMKKSFKTKK"
FT   CDS             join(218600..218695,219061..219160,220462..220621,
FT                   224355..224514,227094..227237,228122..228199,
FT                   228806..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..240317)
FT                   /codon_start=1
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT169235.0
FT                   protein_id=mCP92071.0 isoform=CRA_a"
FT                   /protein_id="EDL13251.1"
FT                   /translation="MATDMSQGELIHPKALPLIVGAQLIHADKLGEKAEDTTMPIRRAV
FT                   NSTRETPPKSKLAEGEEEKPEPDGSSEESISTVEEQENETPPATSSEAEQPKGEPESGE
FT                   KEENNSKSAEEPKKDEKDQSKEKEKKVKKTIPAWATLSASQLARAQRQTPMASSPRPKM
FT                   DAILTEAIKACFQKTGASVVAIRKYIIHKYPSLGLERRGYLLKQALKRELNRGVIRQVK
FT                   GKGASGSFVVVQKSKPPQKSKNRKKGSALDPEPQVKLEDVLPLAFTRLCEPKEASYSLI
FT                   RKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGS
FT                   LMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGANSNYQMHLLKKTLQKCEKNGWLEQ
FT                   ISGKGFSGTFQLSFPYYPSPGVLFPKKESGGSDDEDDDDDDDESSEDSEDEEPPPKRSL
FT                   QKKTPAKSQGKTASMKQRGSKPARKVPAAQRGKVRPLPKKAPPKAKTPARKARPSPSVI
FT                   KKPSGSSSRKPIASARKEAKLPGKGKSAMKKSFKTKK"
FT   CDS             join(218600..218695,219061..219160,220462..220621,
FT                   224355..224514,227094..227237,228122..228199,
FT                   228809..228957,232870..232960,235774..235933,
FT                   238115..238226,239200..239316,240023..240317)
FT                   /codon_start=1
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT190701.0
FT                   protein_id=mCP111660.0 isoform=CRA_d"
FT                   /protein_id="EDL13250.1"
FT                   /translation="MATDMSQGELIHPKALPLIVGAQLIHADKLGEKAEDTTMPIRRAV
FT                   NSTRETPPKSKLAEGEEEKPEPDGSSEESISTVEEQENETPPATSSEAEQPKGEPESGE
FT                   KEENNSKSAEEPKKDEKDQSKEKEKKVKKTIPAWATLSASQLARAQRQTPMASSPRPKM
FT                   DAILTEAIKACFQKTGASVVAIRKYIIHKYPSLGLERRGYLLKQALKRELNRGVIRQVK
FT                   GKGASGSFVVVQKSKPPQKSKNRKGSALDPEPQVKLEDVLPLAFTRLCEPKEASYSLIR
FT                   KYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPLLGGSL
FT                   MEYAILSAIAAMNEPKTCSTTALKKYVLENHPGANSNYQMHLLKKTLQKCEKNGWLEQI
FT                   SGKGFSGTFQLSFPYYPSPGVLFPKKESGGSDDEDDDDDDDESSEDSEDEEPPPKRSLQ
FT                   KKTPAKSQGKTASMKQRGSKPARKVPAAQRGKVRPLPKKAPPKAKTPARKARPSPSVIK
FT                   KPSGSSSRKPIASARKEAKLPGKGKSAMKKSFKTKK"
FT   CDS             join(218612..218695,219061..219160,220462..220621,
FT                   224355..224518,227094..227152)
FT                   /codon_start=1
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT179560.0
FT                   protein_id=mCP102481.0 isoform=CRA_c"
FT                   /protein_id="EDL13248.1"
FT                   /translation="MSQGELIHPKALPLIVGAQLIHADKLGEKAEDTTMPIRRAVNSTR
FT                   ETPPKSKLAEGEEEKPEPDGSSEESISTVEEQENETPPATSSEAEQPKGEPESGEKEEN
FT                   NSKSAEEPKKDEKDQSKEKEKKVKKTIPAWATLSASQLARAQRQTPMASSPRPKMDAIL
FT                   TEAIKASMLPEDWRLGGCDSKVHHS"
FT   CDS             join(219079..219160,220462..220621,224355..224514,
FT                   227094..227237,228122..228199,228806..228957,
FT                   232870..232960,235774..235933,238115..238226,
FT                   239200..239316,240023..240317)
FT                   /codon_start=1
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_f"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT179559.0
FT                   protein_id=mCP102480.0 isoform=CRA_f"
FT                   /protein_id="EDL13253.1"
FT                   /translation="MPIRRAVNSTRETPPKSKLAEGEEEKPEPDGSSEESISTVEEQEN
FT                   ETPPATSSEAEQPKGEPESGEKEENNSKSAEEPKKDEKDQSKEKEKKVKKTIPAWATLS
FT                   ASQLARAQRQTPMASSPRPKMDAILTEAIKACFQKTGASVVAIRKYIIHKYPSLGLERR
FT                   GYLLKQALKRELNRGVIRQVKGKGASGSFVVVQKSKPPQKSKNRKKGSALDPEPQVKLE
FT                   DVLPLAFTRLCEPKEASYSLIRKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITG
FT                   KGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGANSN
FT                   YQMHLLKKTLQKCEKNGWLEQISGKGFSGTFQLSFPYYPSPGVLFPKKESGGSDDEDDD
FT                   DDDDESSEDSEDEEPPPKRSLQKKTPAKSQGKTASMKQRGSKPARKVPAAQRGKVRPLP
FT                   KKAPPKAKTPARKARPSPSVIKKPSGSSSRKPIASARKEAKLPGKGKSAMKKSFKTKK"
FT   CDS             join(219079..219160,220501..220621,224355..224514,
FT                   227094..227237,228122..228199,228806..228957,
FT                   232870..232960,235774..235933,238115..238226,
FT                   239200..239316,240023..240317)
FT                   /codon_start=1
FT                   /gene="Hp1bp3"
FT                   /locus_tag="mCG_14538"
FT                   /product="heterochromatin protein 1, binding protein 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG14538.2 transcript_id=mCT179558.0
FT                   protein_id=mCP102482.0 isoform=CRA_b"
FT                   /protein_id="EDL13247.1"
FT                   /translation="MPIRRAVNSTRETPPKSKLAEGEEEKPEEQENETPPATSSEAEQP
FT                   KGEPESGEKEENNSKSAEEPKKDEKDQSKEKEKKVKKTIPAWATLSASQLARAQRQTPM
FT                   ASSPRPKMDAILTEAIKACFQKTGASVVAIRKYIIHKYPSLGLERRGYLLKQALKRELN
FT                   RGVIRQVKGKGASGSFVVVQKSKPPQKSKNRKKGSALDPEPQVKLEDVLPLAFTRLCEP
FT                   KEASYSLIRKYVSQYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSG
FT                   EKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGANSNYQMHLLKKTLQKC
FT                   EKNGWLEQISGKGFSGTFQLSFPYYPSPGVLFPKKESGGSDDEDDDDDDDESSEDSEDE
FT                   EPPPKRSLQKKTPAKSQGKTASMKQRGSKPARKVPAAQRGKVRPLPKKAPPKAKTPARK
FT                   ARPSPSVIKKPSGSSSRKPIASARKEAKLPGKGKSAMKKSFKTKK"
FT   assembly_gap    222423..222442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    246950..247336
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   gene            249130..258024
FT                   /locus_tag="mCG_120641"
FT                   /note="gene_id=mCG120641.1"
FT   mRNA            join(249130..249214,252325..252402,252544..252671,
FT                   252986..253066,253411..253485,254262..254408,
FT                   255425..255676,255827..256001,256317..256425,
FT                   256881..257040,257757..258024)
FT                   /locus_tag="mCG_120641"
FT                   /product="mCG120641"
FT                   /note="gene_id=mCG120641.1 transcript_id=mCT121832.1
FT                   created on 23-MAY-2002"
FT   CDS             join(252585..252671,252986..253066,253411..253485,
FT                   254262..254408,255425..255676,255827..256001,
FT                   256317..256425,256881..257040,257757..257960)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120641"
FT                   /product="mCG120641"
FT                   /note="gene_id=mCG120641.1 transcript_id=mCT121832.1
FT                   protein_id=mCP53311.1"
FT                   /protein_id="EDL13254.1"
FT                   /translation="MQRAGAGARRASDCGPAPYRPRCIAKLAQYVGSFPVDDLDTQESV
FT                   GLVQQQLWALQDCSRRRAVILKFSLQGLKIYSGEGEVLLMAHALKRILYATWYPAACQF
FT                   AFVARNPRSPSSKLFCHLFVGSQPGEVHILYLLLCRSFQLAYLLQHPEERAQSEPCLAP
FT                   VGDLSPKPLCSPGVPPALVREPFSRDQLSQNVHALVSFRRLPAEGLLGSNGKELPESEG
FT                   RGGTRHIRLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAREAFPAAWEAWP
FT                   RGPGGPSCLVENEGSLTENIWAFAGLSRSCALSLLRRDVHGAFLLWPEPGTSDQWSLSV
FT                   RTQCGVVPHQVFRNHLGRFCLEHLPAEFPSLEALVESHAGVERSLFCPLSMGRLNPTYE
FT                   EQDCGTEGRFPRTLRPLSHAKSEAELQGLG"
FT   gene            260955..301923
FT                   /gene="Kif17"
FT                   /locus_tag="mCG_14547"
FT                   /note="gene_id=mCG14547.2"
FT   mRNA            join(260955..261437,267761..267907,268662..268763,
FT                   273743..273932,278420..278872,281948..282057,
FT                   286990..287143,288493..289049,289805..289885,
FT                   291898..292127,292638..292869,294236..294494,
FT                   296751..296818,298626..298746,301680..301923)
FT                   /gene="Kif17"
FT                   /locus_tag="mCG_14547"
FT                   /product="kinesin family member 17, transcript variant
FT                   mCT18543"
FT                   /note="gene_id=mCG14547.2 transcript_id=mCT18543.2 created
FT                   on 23-MAY-2002"
FT   mRNA            join(<261174..261437,267761..267907,268662..268763,
FT                   273743..273932,278420..278872,281948..282057,
FT                   289805..289885,291898..292127,292638..292869,
FT                   294236..294494,296751..296818,301680..301813)
FT                   /gene="Kif17"
FT                   /locus_tag="mCG_14547"
FT                   /product="kinesin family member 17, transcript variant
FT                   mCT190702"
FT                   /note="gene_id=mCG14547.2 transcript_id=mCT190702.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<261174..261437,267761..267907,268662..268763,
FT                   273743..273932,278420..278872,281948..282057,
FT                   289805..289885,291898..292127,292638..292869,
FT                   294236..294494,296751..296818,301680..301718)
FT                   /codon_start=1
FT                   /gene="Kif17"
FT                   /locus_tag="mCG_14547"
FT                   /product="kinesin family member 17, isoform CRA_b"
FT                   /note="gene_id=mCG14547.2 transcript_id=mCT190702.0
FT                   protein_id=mCP111661.0 isoform=CRA_b"
FT                   /protein_id="EDL13256.1"
FT                   /translation="TPWTGPRPRAAMASESVKVVVRCRPMNKRERELSCQSVVTVDSAR
FT                   GQCFIQNPGAADEPPKQFTFDGAYYIEHFTEQIYNEIAYPLVEGVTEGYNGTIFAYGQT
FT                   GSGKSFTMQGLPDPPCQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVHDLLG
FT                   ADTKQRLELKEHPEKGVYVKGLSMHTVHNVAQCERVMETGWKNRAVGYTLMNKDSSRSH
FT                   SIFTINIEIYAVDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSAL
FT                   GNVISALVDGRCKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYA
FT                   NRAKNIKNKPRINEDPKDALLREYQEEIKRLKAILAQQMGPGNLSALLSTQTPPGPVQS
FT                   EEKLLSPTTVQQDTEAEKQLIREPSSADLLEPSDTKSEADVADNVVVLGTEPDVNLRVA
FT                   EEVVSEAETGVWMESEAQVAHVAQVSEEAQPQPLLAMVSVRRESVGVEVAVLTEEELQP
FT                   VDQQQVLARLQLLEQQVVGGEQAKNKDLREKHKRRKRYADERKKQLVAALQNSDEDGGD
FT                   WVLLNVYDSIQEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERD
FT                   SMLFQQLLEQVQPLIRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILKTSLPVVPTGT
FT                   QNKPARKTSAVDSGEPHMHITTHHRGSIRL"
FT   CDS             join(261207..261437,267761..267907,268662..268763,
FT                   273743..273932,278420..278872,281948..282057,
FT                   286990..287143,288493..289049,289805..289885,
FT                   291898..292127,292638..292869,294236..294494,
FT                   296751..296818,298626..298746,301680..301858)
FT                   /codon_start=1
FT                   /gene="Kif17"
FT                   /locus_tag="mCG_14547"
FT                   /product="kinesin family member 17, isoform CRA_a"
FT                   /note="gene_id=mCG14547.2 transcript_id=mCT18543.2
FT                   protein_id=mCP4853.2 isoform=CRA_a"
FT                   /protein_id="EDL13255.1"
FT                   /translation="MASESVKVVVRCRPMNKRERELSCQSVVTVDSARGQCFIQNPGAA
FT                   DEPPKQFTFDGAYYIEHFTEQIYNEIAYPLVEGVTEGYNGTIFAYGQTGSGKSFTMQGL
FT                   PDPPCQRGIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVHDLLGADTKQRLELKE
FT                   HPEKGVYVKGLSMHTVHNVAQCERVMETGWKNRAVGYTLMNKDSSRSHSIFTINIEIYA
FT                   VDERGKDHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDGR
FT                   CKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPR
FT                   INEDPKDALLREYQEEIKRLKAILAQQMGPGNLSALLSTQTPPGPVQSEEKLLSPTTVQ
FT                   QDTEAEKQLIREEYEERLARLKADYEAEQESRVRLQEDITAMRNSYDVKLSTLQENLRK
FT                   EKETEAILKAEVLCKTEVMSRAELASGPEYSPPLQYETAVKPTILSMPDMPPSGKVTKS
FT                   QAPLAFEEPHGETSRSEFSFESNECSTLEDSATSEAFPGPEEFSNMEFSMAAALTESRY
FT                   LPEEYLGGQEAAASPLEAERYVQENEPSLEPLRILASLQDPFAEVEAKLARLSSTVAMS
FT                   DSSQTVVPQIPKQPSSADLLEPSDTKSEADVADNVVVLGTEPDVNLRVAEEVVSEAETG
FT                   VWMESEAQVAHVAQVSEEAQPQPLLAMVSVRRESVGVEVAVLTEEELQPVDQQQVLARL
FT                   QLLEQQVVGGEQAKNKDLREKHKRRKRYADERKKQLVAALQNSDEDGGDWVLLNVYDSI
FT                   QEEVRAKSKLLEKMQRKLRAAEVEIKDLQSEFQLEKIDYLATIRRQERDSMLFQQLLEQ
FT                   VQPLIRRDCNYSNLEKIRRESSWDEDNGFWKIPDPIILKTSLPVVPTGTQNKPARKTSA
FT                   VDSGEPHMQEEDRYKLMLSRSDSENIASNYFRSKRASQILSTDPMKSLTYHNSPPGLNS
FT                   SLSNNSALPPTQTPEMPQPRPFRLESLDIPFSKAKRKKSKNSFGGEPL"
FT   assembly_gap    264878..264907
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    270418..270437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    275945..275964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            305142..313034
FT                   /gene="Ddost"
FT                   /locus_tag="mCG_14545"
FT                   /note="gene_id=mCG14545.2"
FT   mRNA            join(305142..305446,305569..305679,310645..310682,
FT                   311017..311165,311255..311402,311826..311946,
FT                   312056..312162,312250..313034)
FT                   /gene="Ddost"
FT                   /locus_tag="mCG_14545"
FT                   /product="dolichyl-di-phosphooligosaccharide-protein
FT                   glycotransferase, transcript variant mCT169243"
FT                   /note="gene_id=mCG14545.2 transcript_id=mCT169243.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(305143..305446,305569..305679,311017..311165,
FT                   311255..311402,311826..311946,312056..312162,
FT                   312250..313033)
FT                   /gene="Ddost"
FT                   /locus_tag="mCG_14545"
FT                   /product="dolichyl-di-phosphooligosaccharide-protein
FT                   glycotransferase, transcript variant mCT169242"
FT                   /note="gene_id=mCG14545.2 transcript_id=mCT169242.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(305143..305446,305569..305679,308745..308831,
FT                   309857..309960,310097..310191,310589..310682,
FT                   311017..311165,311255..311402,311826..311946,
FT                   312056..312162,312250..312648)
FT                   /gene="Ddost"
FT                   /locus_tag="mCG_14545"
FT                   /product="dolichyl-di-phosphooligosaccharide-protein
FT                   glycotransferase, transcript variant mCT18541"
FT                   /note="gene_id=mCG14545.2 transcript_id=mCT18541.1 created
FT                   on 23-MAY-2002"
FT   CDS             join(305287..305446,305569..305679,308745..308831,
FT                   309857..309960,310097..310191,310589..310682,
FT                   311017..311165,311255..311402,311826..311946,
FT                   312056..312162,312250..312399)
FT                   /codon_start=1
FT                   /gene="Ddost"
FT                   /locus_tag="mCG_14545"
FT                   /product="dolichyl-di-phosphooligosaccharide-protein
FT                   glycotransferase, isoform CRA_c"
FT                   /note="gene_id=mCG14545.2 transcript_id=mCT18541.1
FT                   protein_id=mCP4885.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UG68"
FT                   /db_xref="InterPro:IPR005013"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="MGI:MGI:1194508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UG68"
FT                   /protein_id="EDL13259.1"
FT                   /translation="MKMDPRLAVRAWPLCGLLLAALGCVCASGPRTLVLLDNLNVRDTH
FT                   SLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAF
FT                   IDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTE
FT                   NLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAV
FT                   GRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALS
FT                   RWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIVIEQLSNGKWVPFDGDDIQL
FT                   EFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQ
FT                   HTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD"
FT   CDS             join(305287..305446,305569..305679,310645..310682,
FT                   311017..311165,311255..311402,311826..311946,
FT                   312056..312162,312250..312399)
FT                   /codon_start=1
FT                   /gene="Ddost"
FT                   /locus_tag="mCG_14545"
FT                   /product="dolichyl-di-phosphooligosaccharide-protein
FT                   glycotransferase, isoform CRA_b"
FT                   /note="gene_id=mCG14545.2 transcript_id=mCT169243.0
FT                   protein_id=mCP92056.0 isoform=CRA_b"
FT                   /protein_id="EDL13258.1"
FT                   /translation="MKMDPRLAVRAWPLCGLLLAALGCVCASGPRTLVLLDNLNVRDTH
FT                   SLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEASYSFFPDKPITQY
FT                   PHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELA
FT                   VALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIVIEQLSNGKWVPFDGD
FT                   DIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSV
FT                   RPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD"
FT   CDS             join(305602..305679,311017..311165,311255..311402,
FT                   311826..311946,312056..312162,312250..312399)
FT                   /codon_start=1
FT                   /gene="Ddost"
FT                   /locus_tag="mCG_14545"
FT                   /product="dolichyl-di-phosphooligosaccharide-protein
FT                   glycotransferase, isoform CRA_a"
FT                   /note="gene_id=mCG14545.2 transcript_id=mCT169242.0
FT                   protein_id=mCP92045.0 isoform=CRA_a"
FT                   /protein_id="EDL13257.1"
FT                   /translation="MTPACPSLSTGSSSMTTLSSFPRRWKYPHAVGRNTLLIAGLQARN
FT                   NARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGP
FT                   VSHHRVGEMAPPNAYTVTDLVEYSIVIEQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLK
FT                   RKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPY
FT                   YASAFSMMAGLFIFSIVFLHMKEKEKSD"
FT   assembly_gap    306734..307625
FT                   /estimated_length=892
FT                   /gap_type="unknown"
FT   gene            complement(313821..330629)
FT                   /gene="Pink1"
FT                   /locus_tag="mCG_14549"
FT                   /note="gene_id=mCG14549.2"
FT   mRNA            complement(join(313821..314629,315913..316149,
FT                   316420..316547,318517..318648,319972..320135,
FT                   320525..320707,322556..322656,323344..323507,
FT                   323937..324123))
FT                   /gene="Pink1"
FT                   /locus_tag="mCG_14549"
FT                   /product="PTEN induced putative kinase 1, transcript
FT                   variant mCT169246"
FT                   /note="gene_id=mCG14549.2 transcript_id=mCT169246.0 created
FT                   on 23-MAY-2002"
FT   mRNA            complement(join(313828..314629,315913..316149,
FT                   318521..318648,319972..320135,320525..320707,
FT                   322556..322656,330286..330629))
FT                   /gene="Pink1"
FT                   /locus_tag="mCG_14549"
FT                   /product="PTEN induced putative kinase 1, transcript
FT                   variant mCT18544"
FT                   /note="gene_id=mCG14549.2 transcript_id=mCT18544.2 created
FT                   on 23-MAY-2002"
FT   mRNA            complement(join(313952..314629,315913..316149,
FT                   316420..316547,319972..320135,320525..320707,
FT                   322556..322656,330262..330607))
FT                   /gene="Pink1"
FT                   /locus_tag="mCG_14549"
FT                   /product="PTEN induced putative kinase 1, transcript
FT                   variant mCT169245"
FT                   /note="gene_id=mCG14549.2 transcript_id=mCT169245.0 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(314372..314629,315913..316149,
FT                   318521..318648,319972..320135,320525..320707,
FT                   322556..322656,330286..330573))
FT                   /codon_start=1
FT                   /gene="Pink1"
FT                   /locus_tag="mCG_14549"
FT                   /product="PTEN induced putative kinase 1, isoform CRA_c"
FT                   /note="gene_id=mCG14549.2 transcript_id=mCT18544.2
FT                   protein_id=mCP4855.2 isoform=CRA_c"
FT                   /protein_id="EDL13262.1"
FT                   /translation="MAVRQALGRGLQLGRALLLRFAPKPGPLFGWGKPGPAAAWGRGER
FT                   PGRVVSPGAQPRPVGLPLPDRYRFFRQSVAGLAARIQRQFMVRARGGAGPCAGSSSEAI
FT                   LSKMSQELVPASRVALDGEYGAVTYRRSRDGPKQLAPHPNIIRVFRAFTSSVPLLPGAL
FT                   ADYPDMLPPHYYPEGLGHGRTLFLVMKNYPCTLRQYLEEQTPSSRLATMMTLQLLEGVD
FT                   HLVQQGIAHRDLKSDNILVEWDSDGCPWLVISDFGCCLADQHVGLRLPFNSSSVERGGN
FT                   GSLMAPEVSTAHSGPGAVIDYSKADTWAVGAIAYEIFGLANPFYGQGSAHLESRSYQEA
FT                   QLPEMPESVPPEARRLVRSLLQREASKRPSARLAANVLHLSLWGEHLLALKNLKLDKMI
FT                   AWLLQQSAATLLADRLREKSCVETKLQMLFLANLECEALCQAALLLSSWRAAP"
FT   CDS             complement(join(314372..314629,315913..316149,
FT                   316420..316547,319972..320135,320525..320707,
FT                   322556..322656,330262..330573))
FT                   /codon_start=1
FT                   /gene="Pink1"
FT                   /locus_tag="mCG_14549"
FT                   /product="PTEN induced putative kinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG14549.2 transcript_id=mCT169245.0
FT                   protein_id=mCP92044.0 isoform=CRA_a"
FT                   /protein_id="EDL13260.1"
FT                   /translation="MAVRQALGRGLQLGRALLLRFAPKPGPLFGWGKPGPAAAWGRGER
FT                   PGRVVSPGAQPRPVGLPLPDRYRFFRQSVAGLAARIQRQFMVRARGGAGPCGRAVFLAF
FT                   AGSSSEAILSKMSQELVPASRVALDGEYGAVTYRRSRDGPKQLAPHPNIIRVFRAFTSS
FT                   VPLLPGALADYPDMLPPHYYPEGLGHGRTLFLVMKNYPCTLRQYLEEQTPSSRLATMMT
FT                   LQLLEGVDHLVQQGIAHRDLKSDNILVEWDSDGCPWLVISDFGCCLADQHVGLRLPFNS
FT                   SSVERGGNGSLMAPEVSTAHSGPGAVIDYSKADTWAVGAIAYEIFGLANPFYGQGSAHL
FT                   ESRSYQEAQLPEMPESVPPEARRLVRSLLQREASKRPSARLAANVLHLSLWGEHLLALK
FT                   NLKLDKMIAWLLQQSAATLLADRLREKSCVETKLQMLFLANLECEALCQAALLLSSWRA
FT                   AP"
FT   CDS             complement(join(314372..314629,315913..316149,
FT                   316420..316547,318517..318648,319972..320135,
FT                   320525..320707,322556..322623))
FT                   /codon_start=1
FT                   /gene="Pink1"
FT                   /locus_tag="mCG_14549"
FT                   /product="PTEN induced putative kinase 1, isoform CRA_b"
FT                   /note="gene_id=mCG14549.2 transcript_id=mCT169246.0
FT                   protein_id=mCP92055.0 isoform=CRA_b"
FT                   /protein_id="EDL13261.1"
FT                   /translation="MSQELVPASRVALDGEYGAVTYRRSRDGPKQLAPHPNIIRVFRAF
FT                   TSSVPLLPGALADYPDMLPPHYYPEGLGHGRTLFLVMKNYPCTLRQYLEEQTPSSRLAT
FT                   MMTLQLLEGVDHLVQQGIAHRDLKSDNILVEWDSDGCPWLVISDFGCCLADQHVGLRLP
FT                   FNSSSVERGGNGSLMAPEVNGCPWLVISDFGCCLADQHVGLRLPFNSSSVERGGNGSLM
FT                   APEVSTAHSGPGAVIDYSKADTWAVGAIAYEIFGLANPFYGQGSAHLESRSYQEAQLPE
FT                   MPESVPPEARRLVRSLLQREASKRPSARLAANVLHLSLWGEHLLALKNLKLDKMIAWLL
FT                   QQSAATLLADRLREKSCVETKLQMLFLANLECEALCQAALLLSSWRAAP"
FT   assembly_gap    317078..317097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    320314..320457
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    323058..323077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    324319..324338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    325363..325382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    326710..326729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    329058..330261
FT                   /estimated_length=1204
FT                   /gap_type="unknown"
FT   gene            complement(342789..372646)
FT                   /gene="Cda"
FT                   /locus_tag="mCG_120640"
FT                   /note="gene_id=mCG120640.0"
FT   mRNA            complement(join(342789..343366,347868..347925,
FT                   355577..355688,372456..372646))
FT                   /gene="Cda"
FT                   /locus_tag="mCG_120640"
FT                   /product="cytidine deaminase"
FT                   /note="gene_id=mCG120640.0 transcript_id=mCT121831.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(join(343250..343366,347868..347925,
FT                   355577..355688,372456..372609))
FT                   /codon_start=1
FT                   /gene="Cda"
FT                   /locus_tag="mCG_120640"
FT                   /product="cytidine deaminase"
FT                   /note="gene_id=mCG120640.0 transcript_id=mCT121831.0
FT                   protein_id=mCP53309.1"
FT                   /protein_id="EDL13263.1"
FT                   /translation="MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTG
FT                   DGRIFSGCNIENACYPLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQ
FT                   VMREFGTDWAVYMTKPDGTFVVRTVQELLPASFGPEDLQKIQ"
FT   assembly_gap    359903..361215
FT                   /estimated_length=1313
FT                   /gap_type="unknown"
FT   assembly_gap    365869..366157
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    373841..376519
FT                   /estimated_length=2679
FT                   /gap_type="unknown"
FT   assembly_gap    379316..380240
FT                   /estimated_length=925
FT                   /gap_type="unknown"
FT   assembly_gap    381427..381681
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    386520..386539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    395665..395924
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   gene            401065..403567
FT                   /locus_tag="mCG_140451"
FT                   /note="gene_id=mCG140451.0"
FT   mRNA            join(401065..401454,401867..403567)
FT                   /locus_tag="mCG_140451"
FT                   /product="mCG140451"
FT                   /note="gene_id=mCG140451.0 transcript_id=mCT169609.0
FT                   created on 30-MAY-2002"
FT   CDS             join(401215..401454,401867..402001)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140451"
FT                   /product="mCG140451"
FT                   /note="gene_id=mCG140451.0 transcript_id=mCT169609.0
FT                   protein_id=mCP92454.0"
FT                   /db_xref="GOA:Q9JJ83"
FT                   /db_xref="MGI:MGI:1931024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JJ83"
FT                   /protein_id="EDL13264.1"
FT                   /translation="MLLAHVARIALALQPLEVAEGRQRSLVEQAGQGARLVRPRQQHSV
FT                   AAQHHGLVACLVAVDPGEDSRVAPIRRAVGDARQQGSIAAAQRAGSAGKLTWVLERPKA
FT                   LRSPPPRTCDKLGGGRRQSL"
FT   assembly_gap    406266..406285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    407902..407921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    409038..410429
FT                   /estimated_length=1392
FT                   /gap_type="unknown"
FT   assembly_gap    411651..411670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    413465..413484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    416178..416197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    418103..418122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    419214..420962
FT                   /estimated_length=1749
FT                   /gap_type="unknown"
FT   assembly_gap    421962..422043
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            433563..433895
FT                   /locus_tag="mCG_14541"
FT                   /note="gene_id=mCG14541.0"
FT   mRNA            433563..433895
FT                   /locus_tag="mCG_14541"
FT                   /product="mCG14541"
FT                   /note="gene_id=mCG14541.0 transcript_id=mCT18418.0 created
FT                   on 23-JUL-2002"
FT   CDS             433633..433845
FT                   /codon_start=1
FT                   /locus_tag="mCG_14541"
FT                   /product="mCG14541"
FT                   /note="gene_id=mCG14541.0 transcript_id=mCT18418.0
FT                   protein_id=mCP4879.1"
FT                   /db_xref="GOA:Q52KP0"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="MGI:MGI:1914921"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KP0"
FT                   /protein_id="EDL13265.1"
FT                   /translation="MPRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSRYLYTL
FT                   VITDKEKAEKLKQSLPPGLAVKDLK"
FT   assembly_gap    435475..436421
FT                   /estimated_length=947
FT                   /gap_type="unknown"
FT   gene            442660..450258
FT                   /gene="0610009K11Rik"
FT                   /locus_tag="mCG_14534"
FT                   /note="gene_id=mCG14534.3"
FT   mRNA            join(442660..442870,445665..445752,446279..446399,
FT                   446988..450258)
FT                   /gene="0610009K11Rik"
FT                   /locus_tag="mCG_14534"
FT                   /product="RIKEN cDNA 0610009K11, transcript variant
FT                   mCT18411"
FT                   /note="gene_id=mCG14534.3 transcript_id=mCT18411.2 created
FT                   on 11-JUN-2003"
FT   mRNA            join(442696..442870,444214..444434,445665..445752,
FT                   446279..446399,446988..447952)
FT                   /gene="0610009K11Rik"
FT                   /locus_tag="mCG_14534"
FT                   /product="RIKEN cDNA 0610009K11, transcript variant
FT                   mCT169233"
FT                   /note="gene_id=mCG14534.3 transcript_id=mCT169233.0 created
FT                   on 11-JUN-2003"
FT   mRNA            join(442718..442870,446279..446399,446988..447940)
FT                   /gene="0610009K11Rik"
FT                   /locus_tag="mCG_14534"
FT                   /product="RIKEN cDNA 0610009K11, transcript variant
FT                   mCT169232"
FT                   /note="gene_id=mCG14534.3 transcript_id=mCT169232.1 created
FT                   on 11-JUN-2003"
FT   CDS             join(442751..442870,445665..445752,446279..446399,
FT                   446988..447717)
FT                   /codon_start=1
FT                   /gene="0610009K11Rik"
FT                   /locus_tag="mCG_14534"
FT                   /product="RIKEN cDNA 0610009K11, isoform CRA_b"
FT                   /note="gene_id=mCG14534.3 transcript_id=mCT18411.2
FT                   protein_id=mCP4866.2 isoform=CRA_b"
FT                   /protein_id="EDL13267.1"
FT                   /translation="MESGSRPSLGQVILLGTSSMVTAVLYSIYRQKAQVAQELKGAKKI
FT                   HLGEDLKGILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLSLQEHKMVWN
FT                   RTTHLWNDYSKIIHQRTNTVPFDLVPHEDGVAVSVRVLKPLDSVDLGLETVYEKFHPSV
FT                   QSFTDAIGHYISGERPKGIQETEEMLKVGATLTGIGELVLDNNAVRLQPPKQGMQYYLS
FT                   SQDFDSLLHRQESSVRLWKILVLVFGFATCATLFFILRKQYLHRQERLRQQQLQEEFLE
FT                   HEAQLLSQASPEDRESLKSACVVCLSNFKSCVFLECGHVCSCRQCYLALPEPKRCPICR
FT                   REITRVIPLYNS"
FT   assembly_gap    442944..442969
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   CDS             join(444330..444434,445665..445752,446279..446399,
FT                   446988..447717)
FT                   /codon_start=1
FT                   /gene="0610009K11Rik"
FT                   /locus_tag="mCG_14534"
FT                   /product="RIKEN cDNA 0610009K11, isoform CRA_a"
FT                   /note="gene_id=mCG14534.3 transcript_id=mCT169233.0
FT                   protein_id=mCP92039.0 isoform=CRA_a"
FT                   /protein_id="EDL13266.1"
FT                   /translation="MVVVLCWLEFHSPSAKDLFWQLYGRWTLEPKSYHQGAKKIHLGED
FT                   LKGILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLSLQEHKMVWNRTTHL
FT                   WNDYSKIIHQRTNTVPFDLVPHEDGVAVSVRVLKPLDSVDLGLETVYEKFHPSVQSFTD
FT                   AIGHYISGERPKGIQETEEMLKVGATLTGIGELVLDNNAVRLQPPKQGMQYYLSSQDFD
FT                   SLLHRQESSVRLWKILVLVFGFATCATLFFILRKQYLHRQERLRQQQLQEEFLEHEAQL
FT                   LSQASPEDRESLKSACVVCLSNFKSCVFLECGHVCSCRQCYLALPEPKRCPICRREITR
FT                   VIPLYNS"
FT   CDS             join(446371..446399,446988..447717)
FT                   /codon_start=1
FT                   /gene="0610009K11Rik"
FT                   /locus_tag="mCG_14534"
FT                   /product="RIKEN cDNA 0610009K11, isoform CRA_c"
FT                   /note="gene_id=mCG14534.3 transcript_id=mCT169232.1
FT                   protein_id=mCP92059.1 isoform=CRA_c"
FT                   /protein_id="EDL13268.1"
FT                   /translation="MVWNRTTHLWNDYSKIIHQRTNTVPFDLVPHEDGVAVSVRVLKPL
FT                   DSVDLGLETVYEKFHPSVQSFTDAIGHYISGERPKGIQETEEMLKVGATLTGIGELVLD
FT                   NNAVRLQPPKQGMQYYLSSQDFDSLLHRQESSVRLWKILVLVFGFATCATLFFILRKQY
FT                   LHRQERLRQQQLQEEFLEHEAQLLSQASPEDRESLKSACVVCLSNFKSCVFLECGHVCS
FT                   CRQCYLALPEPKRCPICRREITRVIPLYNS"
FT   assembly_gap    452183..453079
FT                   /estimated_length=897
FT                   /gap_type="unknown"
FT   assembly_gap    458663..459361
FT                   /estimated_length=699
FT                   /gap_type="unknown"
FT   assembly_gap    460729..461224
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   gene            461501..462381
FT                   /locus_tag="mCG_147451"
FT                   /note="gene_id=mCG147451.0"
FT   mRNA            461501..462381
FT                   /locus_tag="mCG_147451"
FT                   /product="mCG147451"
FT                   /note="gene_id=mCG147451.0 transcript_id=mCT187714.0
FT                   created on 13-JAN-2004"
FT   CDS             461699..461992
FT                   /codon_start=1
FT                   /locus_tag="mCG_147451"
FT                   /product="mCG147451"
FT                   /note="gene_id=mCG147451.0 transcript_id=mCT187714.0
FT                   protein_id=mCP108133.0"
FT                   /protein_id="EDL13269.1"
FT                   /translation="MNPILKQKVTFLRTDALGRPLPGLVFERQLKSLRFFVAVQLFAQV
FT                   NTNSGFYMSERRRRKTKTNLLELFLASLGALLSEPLFLLQYCVTLSILFNGL"
FT   assembly_gap    465287..465449
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    465774..465816
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    469380..469399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    481227..484005
FT                   /estimated_length=2779
FT                   /gap_type="unknown"
FT   assembly_gap    496448..496684
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    503717..503736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    506313..506332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    508487..508948
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    514367..514875
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    516508..516601
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    523421..523598
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    525344..525625
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    529397..529642
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    535568..535747
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    537241..537363
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    548245..548360
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    555795..556240
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    560578..560622
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    567909..568112
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   gene            complement(<574966..631459)
FT                   /locus_tag="mCG_14536"
FT                   /note="gene_id=mCG14536.1"
FT   mRNA            complement(join(<574966..575466,576877..576994,
FT                   577771..577840,578469..578543,581199..581324,
FT                   584453..584590,586730..587050,587404..587605,
FT                   592446..592636,594411..594582,596725..596910,
FT                   597239..597353,597813..598015,600153..600263,
FT                   606280..606456,610899..611023,611569..611700,
FT                   612569..612714,614881..615136,616829..616972,
FT                   618909..619070,631351..631459))
FT                   /locus_tag="mCG_14536"
FT                   /product="mCG14536"
FT                   /note="gene_id=mCG14536.1 transcript_id=mCT18414.1 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(574966..575466,576877..576994,
FT                   577771..577840,578469..578543,581199..581324,
FT                   584453..584590,586730..587050,587404..587605,
FT                   592446..592636,594411..594582,596725..596910,
FT                   597239..597353,597813..598015,600153..600263,
FT                   606280..606456,610899..611023,611569..611700,
FT                   612569..612714,614881..615136,616829..616972,
FT                   618909..619047))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14536"
FT                   /product="mCG14536"
FT                   /note="gene_id=mCG14536.1 transcript_id=mCT18414.1
FT                   protein_id=mCP4872.2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="MGI:MGI:1922968"
FT                   /db_xref="UniProtKB/TrEMBL:B1AZ81"
FT                   /protein_id="EDL13270.1"
FT                   /translation="MPGLLNCLTGAALPLMESDVTSYVSGYALGLTASLTYGNLEAQPF
FT                   QGLFVYPIDEYSTVVGFEAVIADRVVTIQLRDKAKLDRSHLDIQPATVTGNFPEEESPI
FT                   APGKVTLDEDLERVLFVVNLGTIAPMENVTVFISTSSELPTLPSGAVRVLLPAICAPTV
FT                   PPSCTHRFGSSSPQPQGKDPHCFGTQTKDSYNRLCLATLLDTKVTNPMEYEFKFQLEIR
FT                   GPCLLAGVESPTHEIRADAAPSAHSAKSIIITLAKKHTFDRPVEILLHPSEPHMPHVLV
FT                   EKGDMTLGEYDQHLKGKADFIRGTKKDNSAERKTEVIRKRLHKDIPHHSVIMLNFCPDL
FT                   QSVQPNPRKAHGEFIFLIDRSNSMSKTNIQCIKEAMLVALKSLMPACFFNIIGFGSTFK
FT                   AVFASSRIYNEENLTMACDCIQRMQADMGGTNMLSPLKWVLRQPLRRGHPRLLFLITDG
FT                   SVNNTGKVLELVRNHASSTRCYSFGIGPTVCYRLVKGLASVSKGSAEFLMEGERLQPKM
FT                   VKSLKKAMAPVLSDVTVEWVFPETTEALISPVSTSSLFPGERLMGYGIVCDASLYISNS
FT                   RSDKRRKYGMLHTQESSSSVFYPSQDEGLSPGSGNCAKNVNQGQTKDAHPCNGDSPTHH
FT                   GLDVSRRRRAYSTNQISSHKTCPRATTASDPTGTARRYPLRKAKVQDLASESDWESQKW
FT                   QTDLQTLLNEGHNLSQGPKLHGPGARRPSLLPQGCQLMRFFDQKPQAWGPVRELDCGAS
FT                   RTSAPNSQSSEDLAIEPAHCPSTFERETSLDLEPMAESEEQANPCRTATPSPVVGKALV
FT                   KGLCANQRMQWEVSFELEPPALKRGDTQNADMWSETFHHLAARAIIREFEHLAEREDEI
FT                   ELGSNRRYQVNAVHTSKACSVISKYTAFVPVDINKRQYLPTVVKYPNSGAMLSFRNLTR
FT                   QWGGSSAGLGRPQSMLREHSSAAGDSKFQTLALQDSPTSTFNKTPSPGHEKQTTAEGPP
FT                   QNLSASAPSSMKATETLFGSKLNLNKSRLLTRATKGFLSKSLPKASEATPGSQSSDYIP
FT                   LVSLQLASGAFLLNEAFCTTIQIPMEKLKWTSPFSCLRMSLVTRRQDLKTQSPQDCTSL
FT                   SSSPPSCDGISLKSEESSDQESNAMLEHMGKLWATVVALAWLEHSSANYIIEWELVAAK
FT                   ASSWVEKQKVPEGRTLSTLKNTARQLFVLLRHWDEKLEFNMLCYNPNYV"
FT   assembly_gap    582656..582857
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    591002..591367
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    594941..594960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    620807..620833
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    627853..627872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    632494..634083
FT                   /estimated_length=1590
FT                   /gap_type="unknown"
FT   assembly_gap    642756..642870
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    653277..653320
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    658429..658599
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    668303..668876
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    669544..675802
FT                   /estimated_length=6259
FT                   /gap_type="unknown"
FT   assembly_gap    677047..677066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    678109..694111
FT                   /estimated_length=16003
FT                   /gap_type="unknown"
FT   assembly_gap    701163..701467
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    712995..713135
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            complement(713136..740108)
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /note="gene_id=mCG14546.3"
FT   mRNA            complement(join(713136..713558,719538..719797,
FT                   722658..724325,728120..728162))
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /product="UBX domain containing 3, transcript variant
FT                   mCT185274"
FT                   /note="gene_id=mCG14546.3 transcript_id=mCT185274.1 created
FT                   on 03-JUN-2004"
FT   assembly_gap    715668..715687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(721486..724325,735071..735145,
FT                   738808..739136,740050..740108))
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /product="UBX domain containing 3, transcript variant
FT                   mCT185275"
FT                   /note="gene_id=mCG14546.3 transcript_id=mCT185275.1 created
FT                   on 03-JUN-2004"
FT   mRNA            complement(join(721486..724325,728120..728206))
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /product="UBX domain containing 3, transcript variant
FT                   mCT169244"
FT                   /note="gene_id=mCG14546.3 transcript_id=mCT169244.2 created
FT                   on 03-JUN-2004"
FT   mRNA            complement(join(721486..724325,724447..724594,
FT                   727728..727795))
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /product="UBX domain containing 3, transcript variant
FT                   mCT18542"
FT                   /note="gene_id=mCG14546.3 transcript_id=mCT18542.4 created
FT                   on 03-JUN-2004"
FT   CDS             complement(723477..724310)
FT                   /codon_start=1
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /product="UBX domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG14546.3 transcript_id=mCT169244.2
FT                   protein_id=mCP92040.1 isoform=CRA_a"
FT                   /protein_id="EDL13271.1"
FT                   /translation="MAIEAPVNFAPPERSTVVSTAGDSSTWQPSSLRMHVIRPKSAKGR
FT                   KRPNLHRPQGMGDGSPSALSSSPPPRSSGSPSNQKPGVCATVSTSQGAPDEMPELLLQQ
FT                   APTRTASSLNRYPVLPSINRRSLEVGAVDTVASKTSSLQLSSVQALYQEDSSQEDSRTQ
FT                   VCALEKKFIIRTKRQSSSRASNIEEPSDEEPRLLLAVRSPSGQRFVRYFRPSDDLQTVL
FT                   EVAEQKNKATYQHCSIETMEVPRRRFSDLTKSLQECGILHKSVLGISQEEGEAWP"
FT   CDS             complement(723477..724310)
FT                   /codon_start=1
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /product="UBX domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG14546.3 transcript_id=mCT185274.1
FT                   protein_id=mCP106532.1 isoform=CRA_a"
FT                   /protein_id="EDL13272.1"
FT                   /translation="MAIEAPVNFAPPERSTVVSTAGDSSTWQPSSLRMHVIRPKSAKGR
FT                   KRPNLHRPQGMGDGSPSALSSSPPPRSSGSPSNQKPGVCATVSTSQGAPDEMPELLLQQ
FT                   APTRTASSLNRYPVLPSINRRSLEVGAVDTVASKTSSLQLSSVQALYQEDSSQEDSRTQ
FT                   VCALEKKFIIRTKRQSSSRASNIEEPSDEEPRLLLAVRSPSGQRFVRYFRPSDDLQTVL
FT                   EVAEQKNKATYQHCSIETMEVPRRRFSDLTKSLQECGILHKSVLGISQEEGEAWP"
FT   CDS             complement(723477..724310)
FT                   /codon_start=1
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /product="UBX domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG14546.3 transcript_id=mCT185275.1
FT                   protein_id=mCP106533.1 isoform=CRA_a"
FT                   /protein_id="EDL13273.1"
FT                   /translation="MAIEAPVNFAPPERSTVVSTAGDSSTWQPSSLRMHVIRPKSAKGR
FT                   KRPNLHRPQGMGDGSPSALSSSPPPRSSGSPSNQKPGVCATVSTSQGAPDEMPELLLQQ
FT                   APTRTASSLNRYPVLPSINRRSLEVGAVDTVASKTSSLQLSSVQALYQEDSSQEDSRTQ
FT                   VCALEKKFIIRTKRQSSSRASNIEEPSDEEPRLLLAVRSPSGQRFVRYFRPSDDLQTVL
FT                   EVAEQKNKATYQHCSIETMEVPRRRFSDLTKSLQECGILHKSVLGISQEEGEAWP"
FT   CDS             complement(723477..724310)
FT                   /codon_start=1
FT                   /gene="Ubxd3"
FT                   /locus_tag="mCG_14546"
FT                   /product="UBX domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG14546.3 transcript_id=mCT18542.4
FT                   protein_id=mCP4856.3 isoform=CRA_a"
FT                   /protein_id="EDL13274.1"
FT                   /translation="MAIEAPVNFAPPERSTVVSTAGDSSTWQPSSLRMHVIRPKSAKGR
FT                   KRPNLHRPQGMGDGSPSALSSSPPPRSSGSPSNQKPGVCATVSTSQGAPDEMPELLLQQ
FT                   APTRTASSLNRYPVLPSINRRSLEVGAVDTVASKTSSLQLSSVQALYQEDSSQEDSRTQ
FT                   VCALEKKFIIRTKRQSSSRASNIEEPSDEEPRLLLAVRSPSGQRFVRYFRPSDDLQTVL
FT                   EVAEQKNKATYQHCSIETMEVPRRRFSDLTKSLQECGILHKSVLGISQEEGEAWP"
FT   gene            728679..747506
FT                   /gene="Pla2g2c"
FT                   /locus_tag="mCG_14539"
FT                   /note="gene_id=mCG14539.1"
FT   mRNA            join(728679..728796,734463..734563,737201..737345,
FT                   738921..739024,746532..747506)
FT                   /gene="Pla2g2c"
FT                   /locus_tag="mCG_14539"
FT                   /product="phospholipase A2, group IIC"
FT                   /note="gene_id=mCG14539.1 transcript_id=mCT18415.1 created
FT                   on 23-MAY-2002"
FT   CDS             join(734524..734563,737201..737345,738921..739024,
FT                   746532..746695)
FT                   /codon_start=1
FT                   /gene="Pla2g2c"
FT                   /locus_tag="mCG_14539"
FT                   /product="phospholipase A2, group IIC"
FT                   /note="gene_id=mCG14539.1 transcript_id=mCT18415.1
FT                   protein_id=mCP4878.2"
FT                   /db_xref="GOA:A2APR1"
FT                   /db_xref="InterPro:IPR001211"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="InterPro:IPR033112"
FT                   /db_xref="InterPro:IPR033113"
FT                   /db_xref="MGI:MGI:106638"
FT                   /db_xref="UniProtKB/TrEMBL:A2APR1"
FT                   /protein_id="EDL13275.1"
FT                   /translation="MKGIAIFLVFIFYWTTSTLSSFWQFQRMVKHVTGRSAFFSYYGYG
FT                   CYCGLGGKGLPVDATDRCCWAHDCCYHKLKEYGCQPILNAYQFTIVNGTVTCGCTVASS
FT                   CLCGQKACECDKQSVYCFKENLATYEKAFKQLFPTRPQCGRDKLQC"
FT   assembly_gap    751229..751248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(754783..760819)
FT                   /gene="Pla2g2f"
FT                   /locus_tag="mCG_14537"
FT                   /note="gene_id=mCG14537.2"
FT   mRNA            complement(join(754783..755645,756485..756594,
FT                   757348..757492,759929..759981,760583..760819))
FT                   /gene="Pla2g2f"
FT                   /locus_tag="mCG_14537"
FT                   /product="phospholipase A2, group IIF"
FT                   /note="gene_id=mCG14537.2 transcript_id=mCT18412.2 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(755434..755645,756485..756594,
FT                   757348..757492,759929..759968))
FT                   /codon_start=1
FT                   /gene="Pla2g2f"
FT                   /locus_tag="mCG_14537"
FT                   /product="phospholipase A2, group IIF"
FT                   /note="gene_id=mCG14537.2 transcript_id=mCT18412.2
FT                   protein_id=mCP4874.1"
FT                   /protein_id="EDL13276.1"
FT                   /translation="MKKFFAIAVLAGSVVTTAHSSLLNLKSMVEAITHRNSILSFVGYG
FT                   CYCGLGGRGHPMDEVDWCCHAHDCCYEKLFEQGCRPYVDHYDHRIENGTMIVCTELNET
FT                   ECDKQTCECDKSLTLCLKDHPYRNKYRGYFNVYCQGPTPNCSIYDPYPEEVTCGHGLPA
FT                   TPVST"
FT   assembly_gap    762751..762770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    770000..770245
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    773597..773702
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    777677..777747
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            779254..785662
FT                   /gene="Pla2g2d"
FT                   /locus_tag="mCG_14535"
FT                   /note="gene_id=mCG14535.1"
FT   mRNA            join(779254..779369,782160..782304,782868..782974,
FT                   783767..785662)
FT                   /gene="Pla2g2d"
FT                   /locus_tag="mCG_14535"
FT                   /product="phospholipase A2, group IID, transcript variant
FT                   mCT18413"
FT                   /note="gene_id=mCG14535.1 transcript_id=mCT18413.1 created
FT                   on 23-MAY-2002"
FT   CDS             join(779333..779369,782160..782304,782868..782974,
FT                   783767..783912)
FT                   /codon_start=1
FT                   /gene="Pla2g2d"
FT                   /locus_tag="mCG_14535"
FT                   /product="phospholipase A2, group IID, isoform CRA_b"
FT                   /note="gene_id=mCG14535.1 transcript_id=mCT18413.1
FT                   protein_id=mCP4868.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TYT9"
FT                   /db_xref="InterPro:IPR001211"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="InterPro:IPR033112"
FT                   /db_xref="InterPro:IPR033113"
FT                   /db_xref="MGI:MGI:1341796"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TYT9"
FT                   /protein_id="EDL13278.1"
FT                   /translation="MRLALLCGLLLAGITATQGGLLNLNKMVTHMTGKKAFFSYWPYGC
FT                   HCGLGGKGQPKDATDWCCQKHDCCYAHLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCE
FT                   RQLCACDKEVALCLKQNLDSYNKRLRYYWRPRCKGKTPAC"
FT   mRNA            join(781412..781488,782160..782304,782868..782974,
FT                   783767..784644)
FT                   /gene="Pla2g2d"
FT                   /locus_tag="mCG_14535"
FT                   /product="phospholipase A2, group IID, transcript variant
FT                   mCT169234"
FT                   /note="gene_id=mCG14535.1 transcript_id=mCT169234.0 created
FT                   on 23-MAY-2002"
FT   CDS             join(782201..782304,782868..782974,783767..783912)
FT                   /codon_start=1
FT                   /gene="Pla2g2d"
FT                   /locus_tag="mCG_14535"
FT                   /product="phospholipase A2, group IID, isoform CRA_a"
FT                   /note="gene_id=mCG14535.1 transcript_id=mCT169234.0
FT                   protein_id=mCP92053.0 isoform=CRA_a"
FT                   /protein_id="EDL13277.1"
FT                   /translation="MVTHMTGKKAFFSYWPYGCHCGLGGKGQPKDATDWCCQKHDCCYA
FT                   HLKIDGCKSLTDNYKYSISQGTIQCSDNGSWCERQLCACDKEVALCLKQNLDSYNKRLR
FT                   YYWRPRCKGKTPAC"
FT   assembly_gap    790238..790257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    791612..791631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    796193..796212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    802439..802482
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            complement(804618..870024)
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /note="gene_id=mCG14533.3"
FT   mRNA            complement(join(804618..806034,806725..806831,
FT                   809880..810024,812808..812857,825644..825759,
FT                   869717..>870015))
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /product="phospholipase A2, group V, transcript variant
FT                   mCT190699"
FT                   /note="gene_id=mCG14533.3 transcript_id=mCT190699.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(804631..806034,806725..806831,
FT                   809880..810024,812808..812857,825644..825873))
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /product="phospholipase A2, group V, transcript variant
FT                   mCT18410"
FT                   /note="gene_id=mCG14533.3 transcript_id=mCT18410.1 created
FT                   on 23-MAY-2002"
FT   mRNA            complement(join(805585..806034,806725..806831,
FT                   812808..812857,825644..825759,869717..870024))
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /product="phospholipase A2, group V, transcript variant
FT                   mCT169231"
FT                   /note="gene_id=mCG14533.3 transcript_id=mCT169231.0 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(805913..806034,806725..806831,
FT                   809880..810024,812808..812857,825644..>825684))
FT                   /codon_start=1
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /product="phospholipase A2, group V, isoform CRA_d"
FT                   /note="gene_id=mCG14533.3 transcript_id=mCT190699.0
FT                   protein_id=mCP111659.0 isoform=CRA_d"
FT                   /protein_id="EDL13282.1"
FT                   /translation="ERALGTGAETRLQRTQEMKGLLTLAWFLACSVPAVPGGLLELKSM
FT                   IEKVTRKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYD
FT                   YRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC"
FT   CDS             complement(join(805913..806034,806725..806831,
FT                   809880..810024,812808..812847))
FT                   /codon_start=1
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /product="phospholipase A2, group V, isoform CRA_c"
FT                   /note="gene_id=mCG14533.3 transcript_id=mCT18410.1
FT                   protein_id=mCP4867.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q6GTW1"
FT                   /db_xref="InterPro:IPR001211"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="InterPro:IPR033112"
FT                   /db_xref="InterPro:IPR033113"
FT                   /db_xref="MGI:MGI:101899"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GTW1"
FT                   /protein_id="EDL13281.1"
FT                   /translation="MKGLLTLAWFLACSVPAVPGGLLELKSMIEKVTRKNAFKNYGFYG
FT                   CYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCP
FT                   MRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC"
FT   CDS             complement(join(805913..806034,806725..806821))
FT                   /codon_start=1
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /product="phospholipase A2, group V, isoform CRA_b"
FT                   /note="gene_id=mCG14533.3 transcript_id=mCT169231.0
FT                   protein_id=mCP92050.0 isoform=CRA_b"
FT                   /protein_id="EDL13280.1"
FT                   /translation="MHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCAC
FT                   DRKLVYCLRRNLWTYNPLYQYYPNFLC"
FT   mRNA            complement(join(809952..810024,812705..812857,
FT                   825644..825875))
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /product="phospholipase A2, group V, transcript variant
FT                   mCT169230"
FT                   /note="gene_id=mCG14533.3 transcript_id=mCT169230.0 created
FT                   on 23-MAY-2002"
FT   assembly_gap    811061..811080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(812782..812847)
FT                   /codon_start=1
FT                   /gene="Pla2g5"
FT                   /locus_tag="mCG_14533"
FT                   /product="phospholipase A2, group V, isoform CRA_a"
FT                   /note="gene_id=mCG14533.3 transcript_id=mCT169230.0
FT                   protein_id=mCP92036.0 isoform=CRA_a"
FT                   /protein_id="EDL13279.1"
FT                   /translation="MKGLLTLAWFLACSEYWLYDL"
FT   assembly_gap    822865..822920
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            <838466..841792
FT                   /locus_tag="mCG_14532"
FT                   /note="gene_id=mCG14532.1"
FT   mRNA            join(<838466..838507,839268..839320,839497..839642,
FT                   839875..839984,841356..841792)
FT                   /locus_tag="mCG_14532"
FT                   /product="mCG14532, transcript variant mCT18409"
FT                   /note="gene_id=mCG14532.1 transcript_id=mCT18409.1 created
FT                   on 23-MAY-2002"
FT   mRNA            join(<838479..838507,839268..839320,839497..839642,
FT                   839875..839984,840349..840775)
FT                   /locus_tag="mCG_14532"
FT                   /product="mCG14532, transcript variant mCT169229"
FT                   /note="gene_id=mCG14532.1 transcript_id=mCT169229.0 created
FT                   on 23-MAY-2002"
FT   CDS             join(<839620..839642,839875..839984,841356..841498)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14532"
FT                   /product="mCG14532, isoform CRA_a"
FT                   /note="gene_id=mCG14532.1 transcript_id=mCT18409.1
FT                   protein_id=mCP4862.1 isoform=CRA_a"
FT                   /protein_id="EDL13283.1"
FT                   /translation="SPKDATDRCCVTHDCCYKRLEKSGCGTKLLKYKYSHQGGQITCSA
FT                   NQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC"
FT   CDS             join(<839620..839642,839875..839984,840349..840689)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14532"
FT                   /product="mCG14532, isoform CRA_b"
FT                   /note="gene_id=mCG14532.1 transcript_id=mCT169229.0
FT                   protein_id=mCP92067.0 isoform=CRA_b"
FT                   /protein_id="EDL13284.1"
FT                   /translation="SPKDATDRCCVTHDCCYKRLEKSGCGTKLLKYKYSHQGGQITCSG
FT                   EDESEQWDNEGTRSSQDFLDIVHSSNGDLLLSKAARSTFVSLAAECLGHRSWGGGANEP
FT                   CYLQEKVVRVGSSLAHTWVRIRKSMLPGLGNFYSTGSVLLLGSGTVSASVLIL"
FT   assembly_gap    849294..849313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    867281..867419
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    882434..882627
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   gene            884517..889390
FT                   /gene="Pla2g2e"
FT                   /locus_tag="mCG_9087"
FT                   /note="gene_id=mCG9087.1"
FT   mRNA            join(884517..884647,885998..886071,886926..887064,
FT                   887245..887351,888991..889390)
FT                   /gene="Pla2g2e"
FT                   /locus_tag="mCG_9087"
FT                   /product="phospholipase A2, group IIE"
FT                   /note="gene_id=mCG9087.1 transcript_id=mCT9219.1 created on
FT                   23-MAY-2002"
FT   CDS             join(886032..886071,886926..887064,887245..887351,
FT                   888991..889133)
FT                   /codon_start=1
FT                   /gene="Pla2g2e"
FT                   /locus_tag="mCG_9087"
FT                   /product="phospholipase A2, group IIE"
FT                   /note="gene_id=mCG9087.1 transcript_id=mCT9219.1
FT                   protein_id=mCP4883.2"
FT                   /db_xref="GOA:Q3UG05"
FT                   /db_xref="InterPro:IPR001211"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="InterPro:IPR033113"
FT                   /db_xref="MGI:MGI:1349660"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UG05"
FT                   /protein_id="EDL13285.1"
FT                   /translation="MKPPIALACLCLLVPLAGGNLVQFGVMIERMTGKPALQYNDYGCY
FT                   CGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCDPKLEKYLFSITRDNIFCAGRTACQRH
FT                   TCECDKRAALCFRHNLNTYNRKYAHYPNKLCTGPTPPC"
FT   assembly_gap    892770..892822
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(902065..920561)
FT                   /locus_tag="mCG_9090"
FT                   /note="gene_id=mCG9090.1"
FT   mRNA            complement(join(902065..902597,903400..903581,
FT                   904171..904267,904621..904746,908466..908588,
FT                   911771..911883,916011..916159,920137..920561))
FT                   /locus_tag="mCG_9090"
FT                   /product="mCG9090, transcript variant mCT9222"
FT                   /note="gene_id=mCG9090.1 transcript_id=mCT9222.1 created on
FT                   06-FEB-2003"
FT   mRNA            complement(join(902066..902597,903400..903581,
FT                   904171..904267,904621..904752,908466..908588,
FT                   911771..911883,916011..916159,920137..920483))
FT                   /locus_tag="mCG_9090"
FT                   /product="mCG9090, transcript variant mCT179630"
FT                   /note="gene_id=mCG9090.1 transcript_id=mCT179630.0 created
FT                   on 06-FEB-2003"
FT   CDS             complement(join(902421..902597,903400..903581,
FT                   904171..904267,904621..904746,908466..908588,
FT                   911771..911883,916011..916159,920137..920354))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9090"
FT                   /product="mCG9090, isoform CRA_b"
FT                   /note="gene_id=mCG9090.1 transcript_id=mCT9222.1
FT                   protein_id=mCP4857.2 isoform=CRA_b"
FT                   /protein_id="EDL13287.1"
FT                   /translation="MSRKQAAKSRPGSGGRRAEAERKRDERAARRALAKERRNRPDPGG
FT                   SGCEEEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIR
FT                   QREDFEPFVEDDIPFEKHVASLSKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRG
FT                   TDKGSTRELHIAYRYGEHYDSVRRINDNSEAPAHLLTDMLHQDGANKKEKMKTKGVDVK
FT                   DGLRDDVEDAVHKVGSATGCTDFNLIVQNLEAENYNIKSAITALLQVNQGTGNDAEENH
FT                   EPGDRVKQRGPSREEAGSGRRLSGNQGRNEGRMETSEARASPAEESKAHKSQLPKVTNK
FT                   QRREQQRLEKKKRQEERHRLKALENRNGSRDTGRSEADMNTQVTLVKTFAALNI"
FT   CDS             complement(join(902421..902597,903400..903581,
FT                   904171..904267,904621..904752,908466..908588,
FT                   911771..911883,916011..916159,920137..920354))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9090"
FT                   /product="mCG9090, isoform CRA_a"
FT                   /note="gene_id=mCG9090.1 transcript_id=mCT179630.0
FT                   protein_id=mCP102552.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1AZ99"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="MGI:MGI:1920412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1AZ99"
FT                   /protein_id="EDL13286.1"
FT                   /translation="MSRKQAAKSRPGSGGRRAEAERKRDERAARRALAKERRNRPDPGG
FT                   SGCEEEFVSFANQLQALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIR
FT                   QREDFEPFVEDDIPFEKHVASLSKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRG
FT                   TDKGSTRELHIAYRYGEHYDSVRRINDNSEAPAHLLTDFQMLHQDGANKKEKMKTKGVD
FT                   VKDGLRDDVEDAVHKVGSATGCTDFNLIVQNLEAENYNIKSAITALLQVNQGTGNDAEE
FT                   NHEPGDRVKQRGPSREEAGSGRRLSGNQGRNEGRMETSEARASPAEESKAHKSQLPKVT
FT                   NKQRREQQRLEKKKRQEERHRLKALENRNGSRDTGRSEADMNTQVTLVKTFAALNI"
FT   assembly_gap    921998..922356
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    927054..929210
FT                   /estimated_length=2157
FT                   /gap_type="unknown"
FT   assembly_gap    930581..930958
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    942588..942607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            974379..975622
FT                   /gene="Rnf186"
FT                   /locus_tag="mCG_1029769"
FT                   /note="gene_id=mCG1029769.1"
FT   mRNA            974379..975622
FT                   /gene="Rnf186"
FT                   /locus_tag="mCG_1029769"
FT                   /product="ring finger protein 186"
FT                   /note="gene_id=mCG1029769.1 transcript_id=mCT147473.1
FT                   created on 23-MAY-2002"
FT   CDS             974575..975255
FT                   /codon_start=1
FT                   /gene="Rnf186"
FT                   /locus_tag="mCG_1029769"
FT                   /product="ring finger protein 186"
FT                   /note="gene_id=mCG1029769.1 transcript_id=mCT147473.1
FT                   protein_id=mCP53215.1"
FT                   /protein_id="EDL13288.1"
FT                   /translation="MSCTEAPQPIPAGTTTTSTIIALGPTGRLSISVEGDLECLVCREP
FT                   YNCARSPKLLSCQHTFCAVCLKLLLYVQEDTWSIPCPLCRKVTAVPGGLICSLRDQEAM
FT                   VGRLALPCPEVRLCPQRLVGSAASATRPANWTGEEEQDTVSVNRVAARRLAVHLLLLAL
FT                   VIVLILPFIYPGVIRWVLAFVIALALLMSTLFCCHPQSQNSNWLCPRTLFCREQKQTQI
FT                   TSIA"
FT   gene            980153..1064512
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /note="gene_id=mCG140373.0"
FT   mRNA            join(980153..980252,984454..984568,990869..991013,
FT                   992307..992425,997693..997871,1003549..1003723,
FT                   1005175..1005202,1017528..1017660,1026713..1026810,
FT                   1027186..1027329,1027999..1028118,1028761..1028925,
FT                   1030071..1030207,1035573..1035657,1057844..1057961,
FT                   1059243..1059360,1063456..1064510)
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant mCT169214"
FT                   /note="gene_id=mCG140373.0 transcript_id=mCT169214.0
FT                   created on 06-JAN-2003"
FT   mRNA            join(980153..980252,990869..991013,992307..992425,
FT                   997693..997871,1003549..1003723,1005175..1005202,
FT                   1017528..1017660,1026713..1026810,1027186..1027329,
FT                   1027999..1028118,1028761..1028925,1030071..1030207,
FT                   1035573..1035657,1057844..1057961,1059243..1059360,
FT                   1063456..1064510)
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant mCT178359"
FT                   /note="gene_id=mCG140373.0 transcript_id=mCT178359.0
FT                   created on 06-JAN-2003"
FT   mRNA            join(980168..980550,984454..984568,990869..991013,
FT                   992307..992425,997693..997871,1003549..1003723,
FT                   1005175..1005202,1017528..1017660,1026713..1026810,
FT                   1027186..1027329,1027999..1028118,1028761..1028925,
FT                   1030071..1030207,1035573..1035657,1057844..1057961,
FT                   1059243..1059360,1063456..1064512)
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant mCT169213"
FT                   /note="gene_id=mCG140373.0 transcript_id=mCT169213.0
FT                   created on 06-JAN-2003"
FT   mRNA            join(980177..980252,984454..984568,992307..992425,
FT                   997693..997871,1003549..1003723,1005175..1005202,
FT                   1017528..1017660,1026713..1026810,1027186..1027329,
FT                   1027999..1028118,1028761..1028925,1030071..1030207,
FT                   1035573..1035657,1057844..1057961,1059243..1059360,
FT                   1063456..1064510)
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /product="transmembrane and coiled-coil domains 4,
FT                   transcript variant mCT178360"
FT                   /note="gene_id=mCG140373.0 transcript_id=mCT178360.0
FT                   created on 06-JAN-2003"
FT   assembly_gap    991834..991853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(997702..997871,1003549..1003723,1005175..1005202,
FT                   1017528..1017660,1026713..1026810,1027186..1027329,
FT                   1027999..1028118,1028761..1028925,1030071..1030207,
FT                   1035573..1035657,1057844..1057961,1059243..1059360,
FT                   1063456..1063860)
FT                   /codon_start=1
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140373.0 transcript_id=mCT169213.0
FT                   protein_id=mCP92047.0 isoform=CRA_a"
FT                   /protein_id="EDL13289.1"
FT                   /translation="MATWNRPHPRQPVAPEPAAEDDSQQPLGRELSEANRFAYAALCGF
FT                   SLSQLFPEPEQSSFCTEFVTGLVKWLHLSESVLPTIMAFASGLGGEGADIFAQTLLQDP
FT                   ILRDNPSAVSQDLLSFSLKNGHYDARARVLVCHVTSLLQVPMEELDILEEVFLESLKDA
FT                   KEEESETAEASRKRKEKRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGS
FT                   AGAAALGSVAGIAVMTSLFGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGRQLHITIAIT
FT                   GWLGSGRYRTFNAPWMALARSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKY
FT                   TVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIG
FT                   FSLGARVIYFCLQEMAQEQDCQGIIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCR
FT                   GDWLLSFVYRTSSVQLRVAGLQPVLLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGI
FT                   RTKPGWREKGLPLAPGSLPQEEPLQTAIVSTDEIILQDGQSQGPASEDSLKTTIPSSAS
FT                   QAQMPAGLNQSTEDSLSTAAAPAEGHLICSHGVGPNPLGCPDCTHGTQESCTELD"
FT   CDS             join(997702..997871,1003549..1003723,1005175..1005202,
FT                   1017528..1017660,1026713..1026810,1027186..1027329,
FT                   1027999..1028118,1028761..1028925,1030071..1030207,
FT                   1035573..1035657,1057844..1057961,1059243..1059360,
FT                   1063456..1063860)
FT                   /codon_start=1
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140373.0 transcript_id=mCT169214.0
FT                   protein_id=mCP92069.0 isoform=CRA_a"
FT                   /protein_id="EDL13290.1"
FT                   /translation="MATWNRPHPRQPVAPEPAAEDDSQQPLGRELSEANRFAYAALCGF
FT                   SLSQLFPEPEQSSFCTEFVTGLVKWLHLSESVLPTIMAFASGLGGEGADIFAQTLLQDP
FT                   ILRDNPSAVSQDLLSFSLKNGHYDARARVLVCHVTSLLQVPMEELDILEEVFLESLKDA
FT                   KEEESETAEASRKRKEKRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGS
FT                   AGAAALGSVAGIAVMTSLFGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGRQLHITIAIT
FT                   GWLGSGRYRTFNAPWMALARSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKY
FT                   TVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIG
FT                   FSLGARVIYFCLQEMAQEQDCQGIIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCR
FT                   GDWLLSFVYRTSSVQLRVAGLQPVLLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGI
FT                   RTKPGWREKGLPLAPGSLPQEEPLQTAIVSTDEIILQDGQSQGPASEDSLKTTIPSSAS
FT                   QAQMPAGLNQSTEDSLSTAAAPAEGHLICSHGVGPNPLGCPDCTHGTQESCTELD"
FT   CDS             join(997702..997871,1003549..1003723,1005175..1005202,
FT                   1017528..1017660,1026713..1026810,1027186..1027329,
FT                   1027999..1028118,1028761..1028925,1030071..1030207,
FT                   1035573..1035657,1057844..1057961,1059243..1059360,
FT                   1063456..1063860)
FT                   /codon_start=1
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140373.0 transcript_id=mCT178359.0
FT                   protein_id=mCP101281.0 isoform=CRA_a"
FT                   /protein_id="EDL13291.1"
FT                   /translation="MATWNRPHPRQPVAPEPAAEDDSQQPLGRELSEANRFAYAALCGF
FT                   SLSQLFPEPEQSSFCTEFVTGLVKWLHLSESVLPTIMAFASGLGGEGADIFAQTLLQDP
FT                   ILRDNPSAVSQDLLSFSLKNGHYDARARVLVCHVTSLLQVPMEELDILEEVFLESLKDA
FT                   KEEESETAEASRKRKEKRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGS
FT                   AGAAALGSVAGIAVMTSLFGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGRQLHITIAIT
FT                   GWLGSGRYRTFNAPWMALARSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKY
FT                   TVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIG
FT                   FSLGARVIYFCLQEMAQEQDCQGIIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCR
FT                   GDWLLSFVYRTSSVQLRVAGLQPVLLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGI
FT                   RTKPGWREKGLPLAPGSLPQEEPLQTAIVSTDEIILQDGQSQGPASEDSLKTTIPSSAS
FT                   QAQMPAGLNQSTEDSLSTAAAPAEGHLICSHGVGPNPLGCPDCTHGTQESCTELD"
FT   CDS             join(997702..997871,1003549..1003723,1005175..1005202,
FT                   1017528..1017660,1026713..1026810,1027186..1027329,
FT                   1027999..1028118,1028761..1028925,1030071..1030207,
FT                   1035573..1035657,1057844..1057961,1059243..1059360,
FT                   1063456..1063860)
FT                   /codon_start=1
FT                   /gene="Tmco4"
FT                   /locus_tag="mCG_140373"
FT                   /product="transmembrane and coiled-coil domains 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140373.0 transcript_id=mCT178360.0
FT                   protein_id=mCP101282.0 isoform=CRA_a"
FT                   /protein_id="EDL13292.1"
FT                   /translation="MATWNRPHPRQPVAPEPAAEDDSQQPLGRELSEANRFAYAALCGF
FT                   SLSQLFPEPEQSSFCTEFVTGLVKWLHLSESVLPTIMAFASGLGGEGADIFAQTLLQDP
FT                   ILRDNPSAVSQDLLSFSLKNGHYDARARVLVCHVTSLLQVPMEELDILEEVFLESLKDA
FT                   KEEESETAEASRKRKEKRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGS
FT                   AGAAALGSVAGIAVMTSLFGAAGAGLTGYKMKKRVGAIEEFMFLPLTEGRQLHITIAIT
FT                   GWLGSGRYRTFNAPWMALARSQEQYCLAWEAKYLMELGNALETILSGLANMVAQEALKY
FT                   TVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIG
FT                   FSLGARVIYFCLQEMAQEQDCQGIIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCR
FT                   GDWLLSFVYRTSSVQLRVAGLQPVLLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGI
FT                   RTKPGWREKGLPLAPGSLPQEEPLQTAIVSTDEIILQDGQSQGPASEDSLKTTIPSSAS
FT                   QAQMPAGLNQSTEDSLSTAAAPAEGHLICSHGVGPNPLGCPDCTHGTQESCTELD"
FT   assembly_gap    1024272..1024705
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    1037377..1042518
FT                   /estimated_length=5142
FT                   /gap_type="unknown"
FT   assembly_gap    1046505..1046524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1049117..1049158
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    1065817..1065926
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            complement(1066689..1080190)
FT                   /gene="Htr6"
FT                   /locus_tag="mCG_9086"
FT                   /note="gene_id=mCG9086.1"
FT   mRNA            complement(join(1066689..1067143,1067354..1067512,
FT                   1079443..1080190))
FT                   /gene="Htr6"
FT                   /locus_tag="mCG_9086"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 6"
FT                   /note="gene_id=mCG9086.1 transcript_id=mCT9218.1 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(1066700..1067143,1067354..1067512,
FT                   1079443..1080162))
FT                   /codon_start=1
FT                   /gene="Htr6"
FT                   /locus_tag="mCG_9086"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 6"
FT                   /note="gene_id=mCG9086.1 transcript_id=mCT9218.1
FT                   protein_id=mCP4882.2"
FT                   /db_xref="GOA:Q14AW8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR002232"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1196627"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AW8"
FT                   /protein_id="EDL13293.1"
FT                   /translation="MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANS
FT                   LLIALICTQPALRNTSNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTA
FT                   FDVMCCSASILNLCLISLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLL
FT                   LGWHELGKARTSAPGQCRLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQV
FT                   ASLTTGTATAGQALETLQVPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFV
FT                   TWLPFFVASIAQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCV
FT                   HCPPEHRASPASPSMWTSHSGARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLL
FT                   LPGEATRDPPPPTRAPTVVNFFVTDSVEPEIRQHPLGSPMN"
FT   assembly_gap    1070109..1070299
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    1076389..1076408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1083190..1084522
FT                   /estimated_length=1333
FT                   /gap_type="unknown"
FT   gene            complement(1088502..1091848)
FT                   /gene="Nbl1"
FT                   /locus_tag="mCG_16162"
FT                   /note="gene_id=mCG16162.1"
FT   mRNA            complement(join(1088502..1089812,1091440..1091551,
FT                   1091653..1091848))
FT                   /gene="Nbl1"
FT                   /locus_tag="mCG_16162"
FT                   /product="neuroblastoma, suppression of tumorigenicity 1"
FT                   /note="gene_id=mCG16162.1 transcript_id=mCT16148.0 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(1089555..1089812,1091440..1091551,
FT                   1091653..1091819))
FT                   /codon_start=1
FT                   /gene="Nbl1"
FT                   /locus_tag="mCG_16162"
FT                   /product="neuroblastoma, suppression of tumorigenicity 1"
FT                   /note="gene_id=mCG16162.1 transcript_id=mCT16148.0
FT                   protein_id=mCP7753.1"
FT                   /db_xref="GOA:Q61477"
FT                   /db_xref="InterPro:IPR004133"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR016728"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:104591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61477"
FT                   /protein_id="EDL13294.1"
FT                   /translation="MLWVLVGAVLPVMLLAAPPPINKLALFPDKSAWCEAKNITQIVGH
FT                   SGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEV
FT                   PRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPE
FT                   EPPGAPQVEEEGAED"
FT   assembly_gap    1099011..1099156
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    1102608..1102627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1106413..>1135641)
FT                   /locus_tag="mCG_145204"
FT                   /note="gene_id=mCG145204.0"
FT   mRNA            complement(join(1106413..1108591,1109569..1109678,
FT                   1110435..1110482,1135498..>1135641))
FT                   /locus_tag="mCG_145204"
FT                   /product="mCG145204"
FT                   /note="gene_id=mCG145204.0 transcript_id=mCT184628.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1108053..>1108385)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145204"
FT                   /product="mCG145204"
FT                   /note="gene_id=mCG145204.0 transcript_id=mCT184628.0
FT                   protein_id=mCP105185.0"
FT                   /protein_id="EDL13295.1"
FT                   /translation="IKNGKPNASNAFIPLCCRRLLFEWPSCGLCDLLKTQTCPTHSPNA
FT                   QLTFPPPSQDWWHPTVCDDGHGEVFRSTLLMGAPVCLTDVCPLLHGALTDSVELVASPS
FT                   LDGRTC"
FT   assembly_gap    1138179..1138198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1139720..1139739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1142242..1142263
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    1146179..1146198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1155616..1156007
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    1157930..1158042
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    1165728..1165963
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    1173626..1173645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1199350..1199369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1199419..1298518
FT                   /gene="Capzb"
FT                   /locus_tag="mCG_122335"
FT                   /note="gene_id=mCG122335.1"
FT   mRNA            join(1199419..1199468,1245307..1245396,1263962..1264083,
FT                   1268685..1268798,1286699..1286840,1287171..1287287,
FT                   1293732..1293797,1294459..1294535,1295564..1295676,
FT                   1297706..1298461)
FT                   /gene="Capzb"
FT                   /locus_tag="mCG_122335"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, transcript variant mCT169210"
FT                   /note="gene_id=mCG122335.1 transcript_id=mCT169210.0
FT                   created on 23-MAY-2002"
FT   mRNA            join(1199448..1199468,1245307..1245396,1263962..1264083,
FT                   1268685..1268798,1286699..1286840,1287171..1287287,
FT                   1293732..1293797,1294459..1294535,1297706..1298461)
FT                   /gene="Capzb"
FT                   /locus_tag="mCG_122335"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, transcript variant mCT123552"
FT                   /note="gene_id=mCG122335.1 transcript_id=mCT123552.1
FT                   created on 23-MAY-2002"
FT   CDS             join(1199466..1199468,1245307..1245396,1263962..1264083,
FT                   1268685..1268798,1286699..1286840,1287171..1287287,
FT                   1293732..1293797,1294459..1294535,1297706..1297793)
FT                   /codon_start=1
FT                   /gene="Capzb"
FT                   /locus_tag="mCG_122335"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, isoform CRA_c"
FT                   /note="gene_id=mCG122335.1 transcript_id=mCT123552.1
FT                   protein_id=mCP53332.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q923G3"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="MGI:MGI:104652"
FT                   /db_xref="UniProtKB/TrEMBL:Q923G3"
FT                   /protein_id="EDL13298.1"
FT                   /translation="MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQ
FT                   PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAF
FT                   DQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGR
FT                   TAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMEN
FT                   KIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC"
FT   CDS             join(1199466..1199468,1245307..1245396,1263962..1264083,
FT                   1268685..1268798,1286699..1286840,1287171..1287287,
FT                   1293732..1293797,1294459..1294535,1295564..1295666)
FT                   /codon_start=1
FT                   /gene="Capzb"
FT                   /locus_tag="mCG_122335"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, isoform CRA_b"
FT                   /note="gene_id=mCG122335.1 transcript_id=mCT169210.0
FT                   protein_id=mCP92065.0 isoform=CRA_b"
FT                   /protein_id="EDL13297.1"
FT                   /translation="MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQ
FT                   PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAF
FT                   DQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGR
FT                   TAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMEN
FT                   KIRSTLNEIYFGKTKDIVNGLRSLDAIPDNHKFKQLQRELSQVLTQRQVYIQPDN"
FT   mRNA            join(1245298..1245396,1263962..1264083,1268685..1268798,
FT                   1286699..1286840,1287171..1287287,1293732..1293797,
FT                   1294459..1294535,1297706..1298518)
FT                   /gene="Capzb"
FT                   /locus_tag="mCG_122335"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, transcript variant mCT169209"
FT                   /note="gene_id=mCG122335.1 transcript_id=mCT169209.0
FT                   created on 23-MAY-2002"
FT   CDS             join(1245340..1245396,1263962..1264083,1268685..1268798,
FT                   1286699..1286840,1287171..1287287,1293732..1293797,
FT                   1294459..1294535,1297706..1297793)
FT                   /codon_start=1
FT                   /gene="Capzb"
FT                   /locus_tag="mCG_122335"
FT                   /product="capping protein (actin filament) muscle Z-line,
FT                   beta, isoform CRA_a"
FT                   /note="gene_id=mCG122335.1 transcript_id=mCT169209.0
FT                   protein_id=mCP92057.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AMW0"
FT                   /db_xref="InterPro:IPR001698"
FT                   /db_xref="InterPro:IPR019771"
FT                   /db_xref="MGI:MGI:104652"
FT                   /db_xref="UniProtKB/TrEMBL:A2AMW0"
FT                   /protein_id="EDL13296.1"
FT                   /translation="MRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGK
FT                   DYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGV
FT                   SSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVML
FT                   WLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFG
FT                   KTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC"
FT   assembly_gap    1251815..1251834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1303223..1303345
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            complement(1304797..1317469)
FT                   /gene="Pqlc2"
FT                   /locus_tag="mCG_9074"
FT                   /note="gene_id=mCG9074.1"
FT   mRNA            complement(join(1304797..1305761,1307018..1307203,
FT                   1307804..1307896,1308042..1308184,1308582..1308669,
FT                   1309217..1309346,1313234..1313473,1314514..1314635,
FT                   1317414..1317469))
FT                   /gene="Pqlc2"
FT                   /locus_tag="mCG_9074"
FT                   /product="PQ loop repeat containing 2, transcript variant
FT                   mCT9205"
FT                   /note="gene_id=mCG9074.1 transcript_id=mCT9205.2 created on
FT                   24-MAY-2002"
FT   mRNA            complement(join(1305323..1307203,1307804..1307896,
FT                   1308042..1308184,1308582..1308669,1309217..1309346,
FT                   1313234..1313473,1314514..1314635,1317414..1317463))
FT                   /gene="Pqlc2"
FT                   /locus_tag="mCG_9074"
FT                   /product="PQ loop repeat containing 2, transcript variant
FT                   mCT169282"
FT                   /note="gene_id=mCG9074.1 transcript_id=mCT169282.0 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(1305684..1305761,1307018..1307203,
FT                   1307804..1307896,1308042..1308184,1308582..1308669,
FT                   1309217..1309315))
FT                   /codon_start=1
FT                   /gene="Pqlc2"
FT                   /locus_tag="mCG_9074"
FT                   /product="PQ loop repeat containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG9074.1 transcript_id=mCT9205.2
FT                   protein_id=mCP4871.2 isoform=CRA_b"
FT                   /protein_id="EDL13300.1"
FT                   /translation="MDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADL
FT                   MMLTLYFHYKFKKRPSPLSAPINSVLLFILGTVCITPLLSSTDPVAVPREGFRGRTLLS
FT                   VEPGNKPFTKKEVIGFVIGSASSLLYLLSRLPQIRTNFIRQSTQGISYSLFALVMLGNT
FT                   LYGLSVLLKNPEVGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRSHETAAASER
FT                   EPLLPS"
FT   CDS             complement(join(1306769..1307203,1307804..1307896,
FT                   1308042..1308184,1308582..1308669,1309217..1309315))
FT                   /codon_start=1
FT                   /gene="Pqlc2"
FT                   /locus_tag="mCG_9074"
FT                   /product="PQ loop repeat containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG9074.1 transcript_id=mCT169282.0
FT                   protein_id=mCP92046.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VCS7"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="MGI:MGI:2384837"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VCS7"
FT                   /protein_id="EDL13299.1"
FT                   /translation="MDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADL
FT                   MMLTLYFHYKFKKRPSPLSAPINSVLLFILGTVCITPLLSSTDPVAVPREGFRGRTLLS
FT                   VEPGNKPFTKKEVIGFVIGSASSLLYLLSRLPQIRTNFIRQSTQGISYSLFALVMLGNT
FT                   LYGLSVLLKNPEVGQSEGSYLLHHLPWLVGSLGVLLLDTIVSFKACDVGTVVWARRPLL
FT                   QCAHPCQPTPLSTYSSTCPLAHSPIRPCVLPSTIQPLTTLHLPIQPHPPTHHPLRHLSI
FT                   YALT"
FT   gene            1317539..1325897
FT                   /gene="Akr7a5"
FT                   /locus_tag="mCG_9076"
FT                   /note="gene_id=mCG9076.1"
FT   mRNA            join(1317539..1317814,1321691..1321880,1322056..1322160,
FT                   1324222..1324318,1324446..1324545,1325082..1325211,
FT                   1325569..1325897)
FT                   /gene="Akr7a5"
FT                   /locus_tag="mCG_9076"
FT                   /product="aldo-keto reductase family 7, member A5
FT                   (aflatoxin aldehyde reductase)"
FT                   /note="gene_id=mCG9076.1 transcript_id=mCT9208.1 created on
FT                   24-MAY-2002"
FT   CDS             join(1317540..1317814,1321691..1321880,1322056..1322160,
FT                   1324222..1324318,1324446..1324545,1325082..1325211,
FT                   1325569..1325643)
FT                   /codon_start=1
FT                   /gene="Akr7a5"
FT                   /locus_tag="mCG_9076"
FT                   /product="aldo-keto reductase family 7, member A5
FT                   (aflatoxin aldehyde reductase)"
FT                   /note="gene_id=mCG9076.1 transcript_id=mCT9208.1
FT                   protein_id=mCP4876.1"
FT                   /protein_id="EDL13301.1"
FT                   /translation="MLRAASRAVGRAAVRSAQRSGTSVGRPLAMSRPPPPRAASGAPLR
FT                   PATVLGTMEMGRRMDASASAASVRAFLERGHSELDTAFMYCDGQSEKVKIATKANPWEG
FT                   KSLKPDSIRSQLETSLKRLQCPRVDLFYLHAPDHSTPVEETLRACHQLHQEGKFVELGL
FT                   SNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNPLA
FT                   GGLLTGKYKYEDKDGKQPVGRFFGNNWAETYRNRFWKEHHFEAIALVEKALQTTYGTNA
FT                   PRMTSAALRWMYHHSQLQGTRGGRSHLGHVQSGAAGAELGRH"
FT   assembly_gap    1317815..1318012
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    1320999..1321018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1323833..1324120
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    1325509..1325528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1335943..1335962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1339671..1339690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1349629..1350824
FT                   /pseudo
FT                   /locus_tag="mCG_9079"
FT                   /note="gene_id=mCG9079.0"
FT   mRNA            join(1349629..1349821,1350701..1350824)
FT                   /pseudo
FT                   /locus_tag="mCG_9079"
FT                   /note="gene_id=mCG9079.0 transcript_id=mCT9211.0 created on
FT                   24-MAY-2002"
FT   gene            complement(1351885..>1353771)
FT                   /locus_tag="mCG_122338"
FT                   /note="gene_id=mCG122338.0"
FT   mRNA            complement(1351885..>1353771)
FT                   /locus_tag="mCG_122338"
FT                   /product="mCG122338"
FT                   /note="gene_id=mCG122338.0 transcript_id=mCT123555.0
FT                   created on 24-MAY-2002"
FT   CDS             complement(1352793..>1353314)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122338"
FT                   /product="mCG122338"
FT                   /note="gene_id=mCG122338.0 transcript_id=mCT123555.0
FT                   protein_id=mCP53340.0"
FT                   /protein_id="EDL13302.1"
FT                   /translation="LLRSFASITDQAVAPWQLREWEVLVLGKLKWDLAAVIAHDFLALI
FT                   LHRLSLPSGWQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVLGLGACSMSAD
FT                   ELTELLAGITGTEVDCLRACQEQIEAALRENLREAAQTAPSPVSKVPRSSSSQGPGQTS
FT                   TPTDVTAIHL"
FT   gene            complement(1354935..1360068)
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /note="gene_id=mCG122343.2"
FT   mRNA            complement(join(1354935..1355296,1355415..1355491,
FT                   1355815..1355966,1356176..1356243,1356500..1356581,
FT                   1357108..1357211,1357928..1357986,1359761..1360046))
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /product="RIKEN cDNA 2610012O22, transcript variant
FT                   mCT123560"
FT                   /note="gene_id=mCG122343.2 transcript_id=mCT123560.1
FT                   created on 06-FEB-2003"
FT   mRNA            complement(join(1354939..1355296,1355815..1355966,
FT                   1356176..1356243,1356500..1356581,1357108..1357211,
FT                   1357928..1357986,1359761..1360054))
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /product="RIKEN cDNA 2610012O22, transcript variant
FT                   mCT169211"
FT                   /note="gene_id=mCG122343.2 transcript_id=mCT169211.0
FT                   created on 06-FEB-2003"
FT   mRNA            complement(join(1355033..1355299,1355415..1355491,
FT                   1355815..1355966,1356176..1356243,1356500..1356581,
FT                   1357108..1357341,1357928..1357986,1359761..1360034))
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /product="RIKEN cDNA 2610012O22, transcript variant
FT                   mCT169212"
FT                   /note="gene_id=mCG122343.2 transcript_id=mCT169212.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(1355150..1355296,1355415..1355491,
FT                   1355815..1355966,1356176..1356243,1356500..1356581,
FT                   1357108..1357211,1357928..1357986,1359761..1359788))
FT                   /codon_start=1
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /product="RIKEN cDNA 2610012O22, isoform CRA_a"
FT                   /note="gene_id=mCG122343.2 transcript_id=mCT123560.1
FT                   protein_id=mCP53349.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2AMV1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR033867"
FT                   /db_xref="MGI:MGI:1917152"
FT                   /db_xref="UniProtKB/TrEMBL:A2AMV1"
FT                   /protein_id="EDL13303.1"
FT                   /translation="MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSV
FT                   ANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKKLRGEVGLLF
FT                   TNRTKEEVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMEPQLRQLGLPTALK
FT                   KGVVTLLSDYEVCKEGDVLTPEQARILLFGYEMAEFKVIIKYMWDAQSGRFQQMDDDLP
FT                   ESAPESEGESEEEDDS"
FT   CDS             complement(join(1355150..1355299,1355415..1355491,
FT                   1355815..1355966,1356176..1356243,1356500..1356581,
FT                   1357108..1357157))
FT                   /codon_start=1
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /product="RIKEN cDNA 2610012O22, isoform CRA_d"
FT                   /note="gene_id=mCG122343.2 transcript_id=mCT169212.0
FT                   protein_id=mCP92054.0 isoform=CRA_d"
FT                   /protein_id="EDL13306.1"
FT                   /translation="MRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQV
FT                   SKKLRGEVGLLFTNRTKEEVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMEP
FT                   QLRQLGLPTALKKGVVTLLSDYEVCKEGDVLTPEQARILKLFGYEMAEFKVIIKYMWDA
FT                   QSGRFQQMDDDLPESAPESEGESEEEDDS"
FT   CDS             complement(join(1355283..1355296,1355815..1355966,
FT                   1356176..1356243,1356500..1356581,1357108..1357211,
FT                   1357928..1357986,1359761..1359788))
FT                   /codon_start=1
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /product="RIKEN cDNA 2610012O22, isoform CRA_b"
FT                   /note="gene_id=mCG122343.2 transcript_id=mCT169211.0
FT                   protein_id=mCP92043.0 isoform=CRA_b"
FT                   /protein_id="EDL13304.1"
FT                   /translation="MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSV
FT                   ANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKKLRGEVGLLF
FT                   TNRTKEEVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMEPQLRQLGLPTALK
FT                   KAVWV"
FT   mRNA            complement(join(1357369..1357986,1359761..1360068))
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /product="RIKEN cDNA 2610012O22, transcript variant
FT                   mCT179490"
FT                   /note="gene_id=mCG122343.2 transcript_id=mCT179490.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(1357832..1357986,1359761..1359788))
FT                   /codon_start=1
FT                   /gene="2610012O22Rik"
FT                   /locus_tag="mCG_122343"
FT                   /product="RIKEN cDNA 2610012O22, isoform CRA_c"
FT                   /note="gene_id=mCG122343.2 transcript_id=mCT179490.0
FT                   protein_id=mCP102412.0 isoform=CRA_c"
FT                   /protein_id="EDL13305.1"
FT                   /translation="MPKSKRDKKVSLTKTAKKGLELKQNLIEEVSACLFLVSCVCVCVC
FT                   VCVCVCVCLSVCLSV"
FT   gene            1360087..1386640
FT                   /gene="C230096C10Rik"
FT                   /locus_tag="mCG_140449"
FT                   /note="gene_id=mCG140449.0"
FT   mRNA            join(1360087..1360209,1361653..1361777,1362304..1362369,
FT                   1362584..1362677,1364996..1365124,1366733..1366859,
FT                   1367523..1367672,1367950..1368117,1368373..1368444,
FT                   1368755..1368817,1369590..1369712,1370746..1370842,
FT                   1371524..1371646,1373062..1373261,1373395..1373544,
FT                   1374252..1374413,1374971..1375090,1377744..1377881,
FT                   1378793..1378960,1379508..1379718,1381719..1381803,
FT                   1382990..1383119,1383256..1386640)
FT                   /gene="C230096C10Rik"
FT                   /locus_tag="mCG_140449"
FT                   /product="RIKEN cDNA C230096C10, transcript variant
FT                   mCT169608"
FT                   /note="gene_id=mCG140449.0 transcript_id=mCT169608.1
FT                   created on 11-JUN-2003"
FT   mRNA            join(1360087..1360209,1361653..1361777,1362304..1362369,
FT                   1362584..1362677,1364996..1365124,1366733..1366859,
FT                   1367523..1367672,1367950..1368117,1368373..1368444,
FT                   1368755..1368817,1369590..1369712,1370746..1370842,
FT                   1371524..1371646,1373062..1373261,1373395..1373544,
FT                   1374252..1374413,1374971..1375090,1377744..1377881,
FT                   1378793..1378942,1379508..1379718,1381719..1381803,
FT                   1382990..1383119,1383256..1386640)
FT                   /gene="C230096C10Rik"
FT                   /locus_tag="mCG_140449"
FT                   /product="RIKEN cDNA C230096C10, transcript variant
FT                   mCT169607"
FT                   /note="gene_id=mCG140449.0 transcript_id=mCT169607.0
FT                   created on 11-JUN-2003"
FT   CDS             join(1360112..1360209,1361653..1361777,1362304..1362369,
FT                   1362584..1362677,1364996..1365124,1366733..1366859,
FT                   1367523..1367672,1367950..1368117,1368373..1368444,
FT                   1368755..1368817,1369590..1369712,1370746..1370842,
FT                   1371524..1371646,1373062..1373261,1373395..1373544,
FT                   1374252..1374413,1374971..1375090,1377744..1377881,
FT                   1378793..1378960,1379508..1379718,1381719..1381803,
FT                   1382990..1383119,1383256..1383435)
FT                   /codon_start=1
FT                   /gene="C230096C10Rik"
FT                   /locus_tag="mCG_140449"
FT                   /product="RIKEN cDNA C230096C10, isoform CRA_b"
FT                   /note="gene_id=mCG140449.0 transcript_id=mCT169608.1
FT                   protein_id=mCP92468.0 isoform=CRA_b"
FT                   /protein_id="EDL13308.1"
FT                   /translation="MAVAVASGFWIWAAVLLVPAAAVYEDQVGKFDWRQQYVGKIKFAS
FT                   LEFSPGSKKLVVATEKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLVHGQDAITVSNG
FT                   GRLMRSWETNIGGLNWEITLDTGSFQALGLVGLQESVRYIAVLKKTTLTLHHLSSGHLK
FT                   WVEHLPESDSILYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVWTPWLQ
FT                   HLTGACGVVDEAVLVCPDPSSHSLHTLALETEWELRQIPLQSPDLEFGSGFQPQVLPTQ
FT                   PSPVAPSRAQFFLQLSPSHYALLHYHHGAVTLLKNFPQATLVSFATTGEKTVAAVMTCR
FT                   TEVQKPVSAGDGSVASFPETSGAQDSLACFNQTYTINLYLVETGRRLLDTSISFSLEQK
FT                   GTRPEQLYIQVFLKKDDSVGYRALVQTQDHLQLFLQQLAGKVVLWSREESLAEVVCLEM
FT                   VDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQI
FT                   KNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQ
FT                   RTTAHFPHPPQCTLLVKDKETGMSSLFVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ
FT                   DYAKVLLLVDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYQLRKDLTTE
FT                   LSWELTIPPEVQRVVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDVHH
FT                   ERTFIGIFLIDGVTGRIIHSSVQKKARGPVHLVHSENWYQYWNSKARRNELTALELYEG
FT                   TEQYNATAFSSLDRPQLPQVLQQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILS
FT                   LPKALLDPRRPEIPTEQSREENLIPYSPDVQVHAERFINYNQTVSRMRGIYTAPSGLES
FT                   TCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITKRLAQVKLLNR
FT                   AWR"
FT   CDS             join(1360112..1360209,1361653..1361777,1362304..1362369,
FT                   1362584..1362677,1364996..1365124,1366733..1366859,
FT                   1367523..1367672,1367950..1368117,1368373..1368444,
FT                   1368755..1368817,1369590..1369712,1370746..1370842,
FT                   1371524..1371646,1373062..1373261,1373395..1373544,
FT                   1374252..1374413,1374971..1375090,1377744..1377881,
FT                   1378793..1378942,1379508..1379718,1381719..1381803,
FT                   1382990..1383119,1383256..1383435)
FT                   /codon_start=1
FT                   /gene="C230096C10Rik"
FT                   /locus_tag="mCG_140449"
FT                   /product="RIKEN cDNA C230096C10, isoform CRA_a"
FT                   /note="gene_id=mCG140449.0 transcript_id=mCT169607.0
FT                   protein_id=mCP92465.0 isoform=CRA_a"
FT                   /protein_id="EDL13307.1"
FT                   /translation="MAVAVASGFWIWAAVLLVPAAAVYEDQVGKFDWRQQYVGKIKFAS
FT                   LEFSPGSKKLVVATEKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLVHGQDAITVSNG
FT                   GRLMRSWETNIGGLNWEITLDTGSFQALGLVGLQESVRYIAVLKKTTLTLHHLSSGHLK
FT                   WVEHLPESDSILYQMVYSYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVWTPWLQ
FT                   HLTGACGVVDEAVLVCPDPSSHSLHTLALETEWELRQIPLQSPDLEFGSGFQPQVLPTQ
FT                   PSPVAPSRAQFFLQLSPSHYALLHYHHGAVTLLKNFPQATLVSFATTGEKTVAAVMTCR
FT                   TEVQKPVSAGDGSVASFPETSGAQDSLACFNQTYTINLYLVETGRRLLDTSISFSLEQK
FT                   GTRPEQLYIQVFLKKDDSVGYRALVQTQDHLQLFLQQLAGKVVLWSREESLAEVVCLEM
FT                   VDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQI
FT                   KNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQ
FT                   RTTAHFPHPPQCTLLVKDKETGMSSLFVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQ
FT                   DYAKVLLLVDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLSGYQLRKDLTTE
FT                   LSWELTIPPEVQRVVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDVHH
FT                   ERTFIGIFLIDGVTGRIIHSSVQKKARGPVHLYQYWNSKARRNELTALELYEGTEQYNA
FT                   TAFSSLDRPQLPQVLQQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALL
FT                   DPRRPEIPTEQSREENLIPYSPDVQVHAERFINYNQTVSRMRGIYTAPSGLESTCLVVA
FT                   YGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITKRLAQVKLLNRAWR"
FT   assembly_gap    1370989..1371311
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    1378962..1378981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1388577..1497737
FT                   /locus_tag="mCG_140375"
FT                   /note="gene_id=mCG140375.0"
FT   mRNA            join(1388577..1388772,1396248..1396345,1398793..1398896,
FT                   1399738..1399867,1399973..1400112,1400737..1400839,
FT                   1400970..1401111,1401248..1401372,1404458..1404582,
FT                   1405054..1405113,1405195..1405385,1407463..1407562,
FT                   1407698..1407835,1408226..1408343,1409182..1409369,
FT                   1410410..1410569,1410648..1410733,1414380..1414549,
FT                   1415614..1415896,1416441..1416576,1416740..1416819,
FT                   1417574..1417702,1417989..1418171,1418308..1418430,
FT                   1418523..1418752,1420527..1420648,1421313..1421410,
FT                   1422244..1422401,1422901..1423110,1424467..1424568,
FT                   1424770..1424870,1425105..1425303,1426316..1426504,
FT                   1427326..1427389,1428537..1428728,1429239..1429309,
FT                   1429389..1429536,1429855..1430082,1430551..1430721,
FT                   1431985..1432167,1432918..1433076,1433371..1433523,
FT                   1433857..1434084,1434936..1435093,1436193..1436364,
FT                   1436648..1436849,1437650..1437813,1438282..1438498,
FT                   1439703..1439919,1441778..1441841,1442152..1442286,
FT                   1443168..1443342,1444280..1444417,1445231..1445352,
FT                   1446208..1446319,1448569..1448699,1448803..1448980,
FT                   1449350..1449454,1450850..1451031,1451557..1451714,
FT                   1452753..1452849,1453402..1453509,1454017..1454133,
FT                   1455017..1455226,1456979..1457128,1458472..1458699,
FT                   1459403..1459481,1459885..1460130,1460728..1460896,
FT                   1461292..1461436,1462129..1462214,1463324..1463411,
FT                   1463605..1463798,1465739..1465978,1466302..1466440,
FT                   1467006..1467131,1467233..1467361,1468206..1468549,
FT                   1470035..1470125,1470385..1470469,1470609..1470736,
FT                   1471487..1471616,1471705..1471862,1472192..1472301,
FT                   1472749..1472890,1473166..1473247,1473501..1473674,
FT                   1475420..1475541,1476213..1476410,1476997..1477077,
FT                   1477883..1477970,1478406..1478533,1479512..1479619,
FT                   1479939..1480058,1480679..1480869,1481278..1481451,
FT                   1481744..1481843,1484338..1484556,1485340..1485453,
FT                   1487124..1487266,1487656..1487781,1488848..1489042,
FT                   1490664..1490888,1493491..1493581,1494191..1494353,
FT                   1497373..1497737)
FT                   /locus_tag="mCG_140375"
FT                   /product="mCG140375"
FT                   /note="gene_id=mCG140375.0 transcript_id=mCT169283.0
FT                   created on 24-MAY-2002"
FT   CDS             join(1388597..1388772,1396248..1396345,1398793..1398896,
FT                   1399738..1399867,1399973..1400112,1400737..1400839,
FT                   1400970..1401111,1401248..1401372,1404458..1404582,
FT                   1405054..1405113,1405195..1405385,1407463..1407562,
FT                   1407698..1407835,1408226..1408343,1409182..1409369,
FT                   1410410..1410569,1410648..1410733,1414380..1414549,
FT                   1415614..1415896,1416441..1416576,1416740..1416819,
FT                   1417574..1417702,1417989..1418171,1418308..1418430,
FT                   1418523..1418752,1420527..1420648,1421313..1421410,
FT                   1422244..1422401,1422901..1423110,1424467..1424568,
FT                   1424770..1424870,1425105..1425303,1426316..1426504,
FT                   1427326..1427389,1428537..1428728,1429239..1429309,
FT                   1429389..1429536,1429855..1430082,1430551..1430721,
FT                   1431985..1432167,1432918..1433076,1433371..1433523,
FT                   1433857..1434084,1434936..1435093,1436193..1436364,
FT                   1436648..1436849,1437650..1437813,1438282..1438498,
FT                   1439703..1439919,1441778..1441841,1442152..1442286,
FT                   1443168..1443342,1444280..1444417,1445231..1445352,
FT                   1446208..1446319,1448569..1448699,1448803..1448980,
FT                   1449350..1449454,1450850..1451031,1451557..1451714,
FT                   1452753..1452849,1453402..1453509,1454017..1454133,
FT                   1455017..1455226,1456979..1457128,1458472..1458699,
FT                   1459403..1459481,1459885..1460130,1460728..1460896,
FT                   1461292..1461436,1462129..1462214,1463324..1463411,
FT                   1463605..1463798,1465739..1465978,1466302..1466440,
FT                   1467006..1467131,1467233..1467361,1468206..1468549,
FT                   1470035..1470125,1470385..1470469,1470609..1470736,
FT                   1471487..1471616,1471705..1471862,1472192..1472301,
FT                   1472749..1472890,1473166..1473247,1473501..1473674,
FT                   1475420..1475541,1476213..1476410,1476997..1477077,
FT                   1477883..1477970,1478406..1478533,1479512..1479619,
FT                   1479939..1480058,1480679..1480869,1481278..1481451,
FT                   1481744..1481843,1484338..1484556,1485340..1485453,
FT                   1487124..1487266,1487656..1487781,1488848..1489042,
FT                   1490664..1490888,1493491..1493581,1494191..1494353,
FT                   1497373..1497437)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140375"
FT                   /product="mCG140375"
FT                   /note="gene_id=mCG140375.0 transcript_id=mCT169283.0
FT                   protein_id=mCP92037.0"
FT                   /protein_id="EDL13309.1"
FT                   /translation="MATSGGEEAAAAAPAPGAPATGQDTTPGWEVAVRPLLSASYSAFE
FT                   MKELPQLVASVIESESEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAAC
FT                   KVLIEFSLLRLENPDEACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQT
FT                   VKTLSDVEDQKELASPVSPELRQKEVQMNFLNQLTSVFNPRTVPSPPISPQALVEGEND
FT                   EQSSPDQVSAAKTKSVFIAQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVVANS
FT                   FFIMPATVADATAVRNGFHSLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAG
FT                   VSVATCMAILHVGSAQQVRTGSTSSKEDDYESDAATIVQKCLEIYDMIGQAISSSRRAG
FT                   GEHFQNFQLLGAWCLLNSLFLILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSP
FT                   KLGPGKGHQGFGVLSVILANHAIKLLASLFQDLQVEALHKGWETDGPPAVLSIMAQSTS
FT                   TQRIQRLIDSVPLTNLLLTLLSTSYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSS
FT                   TEEDSSQDDDSEPILGQWFEETISPSKEKAAPPPPPPPPPLESSPRVKSPNKQASGEKG
FT                   NILASRKDPELFSGLASNILNFITTSMLNSRNSFIRSYLSASLSEHHMATLASIIKEVD
FT                   KDGLKGSSDEDFAAALYHFNHSLVTSDLQSPNLQNTLLQQLGVAPFSEGPWPLYIHPQG
FT                   LSVLSRLLLIWQHKAGAQGDPDVPECLKVWDRFLTTMKQNALQGVVPSETEDLNVEHLQ
FT                   LLLLIFHSFSEKGRRAILTMLVQSIQELSVNMEVQMRTAPLILARLLLIFDYLLHQYSK
FT                   APVYLFEQVQHNLLSPPFGWASGSQDSSSRRANTPLYHGFKEVEENWSKHFSSDAAPQP
FT                   RFYCVLSTEASEEDLNRLDSEACEVLFSKPVKYDELYSSLTTLLAAGSQLDTTRRKEKK
FT                   NVTALEACALQYYFLILWRILGILPPSKTYMNQLAMNSPEMSECDILHTLRWSSRLRIS
FT                   SYVSWIKDHLIKQGMKPEHAGSLIELAASKCSSVKYDVEIVEEYFARQISSFCSIDCTA
FT                   VLQLHEIPSLQSIYTLDAAVSKVQVSLDEHFSKMAAETDPHKSSEITKNLLPATLQLID
FT                   TYASFTRAYLLQNLNEEGSTEKPSQEKLHGFAAVLAIGSSRCKANTLGPTLVQNLPSSV
FT                   QSVCESWNNINTNEFPNIGSWRNAFANDTIPSESYISAVQAAHLGTLCGQSLPLAASLK
FT                   HTLLSLVRLTGDLIVWSDEMNPAQVIRTLLPLLLESSTESAAEISSNSLERILGPAESD
FT                   EFLARVYEKLITGCYNILANHADPNSGLDESILEECLQYLEKQLESSQARKAMEEFFSD
FT                   GGELVQIMMATANEDLSAKFCNRVLKFFTKLFQLTEKSPNPSLLHLCGSLAQLACVEPV
FT                   RLQAWLTRMTTSPPKDSDQLEVIQENRQLLQLLTTYIVRENSQVGEGVCAVLLGTLTPM
FT                   ATDMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNAAVDWLGRCKKYLSQKNVVEKL
FT                   NANVMHGKHVMVLECTCHIMSYLADVTNALSQSNGQGPSHLSVDGEERAIEVDSDWVEE
FT                   LAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVC
FT                   HKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQSEPRVSESLVR
FT                   HASTSPADKAKVTISDGKVTDEEKPKKSSLCRTVEGCREELQNQANFSFAPLVLDMLSF
FT                   LMDAIQTNFQQASAVGSSSRAQQALSELHTVDKGVEMTDQLMVPTLGSQEGAFENVRMN
FT                   YSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGKITVLQLSALLKQADS
FT                   SKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHP
FT                   QLATGNFIIKAVWLPGSQTELAIVTADFVKIYDLSIDALSPTFYFLLPSSKIRDVTFLF
FT                   NEEGKNIIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDLKDSNSQVAGGGVS
FT                   VYYSHVLQMLFFSYSQGRSFAATVSRSTLEVLQLFPINIKSSNGGSKTSPALCQWSEVM
FT                   NHPGLVCCVQQTTGVPLVVMVKPGTFLIQEIKTLPAKAKIQDMVAIRHTACNEQQRTTM
FT                   ILLCEDGSLRIYMANVENTSYWLQPSLQPSSVISIMKPVRKRKTATITARTSSQVTFPI
FT                   DFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNSSTMV
FT                   MTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADRKLSLFIGA
FT                   SVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSNICPPNLNQSNGTGESDSAA
FT                   PATTSGTVLERLVVSSLEALESCFAVGPIIEKERNKHAAQELATLLLSLPAPASVQQQS
FT                   KSLLASLHSSRSAYHSHKDQALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSIAVTR
FT                   PNNLVHFTESKLPQMETEGADEGKEPQKQEGDGCSFITQLVNHFWKLHASKPKNAFLAP
FT                   ACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCPDPAVSFSCKQALIR
FT                   VLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSGIPDGGHIRQESQEQSEV
FT                   DHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPMLDIPPDADDETMVELAIA
FT                   LSLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASASDDEGSTAATDGSTL
FT                   RTSPADHGGSVGSESGGSAVDSVAGEHSGNVPGCLHLFGLRVMDKCLAGAVHMVTPQLR
FT                   GTRLDQGASALAQAPSAPPLGTRRETALREKEKGKLKEMLHMVRLMLLERLLQTLPQLR
FT                   NVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLAQLIAELGMDKKDVSKKNERSAL
FT                   NEVHLVVMRLLSVFMSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCLHVLKSLLE
FT                   YWKSQQSDEEPVAASQLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQLLTEMVLR
FT                   LPYQIKKIADTSSRIPPPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYR
FT                   QLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAA
FT                   QRTINWQKFCIKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAALAASTGSS
FT                   SVASSSAPPAASSGQATTQSKSSTKKSKKEEKEKEKEGESSGSQEDQLCTALVNQLNRF
FT                   ADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKAQQELLLDLMWSIWPELPAY
FT                   GRKAAQFVDLLGYFSLKTAQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLV
FT                   EFDGYYLESDPCLVCNNPEVPFCYIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIG
FT                   DLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVAS
FT                   NLMIEFADFYENYQASTETLQCPRCSASVPANPGVCGNCGENVYQCHKCRSINYDEKDP
FT                   FLCNACGFCKYARFDFMLYAKPCCAVDPIENEEDRKKAVSNINTLLDKADRVYHQLMGH
FT                   RPQLENLLCKVNEAAPEKPQEDSGTAGGISSTSASVNRYILQLAQEYCGDCKNSFDELS
FT                   KIIQKVFASRKELLEYDLQQREAATKSSRTSVQPTFTASQYRALSVLGCGHTSSTKCYG
FT                   CASAVTEHCITLLRALATNPALRHILVSQGLIRELFDYNLRRGAAAIREEVRQLMCLLT
FT                   RDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRC
FT                   ALSLFLMAVNIKTPVVVENITLMCLRILQKLIKPPAPTSKKNKDVPVEALTTVKPYCNE
FT                   IHAQAQLWLKRDPKASYEAWKKCLPIRGVDGNGKSPSKSELHRLYLTEKYVWRWKQFLS
FT                   RRGKRTTPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATVPSRKQQVLDLLTSY
FT                   LDELSVAGECAAEYLALYQKLIASCHWKVYLAARGVLPYVGNLITKEIARLLALEEATL
FT                   STDLQQGYALKSLTGLLSSFVEVESIKRHFKSRLVGTVLNGYLCLRKLVLQRTKLIDET
FT                   QDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEV
FT                   TEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSG
FT                   MELLVNNKIISLDLPVAEVYKKVWCATNEGEPMRIVYRMRGLLGDATEEFIESLDSTTD
FT                   EEEDEEEVYRMAGVMAQCGGLQCMLNRLAGVKDFKQGRHLLTVLLKLFSYCVKVKVNRQ
FT                   QLVKLETNTLNVMLGTLNLALVAEQESKDSGGAAVAEQVLSIMEIILDESNAEPLSEDK
FT                   GNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIPYLSFGEVEKMQILVERFKPY
FT                   CSFEKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIP
FT                   SAKNLDADIWKKFLSRPALPFILRLLRGLAMQHPATQVLIGTDSITSLHKLEQVSSDEG
FT                   IGTLAENLLEALREHPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVV
FT                   TKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEEMENKPRKQQGY
FT                   STVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCL
FT                   ARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIH
FT                   TVLYVLNTTRATSREEKNLQGFLEQPKEKWTESAFDVDGPHYFTILALHVLPPEQWKAI
FT                   RVEILRRLLVASHARAVAPGGATRLTDKAVKDYSAYRSSLLFWALVDLIYNMFKKVPTS
FT                   NTEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDAAGLLSEITDPE
FT                   SFLKDLLNSVP"
FT   assembly_gap    1388805..1388863
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    1396993..1397087
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1426578..1426851
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    1465474..1465554
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    1517828..1517897
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1529651..1529670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1532272..1532291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1533343..1533362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1554013..1554032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1558225..1558565
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    1562308..1563180
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   assembly_gap    1566680..1567697
FT                   /estimated_length=1018
FT                   /gap_type="unknown"
FT   assembly_gap    1569197..1569234
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    1571524..1572659
FT                   /estimated_length=1136
FT                   /gap_type="unknown"
FT   assembly_gap    1580545..1581025
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    1582109..1582128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1583264..1583283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1587591..1587776
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            1587777..1631836
FT                   /gene="C79267"
FT                   /locus_tag="mCG_9084"
FT                   /note="gene_id=mCG9084.2"
FT   mRNA            join(1587777..1588657,1617653..1617713,1619439..1619534,
FT                   1620882..1621022,1622065..1622204,1628249..1628369,
FT                   1628481..1628573,1629386..1629516,1630783..1631836)
FT                   /gene="C79267"
FT                   /locus_tag="mCG_9084"
FT                   /product="expressed sequence C79267"
FT                   /note="gene_id=mCG9084.2 transcript_id=mCT9216.2 created on
FT                   03-SEP-2002"
FT   assembly_gap    1602373..1603600
FT                   /estimated_length=1228
FT                   /gap_type="unknown"
FT   assembly_gap    1613161..1613340
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   CDS             join(1617678..1617713,1619439..1619534,1620882..1621022,
FT                   1622065..1622204,1628249..1628369,1628481..1628573,
FT                   1629386..1629516,1630783..1630888)
FT                   /codon_start=1
FT                   /gene="C79267"
FT                   /locus_tag="mCG_9084"
FT                   /product="expressed sequence C79267"
FT                   /note="gene_id=mCG9084.2 transcript_id=mCT9216.2
FT                   protein_id=mCP4861.2"
FT                   /db_xref="GOA:B1AZL1"
FT                   /db_xref="InterPro:IPR001664"
FT                   /db_xref="MGI:MGI:2140675"
FT                   /db_xref="UniProtKB/TrEMBL:B1AZL1"
FT                   /protein_id="EDL13310.1"
FT                   /translation="MNLQTMVDTLQEAAQEAEAIQEEMNEKIERLKAELVVFKGLMSDP
FT                   MTDLDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKDRKVASD
FT                   EDISEQDGEVNRFSDEEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLW
FT                   EDFTNCNPTIDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRH
FT                   LHEYMEMCSMKRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQEDLEREAD
FT                   VEPMVS"
FT   assembly_gap    1620137..1620449
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    1625905..1625924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1637351..1664340
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /note="gene_id=mCG9082.2"
FT   mRNA            join(1637351..1637637,1648234..1648327,1648416..1648508,
FT                   1649183..1649230,1649908..1650063,1651478..1651627,
FT                   1651705..1651779,1652894..1653081,1655218..1655291,
FT                   1656683..1656879,1657120..1657167,1657996..1658148,
FT                   1658718..1658839,1659585..1659703,1662764..1664340)
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   transcript variant mCT9214"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT9214.2 created on
FT                   24-MAY-2002"
FT   mRNA            join(1637352..1637637,1648234..1648327,1648416..1648508,
FT                   1649183..1649230,1649908..1650063,1651478..1651627,
FT                   1651705..1651779,1652894..1653081,1655218..1655291,
FT                   1656683..1656879,1657120..1657167,1657996..1658148,
FT                   1658718..1658751,1662965..1664130)
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   transcript variant mCT169285"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT169285.0 created
FT                   on 24-MAY-2002"
FT   mRNA            join(1637389..1637637,1648234..1648327,1648416..1648508,
FT                   1649183..1649230,1649908..1650063,1651478..1651627,
FT                   1651705..1651779,1652894..1653081,1655218..1655291,
FT                   1656683..1656879,1657120..1657167,1657996..1658148,
FT                   1658718..1658749,1662924..1664130)
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   transcript variant mCT169286"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT169286.0 created
FT                   on 24-MAY-2002"
FT   mRNA            join(<1637538..1637637,1648234..1648327,1648416..1648508,
FT                   1649183..1649230,1649908..1650063,1651478..1651627,
FT                   1651705..1651779,1652894..1653081,1655218..1655291,
FT                   1656683..1656879,1657120..1657167,1657996..1658148,
FT                   1658718..1658839,1659585..1659703,1662764..1663622,
FT                   1663671..1663882)
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   transcript variant mCT190700"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT190700.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1637540..1637637,1648234..1648327,1648416..1648508,
FT                   1649183..1649230,1649908..1650063,1651478..1651627,
FT                   1651705..1651779,1652894..1653081,1655218..1655291,
FT                   1656683..1656879,1657120..1657167,1657996..1658148,
FT                   1658718..1658839,1659585..1659703,1662764..1662876)
FT                   /codon_start=1
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT190700.0
FT                   protein_id=mCP111665.0 isoform=CRA_c"
FT                   /protein_id="EDL13313.1"
FT                   /translation="ASHSCARLLRVSAMLPLPSLRRSLLSHAWRGAGLRWKHTSSLKVT
FT                   NEPILAFSQGSPERDALQKALKDLKGQMEAIPCVVGDEEVWTSDIQYQLSPFNHAHKVA
FT                   KFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRAEVLAKTMVGQ
FT                   GKTVIQAEIDAAAELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPF
FT                   NFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTF
FT                   GDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSAD
FT                   VDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLEEHSRIKVGDPAEDFGTF
FT                   FSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKE
FT                   EIFGPVLTVYVYPDDKYRETLQLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFY
FT                   INDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYMQ"
FT   mRNA            join(1637549..1637637,1648234..1648508,1649183..1649230,
FT                   1649908..1650063,1651478..1651627,1651705..1651779,
FT                   1652894..1653081,1655218..1655291,1656683..1656879,
FT                   1657120..1657167,1657996..1658148,1658718..1658839,
FT                   1659585..1659703,1662764..1664130)
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   transcript variant mCT169284"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT169284.0 created
FT                   on 24-MAY-2002"
FT   CDS             join(1637579..1637637,1648234..1648327,1648416..1648508,
FT                   1649183..1649230,1649908..1650063,1651478..1651627,
FT                   1651705..1651779,1652894..1653081,1655218..1655291,
FT                   1656683..1656879,1657120..1657167,1657996..1658148,
FT                   1658718..1658751,1662965..1663254)
FT                   /codon_start=1
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT169285.0
FT                   protein_id=mCP92066.0 isoform=CRA_b partial"
FT                   /protein_id="EDL13312.1"
FT                   /translation="MLPLPSLRRSLLSHAWRGAGLRWKHTSSLKVTNEPILAFSQGSPE
FT                   RDALQKALKDLKGQMEAIPCVVGDEEVWTSDIQYQLSPFNHAHKVAKFCYADKALLNRA
FT                   IDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAA
FT                   ELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPFNFTAIGGNLAGAP
FT                   ALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGI
FT                   NFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAF
FT                   EYGGQKCSACSRLYVPKSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARI
FT                   KKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVSG
FT                   LSTAELDPVLATGCLSSESGAQASGHIGEDQPSPPRILIRCGTPWYLAGSPPVCFSLLI
FT                   LGLVTQRASEPKGIFSGPCQGRRQLWCLTSPLRDS"
FT   CDS             join(1637579..1637637,1648234..1648327,1648416..1648508,
FT                   1649183..1649230,1649908..1650063,1651478..1651627,
FT                   1651705..1651779,1652894..1653081,1655218..1655291,
FT                   1656683..1656879,1657120..1657167,1657996..1658148,
FT                   1658718..1658749,1662924..1663254)
FT                   /codon_start=1
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT169286.0
FT                   protein_id=mCP92068.0 isoform=CRA_d partial"
FT                   /protein_id="EDL13314.1"
FT                   /translation="MLPLPSLRRSLLSHAWRGAGLRWKHTSSLKVTNEPILAFSQGSPE
FT                   RDALQKALKDLKGQMEAIPCVVGDEEVWTSDIQYQLSPFNHAHKVAKFCYADKALLNRA
FT                   IDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAA
FT                   ELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPFNFTAIGGNLAGAP
FT                   ALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGI
FT                   NFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAF
FT                   EYGGQKCSACSRLYVPKSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARI
FT                   KKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVDI
FT                   SALTPCSPPASSGLSTAELDPVLATGCLSSESGAQASGHIGEDQPSPPRILIRCGTPWY
FT                   LAGSPPVCFSLLILGLVTQRASEPKGIFSGPCQGRRQLWCLTSPLRDS"
FT   CDS             join(1637579..1637637,1648234..1648327,1648416..1648508,
FT                   1649183..1649230,1649908..1650063,1651478..1651627,
FT                   1651705..1651779,1652894..1653081,1655218..1655291,
FT                   1656683..1656879,1657120..1657167,1657996..1658148,
FT                   1658718..1658839,1659585..1659703,1662764..1662876)
FT                   /codon_start=1
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT9214.2
FT                   protein_id=mCP4852.2 isoform=CRA_e partial"
FT                   /db_xref="GOA:Q8CHT0"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="MGI:MGI:2443883"
FT                   /db_xref="PDB:3V9J"
FT                   /db_xref="PDB:3V9K"
FT                   /db_xref="PDB:3V9L"
FT                   /db_xref="PDB:4E3X"
FT                   /db_xref="PDB:4LGZ"
FT                   /db_xref="PDB:4LH0"
FT                   /db_xref="PDB:4LH1"
FT                   /db_xref="PDB:4LH2"
FT                   /db_xref="PDB:4LH3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CHT0"
FT                   /protein_id="EDL13315.1"
FT                   /translation="MLPLPSLRRSLLSHAWRGAGLRWKHTSSLKVTNEPILAFSQGSPE
FT                   RDALQKALKDLKGQMEAIPCVVGDEEVWTSDIQYQLSPFNHAHKVAKFCYADKALLNRA
FT                   IDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAA
FT                   ELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPFNFTAIGGNLAGAP
FT                   ALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGI
FT                   NFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAF
FT                   EYGGQKCSACSRLYVPKSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARI
FT                   KKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYP
FT                   DDKYRETLQLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQ
FT                   PFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYMQ"
FT   CDS             join(1648440..1648508,1649183..1649230,1649908..1650063,
FT                   1651478..1651627,1651705..1651779,1652894..1653081,
FT                   1655218..1655291,1656683..1656879,1657120..1657167,
FT                   1657996..1658148,1658718..1658839,1659585..1659703,
FT                   1662764..1662876)
FT                   /codon_start=1
FT                   /gene="Aldh4a1"
FT                   /locus_tag="mCG_9082"
FT                   /product="aldehyde dehydrogenase 4 family, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9082.2 transcript_id=mCT169284.0
FT                   protein_id=mCP92048.0 isoform=CRA_a partial"
FT                   /protein_id="EDL13311.1"
FT                   /translation="MEAIPCVVGDEEVWTSDIQYQLSPFNHAHKVAKFCYADKALLNRA
FT                   IDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAA
FT                   ELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPFNFTAIGGNLAGAP
FT                   ALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGI
FT                   NFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAF
FT                   EYGGQKCSACSRLYVPKSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARI
FT                   KKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYP
FT                   DDKYRETLQLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQ
FT                   PFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYMQ"
FT   assembly_gap    1653586..1653672
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1663626..1663645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1668188..1683459
FT                   /gene="Tas1r2"
FT                   /locus_tag="mCG_9071"
FT                   /note="gene_id=mCG9071.1"
FT   mRNA            join(<1668188..1668413,1672906..1673682,1675159..1675368,
FT                   1680509..1680632,1682050..1683459)
FT                   /gene="Tas1r2"
FT                   /locus_tag="mCG_9071"
FT                   /product="taste receptor, type 1, member 2"
FT                   /note="gene_id=mCG9071.1 transcript_id=mCT9206.2 created on
FT                   24-MAY-2002"
FT   assembly_gap    1669502..1669521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<1672906..1673682,1675159..1675368,1680509..1680632,
FT                   1682050..1682978)
FT                   /codon_start=1
FT                   /gene="Tas1r2"
FT                   /locus_tag="mCG_9071"
FT                   /product="taste receptor, type 1, member 2"
FT                   /note="gene_id=mCG9071.1 transcript_id=mCT9206.2
FT                   protein_id=mCP4864.2"
FT                   /protein_id="EDL13316.1"
FT                   /translation="VTYSAITDKLRDKRRFPAMLRTVPSATHHIEAMVQLMVHFQWNWI
FT                   VVLVSDDDYGRENSHLLSQRLTNTGDICIAFQEVLPVPEPNQAVRPEEQDQLDNILDKL
FT                   RRTSARVVVIFSPELSLHNFFREVLRWNFTGFVWIASESWAIDPVLHNLTELRHTGTFL
FT                   GVTIQRVSIPGFSQFRVRHDKPEYPMPNETSLRTTCNQDCDACMNITESFNNVLMLSGE
FT                   RVVYSVYSAVYAVAHTLHRLLHCNQVRCTKQIVYPWQLLREIWHVNFTLLGNQLFFDEQ
FT                   GDMPMLLDIIQWQWGLSQNPFQSIASYSPTETRLTYISNVSWYTPNNTVPISMCSKSCQ
FT                   PGQMKKPIGLHPCCFECVDCPPGTYLNRSVDEFNCLSCPGSMWSYKNNIACFKRRLAFL
FT                   EWHEVPTIVVTILAALGFISTLAILLIFWRHFQTPMVRSAGGPMCFLMLVPLLLAFGMV
FT                   PVYVGPPTVFSCFCRQAFFTVCFSVCLSCITVRSFQIVCVFKMARRLPSAYGFWMRYHG
FT                   PYVFVAFITAVKVALVAGNMLATTINPIGRTDPDDPNIIILSCHPNYRNGLLFNTSMDL
FT                   LLSVLGFSFAYVGKELPTNYNEAKFITLSMTFSFTSSISLCTFMSVHDGVLVTIMDLLV
FT                   TVLNFLAIGLGYFGPKCYMILFYPERNTSAYFNSMIQGYTMRKS"
FT   assembly_gap    1684986..1685332
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    1686374..1686393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1699469..1699488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1705087..1706096
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   assembly_gap    1738073..1738121
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            complement(1750982..>1849537)
FT                   /gene="Pax7"
FT                   /locus_tag="mCG_9077"
FT                   /note="gene_id=mCG9077.2"
FT   mRNA            complement(join(1750982..1753799,1761825..1762071,
FT                   1793030..1793232,1794214..1794379,1797940..1798139,
FT                   1845206..1845334,1846127..1846253,1846768..1847003,
FT                   1849462..>1849537))
FT                   /gene="Pax7"
FT                   /locus_tag="mCG_9077"
FT                   /product="paired box gene 7"
FT                   /note="gene_id=mCG9077.2 transcript_id=mCT9209.2 created on
FT                   30-MAY-2002"
FT   CDS             complement(join(1753684..1753799,1761825..1762071,
FT                   1793030..1793232,1794214..1794379,1797940..1798139,
FT                   1845206..1845334,1846127..1846253,1846768..1847003,
FT                   1849462..>1849534))
FT                   /codon_start=1
FT                   /gene="Pax7"
FT                   /locus_tag="mCG_9077"
FT                   /product="paired box gene 7"
FT                   /note="gene_id=mCG9077.2 transcript_id=mCT9209.2
FT                   protein_id=mCP4875.2"
FT                   /protein_id="EDL13317.1"
FT                   /translation="PGAVPRMMRPGPGQNYPRTGFPLEVSTPLGQGRVNQLGGVFINGR
FT                   PLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPRV
FT                   ATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSVSSISRVLRIKFGKKEDD
FT                   EEGDKKEEDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQRRSRTTFTAEQL
FT                   EELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQLAAFNHLL
FT                   PGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPSTMHQGGLAAAAAAAD
FT                   TSSAYGARHSFSSYSDSFMNPGAPSNHMNPVSNGLSPQVMSILSNPSAVPPQPQADFSI
FT                   SPLHGGLDSASSISASCSQRADSIKPGDSLPTSQSYCPPTYSTTGYSVDPVAGYQYSQY
FT                   GQTAVDYLAKNVSLSTQRRMKLGEHSAVLGLLPVETGQAY"
FT   assembly_gap    1754002..1754041
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    1758981..1759118
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    1761069..1761313
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   gene            complement(1761497..1761823)
FT                   /locus_tag="mCG_147454"
FT                   /note="gene_id=mCG147454.0"
FT   mRNA            complement(1761497..1761823)
FT                   /locus_tag="mCG_147454"
FT                   /product="mCG147454"
FT                   /note="gene_id=mCG147454.0 transcript_id=mCT187717.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1761571..1761681)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147454"
FT                   /product="mCG147454"
FT                   /note="gene_id=mCG147454.0 transcript_id=mCT187717.0
FT                   protein_id=mCP108136.0"
FT                   /protein_id="EDL13318.1"
FT                   /translation="MYAVPAGVRRGHQIPWNGITGGCEPFYGCWGLSPGP"
FT   assembly_gap    1778353..1778372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1801264..1801283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1806657..1806676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1807833..1807852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1809808..1809827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1815022..1815041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1815762..1815781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1827742..1828292
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    1834600..1834743
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    1835598..1835756
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    1836531..1836891
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    1852818..1852837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1861486..1861663
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    1865304..1865451
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    1871551..1872247
FT                   /estimated_length=697
FT                   /gap_type="unknown"
FT   assembly_gap    1874367..1875669
FT                   /estimated_length=1303
FT                   /gap_type="unknown"
FT   assembly_gap    1886702..1886805
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    1910352..1911087
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   assembly_gap    1913793..1913812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1919785..1919804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1925953..1926608
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   assembly_gap    1928295..1928727
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    1931575..1931594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1937860..1937879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1944103..>1963755)
FT                   /locus_tag="mCG_145201"
FT                   /note="gene_id=mCG145201.0"
FT   mRNA            complement(join(1944103..1945212,1962505..1962660,
FT                   1963642..>1963755))
FT                   /locus_tag="mCG_145201"
FT                   /product="mCG145201"
FT                   /note="gene_id=mCG145201.0 transcript_id=mCT184625.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1944930..1945212,1962505..>1962551))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145201"
FT                   /product="mCG145201"
FT                   /note="gene_id=mCG145201.0 transcript_id=mCT184625.0
FT                   protein_id=mCP105182.0"
FT                   /protein_id="EDL13319.1"
FT                   /translation="DQHLPLIWGLRTAWTMCEDGRGQGSPVSASWAIQSSGPGHCEELH
FT                   FSVGHYGEKEFSRQGLRTRPFCAQAECDVISKASMYVGVRGQGVNSHLFTLFETVSLPV
FT                   CVLGY"
FT   assembly_gap    1948113..1949171
FT                   /estimated_length=1059
FT                   /gap_type="unknown"
FT   assembly_gap    1955779..1955798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1956996..1957015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1958701..1959898
FT                   /estimated_length=1198
FT                   /gap_type="unknown"
FT   assembly_gap    1969698..1970540
FT                   /estimated_length=843
FT                   /gap_type="unknown"
FT   assembly_gap    1974150..1974253
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            complement(1980140..1984600)
FT                   /gene="Klhdc7a"
FT                   /locus_tag="mCG_142246"
FT                   /note="gene_id=mCG142246.0"
FT   mRNA            complement(1980140..1984600)
FT                   /gene="Klhdc7a"
FT                   /locus_tag="mCG_142246"
FT                   /product="kelch domain containing 7A"
FT                   /note="gene_id=mCG142246.0 transcript_id=mCT179465.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(1981885..1984206)
FT                   /codon_start=1
FT                   /gene="Klhdc7a"
FT                   /locus_tag="mCG_142246"
FT                   /product="kelch domain containing 7A"
FT                   /note="gene_id=mCG142246.0 transcript_id=mCT179465.0
FT                   protein_id=mCP102387.0"
FT                   /protein_id="EDL13320.1"
FT                   /translation="MLPTGEGAEGQDWHLDMQLPSKVVLSAAALLLVTAAYKLYKSRPA
FT                   PVGQAGRNNKDHKAENETEALGQLAFQEAPPGTLPRGRRRRKASKGAGTSLDYSLVDPE
FT                   DPCILDISRSEEATRKGSDESQGRQCPDSQQVPPPCGGQEAGTDVRGKPNPPHLPHSGC
FT                   EPTSSSGRLIPGVGGSCVGDKLSPWPDSRPPEETGSGDLEAPNGWTDLTLVNGDMNQSW
FT                   IFTHMTGVSRGEAGVLQAAADMGLATQQQEGATNASHTFSSVARIRMEENIIQKAEGPG
FT                   LKGRVYDYFVESTSKADSRPVPCPAALADAPSPGPGPEPLVTGAASRDEAANTAGGGAS
FT                   EAASPQPVASPSAPGFSRKVSLLQIAENPELQLQPEGFRMPLPAHLDQRAQLSSACSHG
FT                   EPHVQLVAGTNFFHIPLTPASALDVRLDLGNCYEMLTLAKRQGLETLKEAAYKVLSDNY
FT                   LQVLRSPDIYGGLSGAERELILQRRFRGHKRLVVADMCPQDDSGRLCCYDNVQDAWHPL
FT                   AQLPPEAMSRGCALCTLFNYLFVVSGCQEPGGQPSNRVFCYNPLTAIWSEVCPLNQARP
FT                   HCRLVALEGHLYAIGGECLNTVERYDPRLDRWTFAPPLPNDTFALAHTATVCANEIFVT
FT                   GGSLRYLLLRFSTQEQRWWAGPTGGSKDRTAEMVAVNGFLYRFDLNRSLGISVYRCSAS
FT                   TRLWYECATYRLPYPDAFQCAVVDDHIYCVGRRRMLCFLADHISPRFVSKELKGFPSAR
FT                   GTLLPAVLTLPVPDVPQTPV"
FT   assembly_gap    1992424..1992562
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    2006697..2006876
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    2007631..2008497
FT                   /estimated_length=867
FT                   /gap_type="unknown"
FT   assembly_gap    2010640..2010659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2022622..2022641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2024625..2025198
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   gene            complement(2044212..>2268627)
FT                   /gene="Igsf21"
FT                   /locus_tag="mCG_119747"
FT                   /note="gene_id=mCG119747.0"
FT   mRNA            complement(join(2044212..2044440,2045085..2045123,
FT                   2045410..2045602,2046059..2046144,2051572..2052046,
FT                   2054654..2054769,2084262..2084380,2124486..2124607,
FT                   2175046..2175158,2268558..>2268627))
FT                   /gene="Igsf21"
FT                   /locus_tag="mCG_119747"
FT                   /product="immunoglobin superfamily, member 21"
FT                   /note="gene_id=mCG119747.0 transcript_id=mCT120924.0
FT                   created on 24-MAY-2002"
FT   CDS             complement(join(2044367..2044440,2045085..2045123,
FT                   2045410..2045602,2046059..2046144,2051572..2052046,
FT                   2054654..2054769,2084262..2084380,2124486..2124607,
FT                   2175046..2175158,2268558..2268627))
FT                   /codon_start=1
FT                   /gene="Igsf21"
FT                   /locus_tag="mCG_119747"
FT                   /product="immunoglobin superfamily, member 21"
FT                   /note="gene_id=mCG119747.0 transcript_id=mCT120924.0
FT                   protein_id=mCP53254.0"
FT                   /protein_id="EDL13321.1"
FT                   /translation="MQAAPSLRRASCLLLAAILDLARGYLTVNIEPLPPVVAGDAVTLK
FT                   CNFKTDGRMREIVWYRVTDGGTIKQKIFTFDAMFSTNYSHMENYRKREDLVYQSTVRLP
FT                   EVRISDNGPYECHVGIYDRATREKVVLASGNIFLNVMAPPTSIEVVAADSPAPFSRYQA
FT                   QNFTLVCIVSGGKPAPMVYFKRDGEPIDAVPLTELPAASSGPVQDSRPFRSLLHRDVDD
FT                   TKMQKSLSLLDTEYRAGRPYTERPARSLTQDPSLFVQPTTENIPETVVSREFPRWVHSA
FT                   EPVYFLRHSRTPGSDGTVEVRALLTWTLNPQIDNEALFSCEVKHPALSMPMQAEVTLVA
FT                   PKGPKIMMTPSRARVGDTVRILVHGFQNEVFPEPMFTWTRVGSRLLDGSAEFDGKELVL
FT                   ERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFENPNIPRGTEDSRGSASGPAGVRLTLV
FT                   LALTVILELT"
FT   assembly_gap    2047806..2047825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2052917..2052964
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    2055874..2055893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2090244..2090595
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    2104152..2105309
FT                   /estimated_length=1158
FT                   /gap_type="unknown"
FT   assembly_gap    2107466..2107748
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    2114720..2115166
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    2124684..2125002
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    2141488..2141816
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    2148174..2148530
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    2164438..2164457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2175385..2175531
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    2176219..2176477
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    2185627..2186128
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   assembly_gap    2192228..2192303
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    2207216..2207326
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    2212145..2212187
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2217469..2217669
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    2244369..2244388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2248256..2248275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2249351..2249370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2252740..2252759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2253770..2253789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2259286..2259305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2264150..2264354
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    2267376..2267610
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    2275498..2275716
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    2282563..2292601
FT                   /estimated_length=10039
FT                   /gap_type="unknown"
FT   assembly_gap    2296124..2296143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2326955..2326974
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2328589..2329890
FT                   /estimated_length=1302
FT                   /gap_type="unknown"
FT   assembly_gap    2333150..2333169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2335439..2335801
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    2336763..2336914
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    2352025..2352130
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    2360413..2360600
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    2378696..2378804
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    2389814..2389833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2390923..2390942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2398126..>2403067
FT                   /locus_tag="mCG_145205"
FT                   /note="gene_id=mCG145205.0"
FT   mRNA            join(<2398126..2398216,2399587..2399714,2401570..>2403067)
FT                   /locus_tag="mCG_145205"
FT                   /product="mCG145205"
FT                   /note="gene_id=mCG145205.0 transcript_id=mCT184629.0
FT                   created on 05-JUN-2003"
FT   CDS             <2402692..>2403067
FT                   /codon_start=1
FT                   /locus_tag="mCG_145205"
FT                   /product="mCG145205"
FT                   /note="gene_id=mCG145205.0 transcript_id=mCT184629.0
FT                   protein_id=mCP105186.0"
FT                   /protein_id="EDL13322.1"
FT                   /translation="TMSQFRSLGPTSCHRGPHDMGCPQSYDVRICARAHAHTHTHTHTH
FT                   THTHTHAFSTLGWHRCRERVTEEAFGQRQMEAGGEPLPIFLAIWRDVFLASYKSSRTQR
FT                   PITHSRDPSTTKLITLLNHCG"
FT   assembly_gap    2423533..2423757
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    2435454..2435473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2437082..2437101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2445847..2445866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2450085..2450324
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    2454975..2455275
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    2468040..2468059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2476710..2477117
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    2481360..2481379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2503106..2503125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2503854..2503873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2505576..2505595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2509032..2509859
FT                   /estimated_length=828
FT                   /gap_type="unknown"
FT   assembly_gap    2512720..2512781
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    2527167..2527186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2528532..2528551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2534036..2689605)
FT                   /gene="Arhgef10l"
FT                   /locus_tag="mCG_119745"
FT                   /note="gene_id=mCG119745.0"
FT   mRNA            complement(join(2534036..2535087,2536302..2536424,
FT                   2540650..2540824,2556235..2556370,2562729..2562952,
FT                   2564308..2564394,2569934..2570055,2580171..2580271,
FT                   2581608..2581735,2582553..2582672,2601102..2601278,
FT                   2602878..2602970,2604065..2604181,2605092..2605271,
FT                   2606261..2606338,2606697..2606803,2609696..2609804,
FT                   2612656..2612772,2617924..2618093,2619199..2619282,
FT                   2620252..2620343,2636976..2637009,2637672..2637857,
FT                   2643520..2643599,2689498..2689605))
FT                   /gene="Arhgef10l"
FT                   /locus_tag="mCG_119745"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like"
FT                   /note="gene_id=mCG119745.0 transcript_id=mCT120922.1
FT                   created on 24-MAY-2002"
FT   CDS             complement(join(2534546..2535087,2536302..2536424,
FT                   2540650..2540824,2556235..2556370,2562729..2562952,
FT                   2564308..2564394,2569934..2570055,2580171..2580271,
FT                   2581608..2581735,2582553..2582672,2601102..2601278,
FT                   2602878..2602970,2604065..2604181,2605092..2605271,
FT                   2606261..2606338,2606697..2606803,2609696..2609804,
FT                   2612656..2612772,2617924..2618093,2619199..2619282,
FT                   2620252..2620343,2636976..2637009,2637672..2637857,
FT                   2643520..2643556))
FT                   /codon_start=1
FT                   /gene="Arhgef10l"
FT                   /locus_tag="mCG_119745"
FT                   /product="Rho guanine nucleotide exchange factor (GEF)
FT                   10-like"
FT                   /note="gene_id=mCG119745.0 transcript_id=mCT120922.1
FT                   protein_id=mCP53293.1"
FT                   /protein_id="EDL13323.1"
FT                   /translation="MASSNPPPQPAIGAPLAPSAPGPSPEVEEDSGEAFEFDDSDEEED
FT                   TSSGLVVPGLAPERDTEPSLICFDTVPGSDLDPAAAPPQTEAPTVVSNGDAVGAAISGV
FT                   RRSSWKRKSSRRIDRFTFPALEEDVIYDDVPCESPDAHQPGAERGLVYEDVHRAGAPRE
FT                   TEDLGWSSSEFESYSEDSGEETKPEAEPTKHRGSFQPKLSPDLTRLKERYVRTKRDILA
FT                   LRVGGRDMQELKLKCDCKMTQLMKAAKSGTRDGLEKTRMAVMRKVSFLHRKDVLGDSEE
FT                   EDMGLLEVGVTDIKPPAPELGPMPDGLSPQQVVRRHILGSIVQSEGSYVESLKRILQDY
FT                   RNPLMEMEPKALSARKCQVVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASF
FT                   SKSMVLDVYSDYVNNFTNAMSIIKKACLTKPAFLEFLKRRQVCSTDRVTLYGLMVKPVQ
FT                   RFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKS
FT                   VSDRSSLNKVPDKVYLGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQD
FT                   WCLALQRLMRVKEEEIHSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNR
FT                   LHLAKIGLREENQPGWLCPDEDKKSKAPFWCPILACCVPAFSSRTLSLQLGGLVHSPVN
FT                   SPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVEIFSLNRPSPRTVKSFPVAAPVLCIEYI
FT                   PDPEEEAEGAEESRAATDPSVTVHPTVCLGLQDGRDLESPPMCITVGPGPIRTLLSLED
FT                   AAWASCGPRVTVLDAATLQTQQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGSSIRLFHT
FT                   ETLEHLQEINIATRTTFLLPGQKHLCVTSLLICQGLLWVGTDQGVIVLLPVPRLEGIPK
FT                   ITGKGMVSLNGHCGPVAFLAVAMSILAPDILRSDQEEAEGPQAEEDKPDGQAHETVPGP
FT                   DSHTARELTRKKGILLQYRLRSTAHLPGPLLSVREPAPADGSALEHSEEDGSIYEMADD
FT                   PDVWVRSRPCARDAHRKEICSVAIISGGQGYRHFGGAPGGLSGRAAPCSETDSTLLIWQ
FT                   VPLAL"
FT   assembly_gap    2537924..2537943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2556971..2556990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2561890..2561909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2563457..2563476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2567856..2567992
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    2574433..2574482
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    2585639..2598272
FT                   /estimated_length=12634
FT                   /gap_type="unknown"
FT   assembly_gap    2599358..2600606
FT                   /estimated_length=1249
FT                   /gap_type="unknown"
FT   assembly_gap    2605332..2605351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2613499..2614050
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   assembly_gap    2622892..2622911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2627723..2627982
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    2628925..2629367
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    2630345..2631977
FT                   /estimated_length=1633
FT                   /gap_type="unknown"
FT   assembly_gap    2634430..2634844
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    2638327..2639071
FT                   /estimated_length=745
FT                   /gap_type="unknown"
FT   assembly_gap    2647327..2648048
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   assembly_gap    2653188..2653207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2655537..2655556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2666128..2666147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2667337..2667356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2668852..2668871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2669990..2670009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2673206..2674773
FT                   /estimated_length=1568
FT                   /gap_type="unknown"
FT   assembly_gap    2675685..2676625
FT                   /estimated_length=941
FT                   /gap_type="unknown"
FT   assembly_gap    2679463..2681002
FT                   /estimated_length=1540
FT                   /gap_type="unknown"
FT   assembly_gap    2682069..2684280
FT                   /estimated_length=2212
FT                   /gap_type="unknown"
FT   assembly_gap    2687113..2687967
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    2692894..2695051
FT                   /estimated_length=2158
FT                   /gap_type="unknown"
FT   assembly_gap    2696332..2696797
FT                   /estimated_length=466
FT                   /gap_type="unknown"
FT   assembly_gap    2699077..2699096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2700285..2700349
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    2701874..2702883
FT                   /estimated_length=1010
FT                   /gap_type="unknown"
FT   gene            <2703844..>2709594
FT                   /locus_tag="mCG_145200"
FT                   /note="gene_id=mCG145200.0"
FT   mRNA            join(<2703844..2703895,2706564..2706718,2706861..2707187,
FT                   2709052..>2709594)
FT                   /locus_tag="mCG_145200"
FT                   /product="mCG145200"
FT                   /note="gene_id=mCG145200.0 transcript_id=mCT184624.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    2703900..2703919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2705911..2706532
FT                   /estimated_length=622
FT                   /gap_type="unknown"
FT   assembly_gap    2707924..2707943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <2709214..>2709594
FT                   /codon_start=1
FT                   /locus_tag="mCG_145200"
FT                   /product="mCG145200"
FT                   /note="gene_id=mCG145200.0 transcript_id=mCT184624.0
FT                   protein_id=mCP105181.0"
FT                   /protein_id="EDL13324.1"
FT                   /translation="IVRIKAEHLVLTTYPQRGPSRSPSSCTTVEGHFFQPFRGSPSGRE
FT                   GGCDCPPQNICQCQEIFSGFPAERKEELLTSVRWGPPPPGLALSQLRLLMSNSSSAQTD
FT                   LGKLRGSLLGFLASLINGFKNEL"
FT   assembly_gap    2711926..2712461
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    2713271..2713883
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    2718105..2718611
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    2721478..2721783
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    2724747..2724766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2730782..2753237
FT                   /gene="Rcc2"
FT                   /locus_tag="mCG_9050"
FT                   /note="gene_id=mCG9050.2"
FT   mRNA            join(<2730782..2730992,2731387..2731447,2731754..2731893,
FT                   2737979..2738072,2740360..2740503,2742165..2742296,
FT                   2742620..2742708,2743433..2743547,2745900..2746066,
FT                   2747043..2747223,2747648..2747753,2748363..2748435,
FT                   2750568..2750645,2751123..2753237)
FT                   /gene="Rcc2"
FT                   /locus_tag="mCG_9050"
FT                   /product="regulator of chromosome condensation 2"
FT                   /note="gene_id=mCG9050.2 transcript_id=mCT9187.2 created on
FT                   16-AUG-2002"
FT   CDS             join(<2730981..2730992,2731387..2731447,2731754..2731893,
FT                   2737979..2738072,2740360..2740503,2742165..2742296,
FT                   2742620..2742708,2743433..2743547,2745900..2746066,
FT                   2747043..2747223,2747648..2747753,2748363..2748435,
FT                   2750568..2750645,2751123..2751227)
FT                   /codon_start=1
FT                   /gene="Rcc2"
FT                   /locus_tag="mCG_9050"
FT                   /product="regulator of chromosome condensation 2"
FT                   /note="gene_id=mCG9050.2 transcript_id=mCT9187.2
FT                   protein_id=mCP8507.1"
FT                   /protein_id="EDL13325.1"
FT                   /translation="SWNPGTSLAGCCVSKATIFQRVSSAFVLEARIYILSVSGEWAGAL
FT                   VPAGERRSLRPRLSVASLLVSHHSNQKLEGSKCKGQLLIFGATNWDLIGRKEVPKQQAA
FT                   YRNLGQNLWGPHRYGCLSGVRVRTVVSGSCAAHSLLITTEGKLWSWGRNEKGQLGHGDT
FT                   KRVEAPRLIEALSHEAIVLAACGRNHTLALTDTGSVFAFGENKMGQLGLGNQTDAVPSP
FT                   AQIMYNGQPITKMACGAEFSMLMDCKGNLYSFGCPEYGQLGHNSDGKFIARAQRIEYDC
FT                   ELVPRRVAIFIEKTKDGQILPVPNVVVRDVACGANHTLVLDSQKRVFSWGFGGYGRLGH
FT                   AEQKDEMVPRLVKLFDFPGRGATQIYAGYTCSFAVSEVGGLFFWGATNTSRESTMYPKA
FT                   VQDLCGWRIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLD
FT                   GIFSEQVAMGYSHSLVIARDESEAEKEKLQRLPEYTPRTL"
FT   assembly_gap    2732037..2733775
FT                   /estimated_length=1739
FT                   /gap_type="unknown"
FT   assembly_gap    2754098..2754117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2759653..>2805714)
FT                   /gene="Padi4"
FT                   /locus_tag="mCG_119744"
FT                   /note="gene_id=mCG119744.0"
FT   mRNA            complement(join(2759653..2759729,2779969..2780109,
FT                   2780341..2780408,2782233..2782335,2782465..2782612,
FT                   2787821..2787929,2788951..2789062,2789270..2789373,
FT                   2789470..2789648,2791386..2791511,2793088..2793205,
FT                   2794874..2794941,2797717..2797785,2805613..>2805714))
FT                   /gene="Padi4"
FT                   /locus_tag="mCG_119744"
FT                   /product="peptidyl arginine deiminase, type IV"
FT                   /note="gene_id=mCG119744.0 transcript_id=mCT120921.0
FT                   created on 24-MAY-2002"
FT   assembly_gap    2776383..2778529
FT                   /estimated_length=2147
FT                   /gap_type="unknown"
FT   CDS             complement(join(2782566..2782612,2787821..2787929,
FT                   2788951..2789062,2789270..2789373,2789470..2789648,
FT                   2791386..2791511,2793088..2793205,2794874..2794941,
FT                   2797717..2797785,2805613..>2805685))
FT                   /codon_start=1
FT                   /gene="Padi4"
FT                   /locus_tag="mCG_119744"
FT                   /product="peptidyl arginine deiminase, type IV"
FT                   /note="gene_id=mCG119744.0 transcript_id=mCT120921.0
FT                   protein_id=mCP53255.0"
FT                   /protein_id="EDL13326.1"
FT                   /translation="STWPPSSPLTPCVWWAQRPRWMSAEVRVSYYGLKTSPVQALIYIT
FT                   GVELSLSADVTRTGRVKPAQAGKDQSTWTWGPGGRGAILLVNCDKEDPQASGMDFEDDK
FT                   ILDNKDLQDMSPMTLSTKTPKDFFEKYQLVLEVPKAKMNRVRVFRATRGKLPSRYKVAL
FT                   GPQQFSYCLELPGGQHSTDFYVEGLAFPDADFKGLIPLTISLLDKSNPELPEALVFQDS
FT                   VTFRVAPWIMTPNTQPPQEVYVCRVSDNEDFLKSLATLTKKAKCKLTVCPEEENIDDQW
FT                   MQDEMEIGYIQAPHKTLPVVFDSPRDRGLKDFPVKRVMAAARAGTCTRPCRTS"
FT   assembly_gap    2783653..2784444
FT                   /estimated_length=792
FT                   /gap_type="unknown"
FT   assembly_gap    2791889..2791936
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    2796811..2797659
FT                   /estimated_length=849
FT                   /gap_type="unknown"
FT   assembly_gap    2799837..2799879
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2800528..2801707
FT                   /estimated_length=1180
FT                   /gap_type="unknown"
FT   assembly_gap    2810926..2811143
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   gene            complement(2816772..2843470)
FT                   /gene="Padi3"
FT                   /locus_tag="mCG_9043"
FT                   /note="gene_id=mCG9043.1"
FT   mRNA            complement(join(2816772..2818037,2820240..2820365,
FT                   2821114..2821193,2822564..2822666,2822759..2822903,
FT                   2824379..2824530,2825239..2825346,2827035..2827146,
FT                   2827235..2827338,2827759..2827937,2829474..2829599,
FT                   2830330..2830447,2832912..2832973,2834389..2834461,
FT                   2836311..2836491,2843337..2843470))
FT                   /gene="Padi3"
FT                   /locus_tag="mCG_9043"
FT                   /product="peptidyl arginine deiminase, type III"
FT                   /note="gene_id=mCG9043.1 transcript_id=mCT9182.1 created on
FT                   24-MAY-2002"
FT   CDS             complement(join(2817804..2818037,2820240..2820365,
FT                   2821114..2821193,2822564..2822666,2822759..2822903,
FT                   2824379..2824530,2825239..2825346,2827035..2827146,
FT                   2827235..2827338,2827759..2827937,2829474..2829599,
FT                   2830330..2830447,2832912..2832973,2834389..2834461,
FT                   2836311..2836491,2843337..2843428))
FT                   /codon_start=1
FT                   /gene="Padi3"
FT                   /locus_tag="mCG_9043"
FT                   /product="peptidyl arginine deiminase, type III"
FT                   /note="gene_id=mCG9043.1 transcript_id=mCT9182.1
FT                   protein_id=mCP8505.2"
FT                   /protein_id="EDL13327.1"
FT                   /translation="MSLQRIVRVSLEHPTSAVCVAGVETIVDIYGAVPEGTDMFEVYGT
FT                   PGVDIYVSPSMERSRERADTRRWCFNKGLEIIVIMNSPSNDLNDSHVQIAYHSSREHLP
FT                   LAYAVLYLTCVDITLDCDMNCADRQDRSFVDKRQWVWGPDGYGAILLVNCDRDNVDSNA
FT                   QDNCDQYVRCLQDLEDMSVMVLRTQGPEALFEDHRLILHTSSCDAERARVFHVCGPEDS
FT                   CEAYKCVLGPDRMSYEVPRLKGYEERFFVEGLSFPDAGFPGLISFHVTLLDDSNEDFSE
FT                   TPIFTDTAVFRVAPWIMTPSTLPPLEVYVCRVRNNTCFVEAVEELARKAGCKLTICPQA
FT                   ENRNDRWIQDEMELGYVQAPHKTLPVVFDSPRNGELQGFPYKRILGLDFGYVTREPKDS
FT                   SVSGLDSFGNLEVSPPVVANGKEYPLGRILIGGNLPGSRGRRVTQVVRNFLHAQKVQPL
FT                   VELFVDWLAVGHVDEFLSFVPAPDGKGFRLLLASPGACFRLFQEKQKWGHGRSLLFEGV
FT                   IGDRRVQTVSINQILNNQSLINFNKFAQSCIDWNREVLKRELGLAEGDIIDIPQLFKTE
FT                   KRKAVAFFPDLVNMLVLGKHLGIPKPFGPIINGRCCLEEKVRSLLEPLGLHCTFIDDFT
FT                   PYHMLHGEVHCGTNVRREPFAFKWWHMVP"
FT   assembly_gap    2832875..2832894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2836712..2836991
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    2840896..2840915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2843743..2844100
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   gene            complement(2845856..2879438)
FT                   /gene="Padi1"
FT                   /locus_tag="mCG_9046"
FT                   /note="gene_id=mCG9046.1"
FT   mRNA            complement(join(2845856..2847729,2850001..2850126,
FT                   2851169..2851248,2851740..2851833,2852604..2852748,
FT                   2857705..2857856,2859387..2859494,2859731..2859854,
FT                   2860790..2860893,2860979..2861151,2862042..2862167,
FT                   2862260..2862374,2863660..2863721,2864331..2864403,
FT                   2865178..2865358,2879220..2879438))
FT                   /gene="Padi1"
FT                   /locus_tag="mCG_9046"
FT                   /product="peptidyl arginine deiminase, type I"
FT                   /note="gene_id=mCG9046.1 transcript_id=mCT9183.1 created on
FT                   24-MAY-2002"
FT   CDS             complement(join(2847496..2847729,2850001..2850126,
FT                   2851169..2851248,2851740..2851833,2852604..2852748,
FT                   2857705..2857856,2859387..2859494,2859731..2859854,
FT                   2860790..2860893,2860979..2861151,2862042..2862167,
FT                   2862260..2862374,2863660..2863721,2864331..2864403,
FT                   2865178..2865358,2879220..2879311))
FT                   /codon_start=1
FT                   /gene="Padi1"
FT                   /locus_tag="mCG_9046"
FT                   /product="peptidyl arginine deiminase, type I"
FT                   /note="gene_id=mCG9046.1 transcript_id=mCT9183.1
FT                   protein_id=mCP8511.1"
FT                   /db_xref="GOA:Q544I4"
FT                   /db_xref="InterPro:IPR004303"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR013530"
FT                   /db_xref="InterPro:IPR013732"
FT                   /db_xref="InterPro:IPR013733"
FT                   /db_xref="MGI:MGI:1338893"
FT                   /db_xref="UniProtKB/TrEMBL:Q544I4"
FT                   /protein_id="EDL13328.1"
FT                   /translation="MASPRAVQLSLRKPTHAVCVVGVETLVNVYSDVPKGAKTFGVSGS
FT                   SEVKIYMVYDPSRVAEPAGWAHWPLDANVDVVVVADTVSKDLYDFKVKVSYFESQEAAA
FT                   LAHSVLYLTAVDVSLDVDTGRTGKVKKGSGDKKTWRWGPGGSGAILLVNCDRDIHGSRE
FT                   DLHANHLKSLEDLQDMSPMVLSCGGPDELFESHKLVLKASLSDSRRLKVFCARGGTSLS
FT                   NYKQVLGPRHSSYEVERHSGERAIQFYVEGLAFPDASFSGLLSLSVSLVDTRPLSEVSV
FT                   FTDSVTFRVAPWIMTPNTQPPLELYVCSVTDIHGRNDKFLEDMSHLATKANCKLVVCPR
FT                   AENRNDRWIQDELEFGYIDAPHKSFPVVFDSPRNRGLRDFALKRILGPDFGYVTREIEF
FT                   AGASGLDSFGNLDVSPPVRVGNTDYPLGRILIGGSFPKPSGRRMARVVRDFLQAQQVQS
FT                   PVELYSDWLSVGHVDEFLSFVPTSDQKGFRLLLASPSACLQLFQEKKEEGYGEAEQFDG
FT                   LKHKAKRSINDILADKHLRRDSAHVQKCIDWNREVLKRELGLSESDIVDIPQLFFLKGA
FT                   YAEAFFPDMVNMVVLGKYLGIPKPFGPLINGRCCLEEKVRSLLEPLGLRCVFIDDFLFY
FT                   HQLLGEIHCGTNVRRKPFTFKWWNSVP"
FT   assembly_gap    2872180..2872199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2873545..2873564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2877628..2877647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2887593..2887612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2889967..2895602
FT                   /estimated_length=5636
FT                   /gap_type="unknown"
FT   gene            <2901449..2906836
FT                   /locus_tag="mCG_145202"
FT                   /note="gene_id=mCG145202.0"
FT   mRNA            join(<2901449..2901620,2906322..2906548,2906645..2906836)
FT                   /locus_tag="mCG_145202"
FT                   /product="mCG145202"
FT                   /note="gene_id=mCG145202.0 transcript_id=mCT184626.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2901451..2901620,2906322..2906454)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145202"
FT                   /product="mCG145202"
FT                   /note="gene_id=mCG145202.0 transcript_id=mCT184626.0
FT                   protein_id=mCP105183.0"
FT                   /protein_id="EDL13329.1"
FT                   /translation="LGTGARHKARVKLFHLWDPRQSATPPHPAEPVTTTHLGGLARSDA
FT                   MFVECLTQANPWKPRNPLVKRKAPPRLWVACTCGPKGLISPSSVTPETKLSAREP"
FT   assembly_gap    2916899..2918182
FT                   /estimated_length=1284
FT                   /gap_type="unknown"
FT   assembly_gap    2921408..2921427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2924409..2924428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2928464..2928956
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    2930058..2930077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2935332..2973388
FT                   /gene="Padi2"
FT                   /locus_tag="mCG_119740"
FT                   /note="gene_id=mCG119740.0"
FT   mRNA            join(<2935332..2935454,2948042..2948161,2949108..2949233,
FT                   2954080..2954258,2954678..2954781,2955104..2955215,
FT                   2956548..2956655,2958452..2958603,2959855..2959999,
FT                   2965344..2965437,2967581..2967666,2970014..2970142,
FT                   2970493..2973388)
FT                   /gene="Padi2"
FT                   /locus_tag="mCG_119740"
FT                   /product="peptidyl arginine deiminase, type II"
FT                   /note="gene_id=mCG119740.0 transcript_id=mCT120917.0
FT                   created on 24-MAY-2002"
FT   CDS             join(<2935454..2935454,2948042..2948161,2949108..2949233,
FT                   2954080..2954258,2954678..2954781,2955104..2955215,
FT                   2956548..2956655,2958452..2958603,2959855..2959999,
FT                   2965344..2965437,2967581..2967666,2970014..2970142,
FT                   2970493..2970726)
FT                   /codon_start=1
FT                   /gene="Padi2"
FT                   /locus_tag="mCG_119740"
FT                   /product="peptidyl arginine deiminase, type II"
FT                   /note="gene_id=mCG119740.0 transcript_id=mCT120917.0
FT                   protein_id=mCP53223.1"
FT                   /protein_id="EDL13330.1"
FT                   /translation="EASWTWGPEGQGAILLVNCDRDTPWLPKEDCSDEKVYSKQDLQDM
FT                   SQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRQKLYHVVK
FT                   YTGGSAELLFFVEGLCFPDESFSGLVSIHVSLLEYMAEGIPLTPIFTDTVMFRIAPWIM
FT                   TPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYMNRGDRWIQDEIEFGYI
FT                   EAPHKGFPVVLDSPRDGNLKDFPIKQLLGPDFGYVTREPLFETVTSLDSFGNLEVSPPV
FT                   TVNGKEYPLGRILIGSSFPLSGGRRMTKVVRDFLQAQQVQAPVELYSDWLTVGHVDEFM
FT                   TFIPIPGKKEFRLLMASTSACYQLFREKQKAGHGEAVMFKGLGGMSSKRITINKILSNE
FT                   SLTQENQYFQRCLDWNRDILKRELALTEKDIIDLPALFKMDENHQARAFFPNMVNMIVL
FT                   DKDLGIPKPFGPQVEEECCLETHVRGLLEPLGLACTFIDDISAYHKFLGEVHCGTNVRR
FT                   KPFTFKWWHMVP"
FT   assembly_gap    2937945..2937964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2941149..2947058
FT                   /estimated_length=5910
FT                   /gap_type="unknown"
FT   assembly_gap    2961500..2963753
FT                   /estimated_length=2254
FT                   /gap_type="unknown"
FT   assembly_gap    2974916..2975228
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   gene            2981909..2999937
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /note="gene_id=mCG9052.3"
FT   mRNA            join(2981909..2982182,2991880..2991965,2993630..2993766,
FT                   2994411..2994527,2996862..2996963,2998125..2998247,
FT                   2999769..2999929)
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant mCT179628"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT179628.0 created
FT                   on 05-FEB-2003"
FT   mRNA            join(2981909..2982182,2987141..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994527,2996862..2996963,
FT                   2998125..2998247,2999769..2999902)
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant mCT179629"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT179629.0 created
FT                   on 05-FEB-2003"
FT   mRNA            join(2981909..2982182,2987135..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994527,2996862..2996963,
FT                   2998125..2998688)
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant mCT179627"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT179627.0 created
FT                   on 05-FEB-2003"
FT   mRNA            join(2981909..2982182,2987135..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2995044)
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant mCT179626"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT179626.0 created
FT                   on 05-FEB-2003"
FT   mRNA            join(2981955..2982182,2987135..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994527,2996862..2996963,
FT                   2998125..2998247,2999769..2999934)
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant mCT9189"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT9189.2 created on
FT                   05-FEB-2003"
FT   mRNA            join(2982068..2982170,2991864..2991965,2993630..2993766,
FT                   2994411..2994527,2996862..2996963,2998125..2998247,
FT                   2999769..2999937)
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant mCT169280"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT169280.0 created
FT                   on 05-FEB-2003"
FT   mRNA            join(2982068..2982182,2987135..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994527,2996862..2997125)
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), transcript variant mCT169281"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT169281.0 created
FT                   on 05-FEB-2003"
FT   CDS             join(2982111..2982182,2987135..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994527,2996862..2996963,
FT                   2998125..2998247,2999769..2999846)
FT                   /codon_start=1
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_f"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT9189.2
FT                   protein_id=mCP8516.0 isoform=CRA_f"
FT                   /protein_id="EDL13336.1"
FT                   /translation="MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFA
FT                   IYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCA
FT                   MNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKD
FT                   ESQEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMI
FT                   DSRDDFTEERLAKLQDPFSVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRAL
FT                   A"
FT   CDS             join(2982111..2982182,2987141..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994527,2996862..2996963,
FT                   2998125..2998247,2999769..2999846)
FT                   /codon_start=1
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_e"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT179629.0
FT                   protein_id=mCP102551.0 isoform=CRA_e"
FT                   /protein_id="EDL13335.1"
FT                   /translation="MAATVGVSLKRGFPAAVLGRVGLQACRGAQTAAAAAPRIKKFAIY
FT                   RWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMN
FT                   INGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDES
FT                   QEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDS
FT                   RDDFTEERLAKLQDPFSVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA"
FT   CDS             join(2982111..2982182,2987135..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994527,2996862..2996963,
FT                   2998125..2998637)
FT                   /codon_start=1
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_c"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT179627.0
FT                   protein_id=mCP102550.0 isoform=CRA_c"
FT                   /protein_id="EDL13333.1"
FT                   /translation="MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFA
FT                   IYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCA
FT                   MNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKD
FT                   ESQEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMI
FT                   DSRDDFTEERLAKLQDPFSVYRCHTIMNCTQTCPKVWQGWPGHSRWMPDVSVGVWNGSL
FT                   SHRLHQVPRGAGLTCGSIEMEGARCLQDPTLWGAGGSGRQGPSAGVTALATDVLHPVWQ
FT                   AGICSAELPWTQAMGLPSLPLISFVAVLSCLRQCLYIAIAVQELTL"
FT   CDS             join(2982111..2982182,2987135..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994527,2996862..2997104)
FT                   /codon_start=1
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_a"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT169281.0
FT                   protein_id=mCP92030.0 isoform=CRA_a"
FT                   /protein_id="EDL13331.1"
FT                   /translation="MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFA
FT                   IYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCA
FT                   MNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKD
FT                   ESQEGKQQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQVRHSPP
FT                   QTARGPRRWWPARGSYLQKAAGLRQTPGTPAHWAHVAQRI"
FT   CDS             join(2982111..2982182,2987135..2987268,2991880..2991965,
FT                   2993630..2993766,2994411..2994539)
FT                   /codon_start=1
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_b"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT179626.0
FT                   protein_id=mCP102549.0 isoform=CRA_b"
FT                   /protein_id="EDL13332.1"
FT                   /translation="MAATVGVSLKRGFPAAVLGRVGLQFQACRGAQTAAAAAPRIKKFA
FT                   IYRWDPDKTGDKPRMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCA
FT                   MNINGGNTLACTRRIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKD
FT                   ESQEGKQQYLQSIEDREKLVIT"
FT   assembly_gap    2985738..2986077
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    2988340..2988393
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    2988864..2988969
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   CDS             join(2991890..2991965,2993630..2993766,2994411..2994527,
FT                   2996862..2996963,2998125..2998247,2999769..2999846)
FT                   /codon_start=1
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_d"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT179628.0
FT                   protein_id=mCP102548.0 isoform=CRA_d"
FT                   /protein_id="EDL13334.1"
FT                   /translation="MVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTR
FT                   RIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSI
FT                   EDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAK
FT                   LQDPFSVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA"
FT   CDS             join(2991890..2991965,2993630..2993766,2994411..2994527,
FT                   2996862..2996963,2998125..2998247,2999769..2999846)
FT                   /codon_start=1
FT                   /gene="Sdhb"
FT                   /locus_tag="mCG_9052"
FT                   /product="succinate dehydrogenase complex, subunit B, iron
FT                   sulfur (Ip), isoform CRA_d"
FT                   /note="gene_id=mCG9052.3 transcript_id=mCT169280.0
FT                   protein_id=mCP92062.0 isoform=CRA_d"
FT                   /protein_id="EDL13337.1"
FT                   /translation="MVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTR
FT                   RIDTDLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSI
FT                   EDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAK
FT                   LQDPFSVYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMATYKEKRALA"
FT   assembly_gap    3000915..3000934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3003730..3003749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3008008..3027906
FT                   /gene="Atp13a2"
FT                   /locus_tag="mCG_123815"
FT                   /note="gene_id=mCG123815.1"
FT   mRNA            join(3008008..3008118,3013169..3013263,3013375..3013557,
FT                   3014828..3014886,3014980..3015094,3015344..3015423,
FT                   3016357..3016434,3016589..3016658,3017334..3017468,
FT                   3017556..3017622,3017701..3017832,3020153..3020308,
FT                   3021369..3021479,3021569..3021615,3022055..3022289,
FT                   3022656..3022745,3022823..3022982,3023099..3023197,
FT                   3023312..3023423,3024448..3024521,3024603..3024682,
FT                   3025237..3025389,3025501..3025597,3026357..3026580,
FT                   3026666..3026817,3026993..3027197,3027337..3027906)
FT                   /gene="Atp13a2"
FT                   /locus_tag="mCG_123815"
FT                   /product="ATPase type 13A2"
FT                   /note="gene_id=mCG123815.1 transcript_id=mCT125051.1
FT                   created on 03-SEP-2002"
FT   CDS             join(3008109..3008118,3013169..3013263,3013375..3013557,
FT                   3014828..3014886,3014980..3015094,3015344..3015423,
FT                   3016357..3016434,3016589..3016658,3017334..3017468,
FT                   3017556..3017622,3017701..3017832,3020153..3020308,
FT                   3021369..3021479,3021569..3021615,3022055..3022237)
FT                   /codon_start=1
FT                   /gene="Atp13a2"
FT                   /locus_tag="mCG_123815"
FT                   /product="ATPase type 13A2"
FT                   /note="gene_id=mCG123815.1 transcript_id=mCT125051.1
FT                   protein_id=mCP53284.1"
FT                   /protein_id="EDL13338.1"
FT                   /translation="MSADSSLLMGSTPPSYGTLTTGTSIDPLSSSASSVRLSGYCGSPW
FT                   RAIGYHAAVWMLAGIPWLLFRWKPLWGVRLRLKPCSLAHAETLVIEIKDKEGSSRQLFT
FT                   VQVQTEAVVQGSLELPPQAQAEDGRSQAAVGVTPEGTWQDTSELHRQEEAKQVLRYYVL
FT                   QGQRYVWMETQQAFCQVSLLDHSRTCDDVHCSSSGLSLQDQATRKTIYGPNVISIPVKS
FT                   YLQLLADEALNPYYGFQAFSIALWLADHYYWYALCIFLISAISICLALYKTRKQSLTLR
FT                   DMVKLSVRVQVCRPGGEEEWVDSSELVPGDCLVLPQEGGVMPCDAALVAGECVVNESSL
FT                   TGESTPVLKTALPEGPKPYCPETHRRHTLFCGTLILQARAYVGPRVLAVVTRTGFCTAK
FT                   GGLVSSILHPRPISFKFYKHSMKFVAALSVLALLGTVYSIVILYRNRPRTWHCPLADRH
FT                   PHGGRLGRNGRGAPKGAGVAATGPRALPPAPGAPPASTGHLSCPQPAT"
FT   assembly_gap    3021660..3021679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3023198..3023226
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    3023975..3024446
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    3025881..3026297
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    3027198..3027336
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   gene            <3030893..3036240
FT                   /gene="Mfap2"
FT                   /locus_tag="mCG_9053"
FT                   /note="gene_id=mCG9053.2"
FT   mRNA            join(<3030893..3030977,3033083..3033158,3034039..3034125,
FT                   3034322..3034348,3034455..3034535,3034661..3034714,
FT                   3035183..3035278)
FT                   /gene="Mfap2"
FT                   /locus_tag="mCG_9053"
FT                   /product="microfibrillar-associated protein 2, transcript
FT                   variant mCT190706"
FT                   /note="gene_id=mCG9053.2 transcript_id=mCT190706.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(3030937..3030977,3033083..3033158,3034039..3034125,
FT                   3034322..3034348,3034455..3034535,3034661..3034714,
FT                   3035249..3035336,3035481..3035554,3035743..3036240)
FT                   /gene="Mfap2"
FT                   /locus_tag="mCG_9053"
FT                   /product="microfibrillar-associated protein 2, transcript
FT                   variant mCT9190"
FT                   /note="gene_id=mCG9053.2 transcript_id=mCT9190.1 created on
FT                   24-MAY-2002"
FT   CDS             join(<3030954..3030977,3033083..3033158,3034039..3034125,
FT                   3034322..3034348,3034455..3034535,3034661..3034714,
FT                   3035183..3035220)
FT                   /codon_start=1
FT                   /gene="Mfap2"
FT                   /locus_tag="mCG_9053"
FT                   /product="microfibrillar-associated protein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9053.2 transcript_id=mCT190706.0
FT                   protein_id=mCP111664.0 isoform=CRA_a"
FT                   /protein_id="EDL13339.1"
FT                   /translation="STAQRPQQLSSTPPPPPHSMAMRAACLFLLFMPGLLAQGQYDLDP
FT                   LPPFPDHVQYNHYGDQIDNADYYDYQEVSPRTPEEQFQSQQQVQQEVIPAPTPEPAAAG
FT                   DLETEPTEPGPLGPEGAWGPRPHA"
FT   CDS             join(3033122..3033158,3034039..3034125,3034322..3034348,
FT                   3034455..3034535,3034661..3034714,3035249..3035336,
FT                   3035481..3035554,3035743..3035846)
FT                   /codon_start=1
FT                   /gene="Mfap2"
FT                   /locus_tag="mCG_9053"
FT                   /product="microfibrillar-associated protein 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG9053.2 transcript_id=mCT9190.1
FT                   protein_id=mCP8498.1 isoform=CRA_b"
FT                   /protein_id="EDL13340.1"
FT                   /translation="MRAACLFLLFMPGLLAQGQYDLDPLPPFPDHVQYNHYGDQIDNAD
FT                   YYDYQEVSPRTPEEQFQSQQQVQQEVIPAPTPEPAAAGDLETEPTEPGPLDCREEQYPC
FT                   TRLYSIHKPCKQCLNEVCFYSLRRVYVVNKEICVRTVCAHEELLRADLCRDKFSKCGVM
FT                   AVSGLCQSVAASCARSCGGC"
FT   gene            complement(3036911..>3057319)
FT                   /gene="Crocc"
FT                   /locus_tag="mCG_140374"
FT                   /note="gene_id=mCG140374.0"
FT   mRNA            complement(join(3036911..3037403,3038125..3038304,
FT                   3038521..3038652,3038940..3039140,3039435..3039584,
FT                   3039980..3040204,3040546..3040761,3041934..3042097,
FT                   3042324..3042444,3042548..3042717,3045794..3045941,
FT                   3046498..3046665,3048757..3048916,3049516..3049754,
FT                   3050111..3050254,3050567..3050701,3051310..3051489,
FT                   3053217..3053386,3054389..3054516,3054774..3054955,
FT                   3055564..3055794,3056098..3056244,3057181..>3057319))
FT                   /gene="Crocc"
FT                   /locus_tag="mCG_140374"
FT                   /product="ciliary rootlet coiled-coil, rootletin"
FT                   /note="gene_id=mCG140374.0 transcript_id=mCT169279.0
FT                   created on 24-MAY-2002"
FT   CDS             complement(join(3037317..3037403,3038125..3038304,
FT                   3038521..3038652,3038940..3039140,3039435..3039584,
FT                   3039980..3040204,3040546..3040761,3041934..3042097,
FT                   3042324..3042444,3042548..3042717,3045794..3045941,
FT                   3046498..3046665,3048757..3048916,3049516..3049754,
FT                   3050111..3050254,3050567..3050701,3051310..3051489,
FT                   3053217..3053386,3054389..3054516,3054774..3054955,
FT                   3055564..3055794,3056098..3056244,3057181..>3057225))
FT                   /codon_start=1
FT                   /gene="Crocc"
FT                   /locus_tag="mCG_140374"
FT                   /product="ciliary rootlet coiled-coil, rootletin"
FT                   /note="gene_id=mCG140374.0 transcript_id=mCT169279.0
FT                   protein_id=mCP92064.0"
FT                   /protein_id="EDL13341.1"
FT                   /translation="VLQTEKAEVAEALTKAEAGRAQLELSLTKLRAEEASLRDSLSKMS
FT                   ALNESLAQDKLELNRLIAQLEEEKVALLGRQQQAEHATTMAVEKQELLEQLRLEQEVER
FT                   QGLQGSLCMAEQAREALEQQILVLRSERSHLQEQLAQLNGRDQELEQALRESQRQVEAL
FT                   ERAAREKEAMAKERAGLAVKLAAAEREGRTLSEEAIRLRLEKEALESSLFDVQRQLAQL
FT                   EARREQLEADSQALLLAKETLTGELAGLRQQVTSTEEKAALDKELMTQKLVQAEREAQA
FT                   SLREQRAAHEEDLQRLQHEKEAAWRELQAERAQLQGQLQQEREELLARMEAEKEELSEE
FT                   IAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMGTRHSLAAISLEMERQKRDAQ
FT                   SRQEQDRNTLNALTSELRDLRAQLEEATAAHAQTVKELEERTGNLGRQREACMREAEEL
FT                   RTQLRVLEDTRDGLRRELLEAQRKGRDSQDSSEAHRQEASELRRSLSEGAKEREALRRS
FT                   NEELRSAVKKAESERISLKLANEDKEQKLALLEEARVSVAKEAGELRASLQEVERSRLE
FT                   ARRELQELRRQMKTLDSDNGRLGRELADLQGRLALGERTEKESRREALGLRQRLLKGES
FT                   SLEALKQELQGSQRKLQEQEAEFRARERGLLGSLEEARGAEKRLLDFCPQPGAEAGGGS
FT                   GDGLSSPSPLEYSPRSQPPSPGLIASPAPPDLDPEAVRDALRDFLQELRSAQRERDELK
FT                   VQTSTLSQQLAEMEAERDHAASRAKQLQKAVAESEEAWRSADRRLSGAQAELALQEESV
FT                   RRSKRECRATLDQMAVLERSLQATESELRASQEKVSKMKATEAKLESDKRRLKEVLDAS
FT                   ESRSIKLELQRRALEGELQRSRLGLGDREAHAQALQDRVDSLQRQVADSEVKAGTLQLT
FT                   VERLSGALAKVEESEGSLRSKVQSLTDALTQSSASLSSTQDKNLHLQKALSTCEHDRQV
FT                   LQERLDAARQALSEARRQSSSLGEQVQTLRGELASLELQRGDAEGQLQQLQQALRQRQE
FT                   GEAMALRSVQKLQEERRLLQERLGSLQRALAQLEAEKRDLERSALQFDKDRVALRKTLD
FT                   KVEREKLRSHEDTLRLNAERGRLDRTLTGAELDLAEAQQQIQHLEAQVDVALEGNHNPV
FT                   QPEAGEQQLELQQEVERLRSAQVQTERTLEARERAHRQRVSGLEEQVSTLKAQLHQELR
FT                   RSSASVSLPSGTPEK"
FT   assembly_gap    3045547..3045742
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    3056944..3057012
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3074035..3074054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3077894..3077913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3081105..3081124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3082924..3082943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3090827..3102613)
FT                   /gene="Necap2"
FT                   /locus_tag="mCG_9055"
FT                   /note="gene_id=mCG9055.2"
FT   mRNA            complement(join(3090827..3091923,3092506..3092590,
FT                   3094367..3094544,3096839..3096947,3097818..3097899,
FT                   3097985..3098089,3099260..3099360,3102513..3102613))
FT                   /gene="Necap2"
FT                   /locus_tag="mCG_9055"
FT                   /product="NECAP endocytosis associated 2"
FT                   /note="gene_id=mCG9055.2 transcript_id=mCT9191.2 created on
FT                   24-MAY-2002"
FT   CDS             complement(join(3091875..3091923,3092506..3092590,
FT                   3094367..3094544,3096839..3096947,3097818..3097899,
FT                   3097985..3098089,3099260..3099360,3102513..3102604))
FT                   /codon_start=1
FT                   /gene="Necap2"
FT                   /locus_tag="mCG_9055"
FT                   /product="NECAP endocytosis associated 2"
FT                   /note="gene_id=mCG9055.2 transcript_id=mCT9191.2
FT                   protein_id=mCP8502.2"
FT                   /protein_id="EDL13342.1"
FT                   /translation="MEESEYESVLCVKPEVHVYRIPPRATNRGYRASEWQLDQPSWSGR
FT                   LRITAKGKVAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAF
FT                   IGLGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDEGPKLDLGFKDGQTIKINIA
FT                   NMRKKEGAAGTPRARPTSAGGLSLLPPPPGGKSSTVIPPSGEQLSVGGSLVQPAVVSGS
FT                   GGATELWPQSKPAAAATADIWGDFTKSTGSPSSQSQPGTGWVQF"
FT   assembly_gap    3106403..3106531
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   gene            3109120..3109748
FT                   /pseudo
FT                   /locus_tag="mCG_48920"
FT                   /note="gene_id=mCG48920.1"
FT   mRNA            3109120..3109748
FT                   /pseudo
FT                   /locus_tag="mCG_48920"
FT                   /note="gene_id=mCG48920.1 transcript_id=mCT49103.2 created
FT                   on 24-MAY-2002"
FT   assembly_gap    3110901..3110941
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    3119381..3121202
FT                   /estimated_length=1822
FT                   /gap_type="unknown"
FT   gene            <3125988..3139495
FT                   /gene="Spata21"
FT                   /locus_tag="mCG_123822"
FT                   /note="gene_id=mCG123822.1"
FT   mRNA            join(<3125988..3126451,3126975..3127063,3127827..3127964,
FT                   3131426..3131563,3133547..3133844,3138098..3138273,
FT                   3138810..3139495)
FT                   /gene="Spata21"
FT                   /locus_tag="mCG_123822"
FT                   /product="spermatogenesis associated 21"
FT                   /note="gene_id=mCG123822.1 transcript_id=mCT125058.1
FT                   created on 24-MAY-2002"
FT   CDS             join(<3125988..3126451,3126975..3127063,3127827..3127964,
FT                   3131426..3131563,3133547..3133844,3138098..3138273,
FT                   3138810..3139039)
FT                   /codon_start=1
FT                   /gene="Spata21"
FT                   /locus_tag="mCG_123822"
FT                   /product="spermatogenesis associated 21"
FT                   /note="gene_id=mCG123822.1 transcript_id=mCT125058.1
FT                   protein_id=mCP53336.1"
FT                   /protein_id="EDL13343.1"
FT                   /translation="PQEERDTEKRELGQGQKQRQQALSAAGTQGPANSRRGFMKCLLEV
FT                   EEQEEATHRRTLKSRGLTARRSPKTVTSVSTSGPISSSVPTLPLTLHEPSTSAPASVPS
FT                   WVRPPAPGQTPIPMGSPGSVLPTSAQDQNWRWPEFLPQGNERTLTYAKILRQEPEEHSL
FT                   FRMYQSWEERTEEHLTLKQEEAFRSYFDIFNGPGEVDARSLKNILLLIGFTFTPAQVEE
FT                   ALMSADVNAFRSYFDIFNGPGEVDARSLKNILLLIGFTFTPAQVEEALMSADVNDGHVD
FT                   FKDFLAVMTDTKRFFCSVGEQRGQPWAVRAGKGPWRLMGDIDVPESNGGYSFMIPEQNV
FT                   LMDMSPRNPYTLFFEILSLLVEMLALPELALEEITNYYQKKLKEGSSKAREMESAMGGL
FT                   RQRKKIPYNPQQVENLEVPERRVLRILSRLKQQNYAANLQSPYAQVPCIPLCPRLDKKA
FT                   VRRKLASHNHSVLDQCVSTSLGPDFHGLFFQPGQQGSRWVLRARASWAHLRC"
FT   assembly_gap    3127361..3127380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3129629..3129648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3130904..3130923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3132893..3133319
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    3136058..3136077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3140320..>3166024)
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /note="gene_id=mCG9036.3"
FT   mRNA            complement(join(3140320..3142681,3145384..3145638,
FT                   3147181..3147230,3165957..>3166023))
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /product="DNA segment, Chr 4, ERATO Doi 22, expressed,
FT                   transcript variant mCT9173"
FT                   /note="gene_id=mCG9036.3 transcript_id=mCT9173.2 created on
FT                   10-FEB-2003"
FT   mRNA            complement(join(3142046..3142681,3145384..3145638,
FT                   3165957..>3166024))
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /product="DNA segment, Chr 4, ERATO Doi 22, expressed,
FT                   transcript variant mCT190705"
FT                   /note="gene_id=mCG9036.3 transcript_id=mCT190705.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3142046..3142681,3145384..3145635,
FT                   3165957..>3166017))
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /product="DNA segment, Chr 4, ERATO Doi 22, expressed,
FT                   transcript variant mCT179998"
FT                   /note="gene_id=mCG9036.3 transcript_id=mCT179998.0 created
FT                   on 10-FEB-2003"
FT   CDS             complement(join(3142579..3142681,3145384..3145638,
FT                   3165957..>3166024))
FT                   /codon_start=1
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /product="DNA segment, Chr 4, ERATO Doi 22, expressed,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG9036.3 transcript_id=mCT190705.0
FT                   protein_id=mCP111662.0 isoform=CRA_c"
FT                   /protein_id="EDL13346.1"
FT                   /translation="GKRRVRWKMRRSLRAGRRRQTAGRKSKSPPKVPIVIQDDSLPTGP
FT                   PPQIRILKRPTSNGVVSSPNSTSRPALPVKSLAQREAEYAEARRRILGSASPEEEQEKP
FT                   ILDRPTRISQPEDSRQPSNVIRQPLGPDGSQGFKQRR"
FT   CDS             complement(join(3142579..3142681,3145384..3145638,
FT                   3147181..3147230,3165957..>3166022))
FT                   /codon_start=1
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /product="DNA segment, Chr 4, ERATO Doi 22, expressed,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG9036.3 transcript_id=mCT9173.2
FT                   protein_id=mCP8503.2 isoform=CRA_d"
FT                   /protein_id="EDL13347.1"
FT                   /translation="KAASKMEDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSP
FT                   PKVPIVIQDDSLPTGPPPQIRILKRPTSNGVVSSPNSTSRPALPVKSLAQREAEYAEAR
FT                   RRILGSASPEEEQEKPILDRPTRISQPEDSRQPSNVIRQPLGPDGSQGFKQRR"
FT   CDS             complement(join(3142579..3142681,3145384..3145635,
FT                   3165957..>3166015))
FT                   /codon_start=1
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /product="DNA segment, Chr 4, ERATO Doi 22, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG9036.3 transcript_id=mCT179998.0
FT                   protein_id=mCP102920.0 isoform=CRA_a"
FT                   /protein_id="EDL13344.1"
FT                   /translation="RVRWKMRRSLRAGRRRQTAGKSKSPPKVPIVIQDDSLPTGPPPQI
FT                   RILKRPTSNGVVSSPNSTSRPALPVKSLAQREAEYAEARRRILGSASPEEEQEKPILDR
FT                   PTRISQPEDSRQPSNVIRQPLGPDGSQGFKQRR"
FT   mRNA            complement(join(3143383..3143456,3145384..3145638,
FT                   3147181..3147230,3165957..>3166005))
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /product="DNA segment, Chr 4, ERATO Doi 22, expressed,
FT                   transcript variant mCT179999"
FT                   /note="gene_id=mCG9036.3 transcript_id=mCT179999.0 created
FT                   on 10-FEB-2003"
FT   CDS             complement(join(3143387..3143456,3145384..3145638,
FT                   3147181..3147230,3165957..>3166004))
FT                   /codon_start=1
FT                   /gene="D4Ertd22e"
FT                   /locus_tag="mCG_9036"
FT                   /product="DNA segment, Chr 4, ERATO Doi 22, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG9036.3 transcript_id=mCT179999.0
FT                   protein_id=mCP102921.0 isoform=CRA_b"
FT                   /protein_id="EDL13345.1"
FT                   /translation="EDEEVAESWEEAADSGEIDRRLEKKLKITQKESRKSKSPPKVPIV
FT                   IQDDSLPTGPPPQIRILKRPTSNGVVSSPNSTSRPALPVKSLAQREAEYAEARRRILGS
FT                   ASPEEEQEKPILDSLHLSGVGKVHFLLSSLVLGVSS"
FT   assembly_gap    3172272..3172291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3175369..3229818
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /note="gene_id=mCG9037.2"
FT   mRNA            join(3175369..3175633,3194933..3195199,3198048..3198164,
FT                   3209465..3209599,3222758..3222911,3224275..3224385,
FT                   3226577..3226673,3227096..3227152,3228033..3228054,
FT                   3228457..3229818)
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /product="F-box protein 42, transcript variant mCT9174"
FT                   /note="gene_id=mCG9037.2 transcript_id=mCT9174.2 created on
FT                   10-FEB-2003"
FT   mRNA            join(3175369..3175633,3209465..3209599,3222758..3222911,
FT                   3224275..3224385,3226577..3226673,3227096..3227152,
FT                   3228033..3228054,3228457..3229803)
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /product="F-box protein 42, transcript variant mCT180001"
FT                   /note="gene_id=mCG9037.2 transcript_id=mCT180001.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(3175423..3175633,3222758..3222911,3224275..3224385,
FT                   3226577..3226673,3227096..3227152,3228033..3228054,
FT                   3228457..3229803)
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /product="F-box protein 42, transcript variant mCT180000"
FT                   /note="gene_id=mCG9037.2 transcript_id=mCT180000.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(<3175530..3175633,3194933..3195199,3198048..3198164,
FT                   3209465..3209599,3222758..3222911,3224275..3224385,
FT                   3226577..3226673,3227096..3227152,3228457..3229805)
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /product="F-box protein 42, transcript variant mCT190708"
FT                   /note="gene_id=mCG9037.2 transcript_id=mCT190708.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3175543..3175633,3194933..3195199,3198048..3198164,
FT                   3209465..3209599,3222758..3222911,3224275..3224385,
FT                   3226577..3226673,3227096..3227152,3228457..3229572)
FT                   /codon_start=1
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /product="F-box protein 42, isoform CRA_b"
FT                   /note="gene_id=mCG9037.2 transcript_id=mCT190708.0
FT                   protein_id=mCP111663.0 isoform=CRA_b"
FT                   /protein_id="EDL13349.1"
FT                   /translation="GRAAVLWPRPWLLRHRRRRRETESAERSGPELQVCVMASSSDSED
FT                   DSVMAVDQEETALEGTMEQDEDPHPVLEVEETRHNRSMSELPEEVLEYILSFLSPYQEH
FT                   KTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYY
FT                   DANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLL
FT                   VLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVIGDKMI
FT                   VFGGSLGSRQMSNEVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDTTLLILGGCGG
FT                   PNAVGQCVVVFSQAPSGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAP
FT                   CVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGNLSPGTVAVGGASLDSPVQ
FT                   VVSPSTPSASDGYDLKVGLSLAPRRGSLPDQKDLRLSSIDLNWDLKSASSSSHVDSIDN
FT                   RTVAGSVRHPPEQTNGVHTPPHVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSP
FT                   PLGSSPSSPGSQSLSSGETVPNSRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQS
FT                   MNCKPMQMYVLDIKDTKEKGRVKWKVFTSSSVVGPPETSLHTVVQGRGELIVFGGLMDK
FT                   KQNVKYYPKTNALYFVRAKR"
FT   assembly_gap    3175828..3175847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3180787..3180920
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   CDS             join(3194950..3195199,3198048..3198164,3209465..3209599,
FT                   3222758..3222911,3224275..3224385,3226577..3226673,
FT                   3227096..3227152,3228033..3228054,3228457..3228572)
FT                   /codon_start=1
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /product="F-box protein 42, isoform CRA_c"
FT                   /note="gene_id=mCG9037.2 transcript_id=mCT9174.2
FT                   protein_id=mCP8506.2 isoform=CRA_c"
FT                   /protein_id="EDL13351.1"
FT                   /translation="MASSSDSEDDSVMAVDQEETALEGTMEQDEDPHPVLEVEETRHNR
FT                   SMSELPEEVLEYILSFLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQW
FT                   ESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIR
FT                   PLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNC
FT                   IVTTHGPPPMAGHSSCVIGDKMIVFGGSLGSRQMSNEVWVLDLEQWAWSKPNISGPSPH
FT                   PRGGQSQIVIDDTTLLILGGCGGPNAMVSSSLPGGTVCGGLQPGAKRESAPQPQFELSP
FT                   VTYQCHSSSPGS"
FT   assembly_gap    3200199..3200218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3201676..3201695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(3224312..3224385,3226577..3226673,3227096..3227152,
FT                   3228033..3228054,3228457..3228572)
FT                   /codon_start=1
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /product="F-box protein 42, isoform CRA_a"
FT                   /note="gene_id=mCG9037.2 transcript_id=mCT180001.0
FT                   protein_id=mCP102923.0 isoform=CRA_a"
FT                   /protein_id="EDL13348.1"
FT                   /translation="MAGHSSCVIGDKMIVFGGSLGSRQMSNEVWVLDLEQWAWSKPNIS
FT                   GPSPHPRGGQSQIVIDDTTLLILGGCGGPNAMVSSSLPGGTVCGGLQPGAKRESAPQPQ
FT                   FELSPVTYQCHSSSPGS"
FT   CDS             join(3224312..3224385,3226577..3226673,3227096..3227152,
FT                   3228033..3228054,3228457..3228572)
FT                   /codon_start=1
FT                   /gene="Fbxo42"
FT                   /locus_tag="mCG_9037"
FT                   /product="F-box protein 42, isoform CRA_a"
FT                   /note="gene_id=mCG9037.2 transcript_id=mCT180000.0
FT                   protein_id=mCP102922.0 isoform=CRA_a"
FT                   /protein_id="EDL13350.1"
FT                   /translation="MAGHSSCVIGDKMIVFGGSLGSRQMSNEVWVLDLEQWAWSKPNIS
FT                   GPSPHPRGGQSQIVIDDTTLLILGGCGGPNAMVSSSLPGGTVCGGLQPGAKRESAPQPQ
FT                   FELSPVTYQCHSSSPGS"
FT   assembly_gap    3227819..3228032
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    3235324..3235343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3237246..3237265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3238423..3238442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3239829..3239848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3242338..3248521
FT                   /locus_tag="mCG_9045"
FT                   /note="gene_id=mCG9045.2"
FT   mRNA            join(3242338..3242399,3242659..3242808,3245588..3245740,
FT                   3246441..3246565,3246874..3247010,3248172..3248521)
FT                   /locus_tag="mCG_9045"
FT                   /product="mCG9045"
FT                   /note="gene_id=mCG9045.2 transcript_id=mCT9181.2 created on
FT                   27-MAY-2002"
FT   CDS             join(3242697..3242808,3245588..3245740,3246441..3246565,
FT                   3246874..3247010,3248172..3248421)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9045"
FT                   /product="mCG9045"
FT                   /note="gene_id=mCG9045.2 transcript_id=mCT9181.2
FT                   protein_id=mCP8500.2"
FT                   /db_xref="GOA:B2RWG6"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1923416"
FT                   /db_xref="UniProtKB/TrEMBL:B2RWG6"
FT                   /protein_id="EDL13352.1"
FT                   /translation="MARPPMHGSVIVPDWHETVEGKEYLACILRKNRRREFGLLERPVL
FT                   PPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVPIVHHETTGIQTTVVFWPAKLKAS
FT                   DCVVMFRFEFWDCGESALKKFDHMLPACKENADAFLFLFSFTDRASFEDLPGQLTRVAG
FT                   EAPGLVKIVIGSKFDQYMHTDVPARDLTAFRQAWELPLFRVKSVPGRRLADGRTLDGRA
FT                   GLADTAHVLNGLAEQLWHQDQVAAGLLPSSPESAPG"
FT   gene            complement(3266632..3267907)
FT                   /locus_tag="mCG_147456"
FT                   /note="gene_id=mCG147456.0"
FT   mRNA            complement(3266632..3267907)
FT                   /locus_tag="mCG_147456"
FT                   /product="mCG147456"
FT                   /note="gene_id=mCG147456.0 transcript_id=mCT187719.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3266963..3267331)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147456"
FT                   /product="mCG147456"
FT                   /note="gene_id=mCG147456.0 transcript_id=mCT187719.0
FT                   protein_id=mCP108138.0"
FT                   /db_xref="GOA:Q8C7M9"
FT                   /db_xref="MGI:MGI:3641643"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C7M9"
FT                   /protein_id="EDL13353.1"
FT                   /translation="MGDVSHTLKAQGSIPESGQGGWKSQKWQMDPEETEVSRLPTRRCT
FT                   YELTETVKCIRPAQAQARQKSQCVEGKVDINSHPSPRGYLQLILAGKGTSAFFNGVTSG
FT                   VSNTLKSLELRKSWPSQI"
FT   gene            3268038..3286035
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /note="gene_id=mCG123828.2"
FT   mRNA            join(3268038..3268323,3269085..3269197,3273271..3273425,
FT                   3274628..3275062,3275402..3275683,3275831..3275939,
FT                   3276007..3276083,3276300..3276562,3277435..3277595,
FT                   3277675..3277827,3278014..3278143,3279028..3279102,
FT                   3279193..3279282,3279409..3279569,3282763..3282921,
FT                   3283174..3283253,3284777..3284881,3285195..3286025)
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   transcript variant mCT125064"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT125064.1
FT                   created on 27-MAY-2002"
FT   mRNA            join(3268104..3268323,3269085..3269197,3274628..3275062,
FT                   3275402..3275683,3275831..3275939,3276007..3276083,
FT                   3276300..3276562,3277435..3277595,3277675..3277827,
FT                   3278014..3278143,3279028..3279102,3279193..3279282,
FT                   3279409..3279569,3282763..3282921,3283174..3283253,
FT                   3284777..3284881,3285195..3285976)
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   transcript variant mCT169217"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT169217.0
FT                   created on 27-MAY-2002"
FT   mRNA            join(3271322..3271463,3273271..3273419,3274399..3274505,
FT                   3274628..3275062,3275402..3275683,3275831..3275939,
FT                   3276007..3276083,3276300..3276562,3277435..3277595,
FT                   3277675..3277827,3278014..3278143,3279028..3279102,
FT                   3279193..3279282,3279409..3279569,3282763..3282921,
FT                   3283174..3283253,3284777..3284881,3285195..3285976)
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   transcript variant mCT169220"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT169220.0
FT                   created on 27-MAY-2002"
FT   mRNA            join(<3271336..3271463,3273271..3273425,3274634..3275062,
FT                   3275402..3275683,3275831..3275939,3276007..3276083,
FT                   3276300..3276562,3277435..3277595,3277675..3277827,
FT                   3278014..3278143,3279028..3279102,3279193..3279282,
FT                   3279409..3279569,3282763..3282921,3283174..3283253,
FT                   3284777..3284881,3285195..3286035)
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   transcript variant mCT190707"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT190707.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(3271339..3271463,3273271..3273425,3274628..3275062,
FT                   3275402..3275683,3275831..3275939,3276007..3276083,
FT                   3276300..3276562,3277435..3277595,3277675..3277827,
FT                   3278014..3278143,3279028..3279102,3279193..3279282,
FT                   3279409..3279569,3282763..3282921,3283174..3283253,
FT                   3284777..3284881,3285195..3285976)
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   transcript variant mCT169218"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT169218.0
FT                   created on 27-MAY-2002"
FT   mRNA            join(3271339..3271463,3273271..3273425,3274634..3275062,
FT                   3275402..3275943)
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   transcript variant mCT169219"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT169219.0
FT                   created on 27-MAY-2002"
FT   CDS             join(<3274642..3275062,3275402..3275683,3275831..3275939,
FT                   3276007..3276083,3276300..3276562,3277435..3277595,
FT                   3277675..3277827,3278014..3278143,3279028..3279102,
FT                   3279193..3279282,3279409..3279569,3282763..3282921,
FT                   3283174..3283253,3284777..3284881,3285195..3285352)
FT                   /codon_start=1
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT190707.0
FT                   protein_id=mCP111658.0 isoform=CRA_b"
FT                   /protein_id="EDL13358.1"
FT                   /translation="QSKEGMDCGPPATLQPHLAGPPGTARRPVAVCQQESLSFVELPPS
FT                   RLCVDLFPIAPEELQAPGSRWSLATPAPLQGLLWPTSPGGPDTHIASTSGGMRPGRAGS
FT                   WPHCPGAQPPTLVEPWSSQHMQPQRRASHSGSEKSAWRKMQVYHNEEATGTETPTGLLE
FT                   TGQAAQEQALCALEPGPQELSGNARGGLEAPERRRFSASELMTRLHSSLRLGRSTATRV
FT                   LTSGSGAGAIREGKLPVRESRRAETRADSVSLPGPVDLNEVHGGLVEPRLDTQDKPTQD
FT                   PSSATERRQSRFLLNSVLYQEYSDVASARELRRQQREEEGPGDGAEGAEEGPGPPRANL
FT                   SPSSSFRAQRSTRGSTFSLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHS
FT                   LSVAVGHFLGSVELSECLGTQDKQWLFSKLPEVKSTSERFLHDLEQRLEADVLRFSVCD
FT                   VVLHHCPAFRRVYLPYVTNQAYQERTYQRLLLENPKFPSILARLEESPVCQRLPLTSFL
FT                   ILPFQRVTRLKMLVENILKRTAPGSQDEDMATKAFSALKELVQECNASVQSMKRTEELI
FT                   HLSKKIHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLL
FT                   LSRRKELGKFAVFVHANMAELQVRDLSLKLQGIPGHVFLLRLLHGQRARHQLLLRARTE
FT                   SEKQRWISALRPSSPQEDKEITCDGEDRPQVQCVRTYKALQPDELTLEKTDILAVKTRT
FT                   SDGWLEGVRLADGEKGWVPQAHVVEISSLSARLRNLREYKRVSNASSKLGDPPA"
FT   CDS             join(3274657..3275062,3275402..3275683,3275831..3275939,
FT                   3276007..3276083,3276300..3276562,3277435..3277595,
FT                   3277675..3277827,3278014..3278143,3279028..3279102,
FT                   3279193..3279282,3279409..3279569,3282763..3282921,
FT                   3283174..3283253,3284777..3284881,3285195..3285352)
FT                   /codon_start=1
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT125064.1
FT                   protein_id=mCP53271.1 isoform=CRA_a"
FT                   /protein_id="EDL13354.1"
FT                   /translation="MDCGPPATLQPHLAGPPGTARRPVAVCQQESLSFVELPPSRLCVD
FT                   LFPIAPEELQAPGSRWSLATPAPLQGLLWPTSPGGPDTHIASTSGGMRPGRAGSWPHCP
FT                   GAQPPTLVEPWSSQHMQPQRRASHSGSEKSAWRKMQVYHNEEATGTETPTGLLETGQAA
FT                   QEQALCALEPGPQELSGNARGGLEAPERRRFSASELMTRLHSSLRLGRSTATRVLTSGS
FT                   GAGAIREGKLPVRESRRAETRADSVSLPGPVDLNEVHGGLVEPRLDTQDKPTQDPSSAT
FT                   ERRQSRFLLNSVLYQEYSDVASARELRRQQREEEGPGDGAEGAEEGPGPPRANLSPSSS
FT                   FRAQRSTRGSTFSLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAV
FT                   GHFLGSVELSECLGTQDKQWLFSKLPEVKSTSERFLHDLEQRLEADVLRFSVCDVVLHH
FT                   CPAFRRVYLPYVTNQAYQERTYQRLLLENPKFPSILARLEESPVCQRLPLTSFLILPFQ
FT                   RVTRLKMLVENILKRTAPGSQDEDMATKAFSALKELVQECNASVQSMKRTEELIHLSKK
FT                   IHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRK
FT                   ELGKFAVFVHANMAELQVRDLSLKLQGIPGHVFLLRLLHGQRARHQLLLRARTESEKQR
FT                   WISALRPSSPQEDKEITCDGEDRPQVQCVRTYKALQPDELTLEKTDILAVKTRTSDGWL
FT                   EGVRLADGEKGWVPQAHVVEISSLSARLRNLREYKRVSNASSKLGDPPA"
FT   CDS             join(3274657..3275062,3275402..3275683,3275831..3275939,
FT                   3276007..3276083,3276300..3276562,3277435..3277595,
FT                   3277675..3277827,3278014..3278143,3279028..3279102,
FT                   3279193..3279282,3279409..3279569,3282763..3282921,
FT                   3283174..3283253,3284777..3284881,3285195..3285352)
FT                   /codon_start=1
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT169217.0
FT                   protein_id=mCP92035.0 isoform=CRA_a"
FT                   /protein_id="EDL13355.1"
FT                   /translation="MDCGPPATLQPHLAGPPGTARRPVAVCQQESLSFVELPPSRLCVD
FT                   LFPIAPEELQAPGSRWSLATPAPLQGLLWPTSPGGPDTHIASTSGGMRPGRAGSWPHCP
FT                   GAQPPTLVEPWSSQHMQPQRRASHSGSEKSAWRKMQVYHNEEATGTETPTGLLETGQAA
FT                   QEQALCALEPGPQELSGNARGGLEAPERRRFSASELMTRLHSSLRLGRSTATRVLTSGS
FT                   GAGAIREGKLPVRESRRAETRADSVSLPGPVDLNEVHGGLVEPRLDTQDKPTQDPSSAT
FT                   ERRQSRFLLNSVLYQEYSDVASARELRRQQREEEGPGDGAEGAEEGPGPPRANLSPSSS
FT                   FRAQRSTRGSTFSLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAV
FT                   GHFLGSVELSECLGTQDKQWLFSKLPEVKSTSERFLHDLEQRLEADVLRFSVCDVVLHH
FT                   CPAFRRVYLPYVTNQAYQERTYQRLLLENPKFPSILARLEESPVCQRLPLTSFLILPFQ
FT                   RVTRLKMLVENILKRTAPGSQDEDMATKAFSALKELVQECNASVQSMKRTEELIHLSKK
FT                   IHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRK
FT                   ELGKFAVFVHANMAELQVRDLSLKLQGIPGHVFLLRLLHGQRARHQLLLRARTESEKQR
FT                   WISALRPSSPQEDKEITCDGEDRPQVQCVRTYKALQPDELTLEKTDILAVKTRTSDGWL
FT                   EGVRLADGEKGWVPQAHVVEISSLSARLRNLREYKRVSNASSKLGDPPA"
FT   CDS             join(3274657..3275062,3275402..3275683,3275831..3275939,
FT                   3276007..3276083,3276300..3276562,3277435..3277595,
FT                   3277675..3277827,3278014..3278143,3279028..3279102,
FT                   3279193..3279282,3279409..3279569,3282763..3282921,
FT                   3283174..3283253,3284777..3284881,3285195..3285352)
FT                   /codon_start=1
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT169218.0
FT                   protein_id=mCP92058.0 isoform=CRA_a"
FT                   /protein_id="EDL13356.1"
FT                   /translation="MDCGPPATLQPHLAGPPGTARRPVAVCQQESLSFVELPPSRLCVD
FT                   LFPIAPEELQAPGSRWSLATPAPLQGLLWPTSPGGPDTHIASTSGGMRPGRAGSWPHCP
FT                   GAQPPTLVEPWSSQHMQPQRRASHSGSEKSAWRKMQVYHNEEATGTETPTGLLETGQAA
FT                   QEQALCALEPGPQELSGNARGGLEAPERRRFSASELMTRLHSSLRLGRSTATRVLTSGS
FT                   GAGAIREGKLPVRESRRAETRADSVSLPGPVDLNEVHGGLVEPRLDTQDKPTQDPSSAT
FT                   ERRQSRFLLNSVLYQEYSDVASARELRRQQREEEGPGDGAEGAEEGPGPPRANLSPSSS
FT                   FRAQRSTRGSTFSLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAV
FT                   GHFLGSVELSECLGTQDKQWLFSKLPEVKSTSERFLHDLEQRLEADVLRFSVCDVVLHH
FT                   CPAFRRVYLPYVTNQAYQERTYQRLLLENPKFPSILARLEESPVCQRLPLTSFLILPFQ
FT                   RVTRLKMLVENILKRTAPGSQDEDMATKAFSALKELVQECNASVQSMKRTEELIHLSKK
FT                   IHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRK
FT                   ELGKFAVFVHANMAELQVRDLSLKLQGIPGHVFLLRLLHGQRARHQLLLRARTESEKQR
FT                   WISALRPSSPQEDKEITCDGEDRPQVQCVRTYKALQPDELTLEKTDILAVKTRTSDGWL
FT                   EGVRLADGEKGWVPQAHVVEISSLSARLRNLREYKRVSNASSKLGDPPA"
FT   CDS             join(3274657..3275062,3275402..3275683,3275831..3275939,
FT                   3276007..3276083,3276300..3276562,3277435..3277595,
FT                   3277675..3277827,3278014..3278143,3279028..3279102,
FT                   3279193..3279282,3279409..3279569,3282763..3282921,
FT                   3283174..3283253,3284777..3284881,3285195..3285352)
FT                   /codon_start=1
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT169220.0
FT                   protein_id=mCP92049.0 isoform=CRA_a"
FT                   /protein_id="EDL13357.1"
FT                   /translation="MDCGPPATLQPHLAGPPGTARRPVAVCQQESLSFVELPPSRLCVD
FT                   LFPIAPEELQAPGSRWSLATPAPLQGLLWPTSPGGPDTHIASTSGGMRPGRAGSWPHCP
FT                   GAQPPTLVEPWSSQHMQPQRRASHSGSEKSAWRKMQVYHNEEATGTETPTGLLETGQAA
FT                   QEQALCALEPGPQELSGNARGGLEAPERRRFSASELMTRLHSSLRLGRSTATRVLTSGS
FT                   GAGAIREGKLPVRESRRAETRADSVSLPGPVDLNEVHGGLVEPRLDTQDKPTQDPSSAT
FT                   ERRQSRFLLNSVLYQEYSDVASARELRRQQREEEGPGDGAEGAEEGPGPPRANLSPSSS
FT                   FRAQRSTRGSTFSLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAV
FT                   GHFLGSVELSECLGTQDKQWLFSKLPEVKSTSERFLHDLEQRLEADVLRFSVCDVVLHH
FT                   CPAFRRVYLPYVTNQAYQERTYQRLLLENPKFPSILARLEESPVCQRLPLTSFLILPFQ
FT                   RVTRLKMLVENILKRTAPGSQDEDMATKAFSALKELVQECNASVQSMKRTEELIHLSKK
FT                   IHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRK
FT                   ELGKFAVFVHANMAELQVRDLSLKLQGIPGHVFLLRLLHGQRARHQLLLRARTESEKQR
FT                   WISALRPSSPQEDKEITCDGEDRPQVQCVRTYKALQPDELTLEKTDILAVKTRTSDGWL
FT                   EGVRLADGEKGWVPQAHVVEISSLSARLRNLREYKRVSNASSKLGDPPA"
FT   CDS             join(3274657..3275062,3275402..3275724)
FT                   /codon_start=1
FT                   /gene="Arhgef19"
FT                   /locus_tag="mCG_123828"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 19,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG123828.2 transcript_id=mCT169219.0
FT                   protein_id=mCP92038.0 isoform=CRA_c"
FT                   /protein_id="EDL13359.1"
FT                   /translation="MDCGPPATLQPHLAGPPGTARRPVAVCQQESLSFVELPPSRLCVD
FT                   LFPIAPEELQAPGSRWSLATPAPLQGLLWPTSPGGPDTHIASTSGGMRPGRAGSWPHCP
FT                   GAQPPTLVEPWSSQHMQPQRRASHSGSEKSAWRKMQVYHNEEATGTETPTGLLETGQAA
FT                   QEQALCALEPGPQELSGNARGGLEAPERRRFSASELMTRLHSSLRLGRSTATRVLTSGS
FT                   GAGAIREGTSYSPGSESSLN"
FT   gene            complement(3290232..3301973)
FT                   /locus_tag="mCG_147455"
FT                   /note="gene_id=mCG147455.0"
FT   mRNA            complement(join(3290232..3292073,3301854..3301973))
FT                   /locus_tag="mCG_147455"
FT                   /product="mCG147455"
FT                   /note="gene_id=mCG147455.0 transcript_id=mCT187718.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3291706..3292023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147455"
FT                   /product="mCG147455"
FT                   /note="gene_id=mCG147455.0 transcript_id=mCT187718.0
FT                   protein_id=mCP108137.0"
FT                   /protein_id="EDL13360.1"
FT                   /translation="MPLWVPSIYLPSEKSPEFRTAHNHRKCLQLAKSLPSSSTRQLIVS
FT                   CCGSFETALSHTWFVCVCVCVCVCVCVCVCVLRKPKFQTSYNKQVPAKADMSTRAFQVS
FT                   S"
FT   assembly_gap    3298789..3298808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3330854..3330873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3337164..3365470
FT                   /gene="Epha2"
FT                   /locus_tag="mCG_10037"
FT                   /note="gene_id=mCG10037.1"
FT   mRNA            join(3337164..3337337,3342417..3342484,3344307..3344982,
FT                   3352490..3352645,3353018..3353350,3354605..3354720,
FT                   3355046..3355199,3356612..3356711,3357305..3357360,
FT                   3357554..3357679,3357791..3357979,3358152..3358213,
FT                   3358292..3358501,3358675..3358824,3359502..3359695,
FT                   3360321..3360476,3364505..3365470)
FT                   /gene="Epha2"
FT                   /locus_tag="mCG_10037"
FT                   /product="Eph receptor A2"
FT                   /note="gene_id=mCG10037.1 transcript_id=mCT9988.1 created
FT                   on 27-MAY-2002"
FT   CDS             join(3337256..3337337,3342417..3342484,3344307..3344982,
FT                   3352490..3352645,3353018..3353350,3354605..3354720,
FT                   3355046..3355199,3356612..3356711,3357305..3357360,
FT                   3357554..3357679,3357791..3357979,3358152..3358213,
FT                   3358292..3358501,3358675..3358824,3359502..3359695,
FT                   3360321..3360476,3364505..3364610)
FT                   /codon_start=1
FT                   /gene="Epha2"
FT                   /locus_tag="mCG_10037"
FT                   /product="Eph receptor A2"
FT                   /note="gene_id=mCG10037.1 transcript_id=mCT9988.1
FT                   protein_id=mCP9989.2"
FT                   /db_xref="GOA:Q03145"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001090"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001426"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016257"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR027936"
FT                   /db_xref="InterPro:IPR034263"
FT                   /db_xref="MGI:MGI:95278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03145"
FT                   /protein_id="EDL13361.1"
FT                   /translation="MELRAVGFCLALLWGCALAAAAAQGKEVVLLDFAAMKGELGWLTH
FT                   PYGKGWDLMQNIMDDMPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDC
FT                   NSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLN
FT                   VEERMVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQ
FT                   PLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGF
FT                   FKSEASESPCLECPEHTLPSTEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIG
FT                   MGAKVELRWTAPKDTGGRQDIVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVT
FT                   VSDLEPHMNYTFAVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWS
FT                   IPVSQQSRVWKYEVTYRKKGDANSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQG
FT                   AGSKVHEFQTLSTEGSANMAVIGGVAVGVVLLLVLAGVGLFIHRRRRNLRARQSSEDVR
FT                   FSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVARQKVIGAGEFGEVYKGTLKA
FT                   SSGKKEIPVAIKTLKAGYTEKQRVDFLSEASIMGQFSHHNIIRLEGVVSKYKPMMIITE
FT                   YMENGALDKFLREKDGEFSVLQLVGMLRGIASGMKYLANMNYVHRDLAARNILVNSNLV
FT                   CKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSYGIVMWEVM
FT                   TYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERSRRPKFADIVSI
FT                   LDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVSEWLESIKMQQYTEHFMVAG
FT                   YTAIEKVVQMSNEDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPI"
FT   assembly_gap    3352915..3352934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3371651..3371670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3373558..3373577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3378525..3378544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3384715..3387739
FT                   /locus_tag="mCG_147459"
FT                   /note="gene_id=mCG147459.0"
FT   mRNA            join(3384715..3384763,3385069..3387739)
FT                   /locus_tag="mCG_147459"
FT                   /product="mCG147459"
FT                   /note="gene_id=mCG147459.0 transcript_id=mCT187722.0
FT                   created on 13-JAN-2004"
FT   CDS             3386598..3386939
FT                   /codon_start=1
FT                   /locus_tag="mCG_147459"
FT                   /product="mCG147459"
FT                   /note="gene_id=mCG147459.0 transcript_id=mCT187722.0
FT                   protein_id=mCP108141.0"
FT                   /protein_id="EDL13362.1"
FT                   /translation="MGTMLVPEIDEGLLHCPELLWLNTGCQVWSHADLYHHRPYYREAR
FT                   RGRLGRTCLVPPCHGLETGDPSDSPHSLGCIDQDLRVPEFWSLQSILPLNSPNIAGRGA
FT                   SLEIALASP"
FT   assembly_gap    3392789..3393548
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   gene            3405390..3421203
FT                   /locus_tag="mCG_10041"
FT                   /note="gene_id=mCG10041.2"
FT   mRNA            join(3405390..3405431,3416791..3416906,3417432..3417467,
FT                   3417715..3417808,3419440..3419622,3419842..3419952,
FT                   3420486..3421203)
FT                   /locus_tag="mCG_10041"
FT                   /product="mCG10041"
FT                   /note="gene_id=mCG10041.2 transcript_id=mCT9990.2 created
FT                   on 27-MAY-2002"
FT   CDS             join(3405410..3405431,3416791..3416906,3417432..3417467,
FT                   3417715..3417808,3419440..3419622,3419842..3419952,
FT                   3420486..3420745)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10041"
FT                   /product="mCG10041"
FT                   /note="gene_id=mCG10041.2 transcript_id=mCT9990.2
FT                   protein_id=mCP9985.2"
FT                   /db_xref="GOA:A2ADB2"
FT                   /db_xref="InterPro:IPR026782"
FT                   /db_xref="MGI:MGI:2685539"
FT                   /db_xref="UniProtKB/TrEMBL:A2ADB2"
FT                   /protein_id="EDL13363.1"
FT                   /translation="MGSCVSRDLFTSAHKNSPRPQGTDLLNRDLPSSHSPAIVPDHVAG
FT                   KDKQMDFCWDPWQRCFQTTNGYISDSRACPSNYSVAALATSSLVGVVQSIKDHITKPTA
FT                   MARGRVAHLIEWKGWSAQQSGWELSPAEDEHYCCLPDELREARFAAGVAEQFAITEATL
FT                   SAWSSLDDEELQPEDSTQGAFQLQDLESIYLQDSLLSGPSQDDSLLACSPGLTLNDGWP
FT                   SPEEPPSPTQQHHRQRLPGAQGLDDRAHLHGSLPSVDSGSLSEEEDEVFYN"
FT   assembly_gap    3421485..3423618
FT                   /estimated_length=2134
FT                   /gap_type="unknown"
FT   gene            complement(3423746..3435497)
FT                   /gene="Clcnka"
FT                   /locus_tag="mCG_10042"
FT                   /note="gene_id=mCG10042.2"
FT   mRNA            complement(join(3423746..3423835,3423968..3424056,
FT                   3424813..3424946,3425996..3426209,3426756..3426866,
FT                   3427021..3427090,3428025..3428198,3428452..3428536,
FT                   3429204..3429305,3429420..3429505,3431784..3431865,
FT                   3431947..3432024,3432369..3432508,3433287..3433415,
FT                   3434003..3434131,3434722..3434826,3435430..3435497))
FT                   /gene="Clcnka"
FT                   /locus_tag="mCG_10042"
FT                   /product="chloride channel Ka, transcript variant
FT                   mCT169565"
FT                   /note="gene_id=mCG10042.2 transcript_id=mCT169565.0 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(3423746..3423835,3423968..3424056,
FT                   3424813..3424946,3425996..3426209,3426756..3426866,
FT                   3427021..3427090,3428025..3428198,3428452..3428536,
FT                   3429204..3429305,3429420..3429505,3431784..3431865,
FT                   3431947..3432024,3432369..3432508,3433287..3433415,
FT                   3434003..3434131,3434722..3434969))
FT                   /gene="Clcnka"
FT                   /locus_tag="mCG_10042"
FT                   /product="chloride channel Ka, transcript variant mCT9991"
FT                   /note="gene_id=mCG10042.2 transcript_id=mCT9991.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(3429453..3429505,3431784..3431865,
FT                   3431947..3432024,3432369..3432508,3433287..3433415,
FT                   3434003..3434131,3434722..3434821))
FT                   /codon_start=1
FT                   /gene="Clcnka"
FT                   /locus_tag="mCG_10042"
FT                   /product="chloride channel Ka, isoform CRA_a"
FT                   /note="gene_id=mCG10042.2 transcript_id=mCT169565.0
FT                   protein_id=mCP92447.0 isoform=CRA_a"
FT                   /protein_id="EDL13364.1"
FT                   /translation="MEELVGLREGSSGKPVTLQELWGPCPRIRRGIRGGLEWLKERLFR
FT                   AREDWYFLVALGVLMALISYAMNFAIGRVVRAHKWLYREVGDGHLLRYLSWTVYPVALL
FT                   SFSSGFSQSITPFSGGSGLPELKTMLSGVVLENYLDIKNFGAKVVGLSCTLATGSTIFL
FT                   GKVGPFVHLSVMISAYLGRVRAKAVGDTESKAKEVEMLSAAAAVGVATVFAAPFSGGDH
FT                   HLHLQDQIPSGCAL"
FT   CDS             complement(join(3429453..3429505,3431784..3431865,
FT                   3431947..3432024,3432369..3432508,3433287..3433415,
FT                   3434003..3434131,3434722..3434821))
FT                   /codon_start=1
FT                   /gene="Clcnka"
FT                   /locus_tag="mCG_10042"
FT                   /product="chloride channel Ka, isoform CRA_a"
FT                   /note="gene_id=mCG10042.2 transcript_id=mCT9991.1
FT                   protein_id=mCP9987.2 isoform=CRA_a"
FT                   /protein_id="EDL13365.1"
FT                   /translation="MEELVGLREGSSGKPVTLQELWGPCPRIRRGIRGGLEWLKERLFR
FT                   AREDWYFLVALGVLMALISYAMNFAIGRVVRAHKWLYREVGDGHLLRYLSWTVYPVALL
FT                   SFSSGFSQSITPFSGGSGLPELKTMLSGVVLENYLDIKNFGAKVVGLSCTLATGSTIFL
FT                   GKVGPFVHLSVMISAYLGRVRAKAVGDTESKAKEVEMLSAAAAVGVATVFAAPFSGGDH
FT                   HLHLQDQIPSGCAL"
FT   assembly_gap    3429647..3431603
FT                   /estimated_length=1957
FT                   /gap_type="unknown"
FT   gene            3435630..3447943
FT                   /locus_tag="mCG_1050981"
FT                   /note="gene_id=mCG1050981.0"
FT   mRNA            join(3435630..3435658,3444515..3444604,3446100..3446282,
FT                   3446635..3446788,3446989..3447064,3447083..3447943)
FT                   /locus_tag="mCG_1050981"
FT                   /product="mCG1050981"
FT                   /note="gene_id=mCG1050981.0 transcript_id=mCT194770.0
FT                   created on 27-JAN-2005"
FT   gene            complement(3441127..3452776)
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /note="gene_id=mCG10040.2"
FT   mRNA            complement(join(3441127..3441612,3441824..3441907,
FT                   3442044..3442132,3443861..3443994,3444576..3444789,
FT                   3445078..3445188,3445348..3445417,3446088..3446261,
FT                   3446504..3446588,3447278..3447379,3447456..3447540,
FT                   3448145..3448270,3448352..3448430,3448505..3448582,
FT                   3448954..3449093,3450647..3450775,3451207..3451335,
FT                   3451958..3452064,3452710..3452776))
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, transcript variant
FT                   mCT169178"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169178.0 created
FT                   on 27-MAY-2002"
FT   mRNA            complement(join(3441130..3441405,3441526..3441612,
FT                   3441824..3441907,3442044..3442132,3443861..3443994,
FT                   3444576..3444789,3445078..3445188,3445348..3445417,
FT                   3446088..3446261,3446504..3446588,3447278..3447379,
FT                   3447456..3447540,3448145..3448270,3448352..3448430,
FT                   3448505..3448582,3448954..3449093,3450647..3450775,
FT                   3451207..3451335,3451958..3452064,3452710..3452743))
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, transcript variant mCT9989"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT9989.2 created
FT                   on 27-MAY-2002"
FT   mRNA            complement(join(3441131..3441405,3441526..3441612,
FT                   3442044..3442132,3443861..3443994,3444576..3444789,
FT                   3445078..3445188,3445348..3445417,3446088..3446261,
FT                   3446504..3446588,3447278..3447379,3447456..3447540,
FT                   3448145..3448270,3448352..3448430,3448505..3448582,
FT                   3448954..3449093,3450647..3450775,3451207..3451335,
FT                   3451958..3452064,3452710..3452743))
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, transcript variant
FT                   mCT169176"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169176.0 created
FT                   on 27-MAY-2002"
FT   CDS             complement(join(3441358..3441405,3441526..3441612,
FT                   3442044..3442132,3443861..3443994,3444576..3444789,
FT                   3445078..3445188,3445348..3445417,3446088..3446261,
FT                   3446504..3446588,3447278..3447379,3447456..3447540,
FT                   3448145..3448270,3448352..3448430,3448505..3448582,
FT                   3448954..3449093,3450647..3450775,3451207..3451335,
FT                   3451958..3452057))
FT                   /codon_start=1
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, isoform CRA_a"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169176.0
FT                   protein_id=mCP92072.0 isoform=CRA_a"
FT                   /protein_id="EDL13367.1"
FT                   /translation="MEELVGLREGASKKPVPLQELWGPCPRIRRNIQGGLEWLKERLFR
FT                   VGEDWYFLVALGVLMALISYAMNFTIGRVVRAHKWLYREIGDGHLLRYLSWTVYPVALL
FT                   SFSSGFSQSITPSSGGSGIPEVKTILTGVVLEDYLDIKNFGAKVVGLSCTLATGSTIFL
FT                   GKLGPFVHLSVMIAAYLGRVRTKTVGEPESKTKEMELLAAGAAVGVATVFAAPISGVLF
FT                   SIEVMSSHFSVWDYWRGFFAATCGAFMFHLLAVFNNEQETITSIYKTSFPVDIPFDLPE
FT                   IFFFVALGAICGILSCGYNYSQRTFLFFLKANGFTSKLLATSKPLYSALAAVVLASITY
FT                   PPGVGHFMASRLSMSEHLETLFDNNSWALMTKNSSPPWAAEPDPQKLWLEWCHPQLTVF
FT                   GTLVFFLVMKFWMLILATTIPIPAGYFLPIFIYGAVIGRLFGEVLSVAFPEGIVAGGRV
FT                   NPIMPGAYALAGAAAFSGAVTHTLSTALLAFEVTGQLVHALPVLMAVLAANAISQSFQP
FT                   SFYDGTIIVKKLPYLPWIRGRQIGSHSVTVGHFMNCALTTLAKDMPLEQVIQVVISTDV
FT                   TQYPLVETTESQTLVGVVKRTHLVQALQTEPASWAPGQQTHNLFELLNLQTLFVTSRGR
FT                   AVGSVSWVELKKAISTLTNPPAPK"
FT   CDS             complement(join(3441358..3441405,3441526..3441612,
FT                   3441824..3441907,3442044..3442132,3443861..3443994,
FT                   3444576..3444789,3445078..3445188,3445348..3445417,
FT                   3446088..3446261,3446504..3446588,3447278..3447379,
FT                   3447456..3447540,3448145..3448270,3448352..3448430,
FT                   3448505..3448582,3448954..3449093,3450647..3450775,
FT                   3451207..3451335,3451958..3452057))
FT                   /codon_start=1
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, isoform CRA_f"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT9989.2
FT                   protein_id=mCP9986.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q9WUB6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002250"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:1930643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUB6"
FT                   /protein_id="EDL13372.1"
FT                   /translation="MEELVGLREGASKKPVPLQELWGPCPRIRRNIQGGLEWLKERLFR
FT                   VGEDWYFLVALGVLMALISYAMNFTIGRVVRAHKWLYREIGDGHLLRYLSWTVYPVALL
FT                   SFSSGFSQSITPSSGGSGIPEVKTILTGVVLEDYLDIKNFGAKVVGLSCTLATGSTIFL
FT                   GKLGPFVHLSVMIAAYLGRVRTKTVGEPESKTKEMELLAAGAAVGVATVFAAPISGVLF
FT                   SIEVMSSHFSVWDYWRGFFAATCGAFMFHLLAVFNNEQETITSIYKTSFPVDIPFDLPE
FT                   IFFFVALGAICGILSCGYNYSQRTFLFFLKANGFTSKLLATSKPLYSALAAVVLASITY
FT                   PPGVGHFMASRLSMSEHLETLFDNNSWALMTKNSSPPWAAEPDPQKLWLEWCHPQLTVF
FT                   GTLVFFLVMKFWMLILATTIPIPAGYFLPIFIYGAVIGRLFGEVLSVAFPEGIVAGGRV
FT                   NPIMPGAYALAGAAAFSGAVTHTLSTALLAFEVTGQLVHALPVLMAVLAANAISQSFQP
FT                   SFYDGTIIVKKLPYLPWIRGRQIGSHSVTVGHFMNCALTTLAKDMPLEQVIQVVISTDV
FT                   TQYPLVETTESQTLVGVVKRTHLVQALQTEPASWAPGQQPCLQDILANGCPTQPVTLQL
FT                   SLETSLHETHNLFELLNLQTLFVTSRGRAVGSVSWVELKKAISTLTNPPAPK"
FT   CDS             complement(join(3441511..3441612,3441824..3441907,
FT                   3442044..3442132,3443861..3443994,3444576..3444789,
FT                   3445078..3445188,3445348..3445417,3446088..3446261,
FT                   3446504..3446588,3447278..3447379,3447456..3447540,
FT                   3448145..3448270,3448352..3448430,3448505..3448582,
FT                   3448954..3449093,3450647..3450775,3451207..3451335,
FT                   3451958..3452057))
FT                   /codon_start=1
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, isoform CRA_c"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169178.0
FT                   protein_id=mCP92052.0 isoform=CRA_c"
FT                   /protein_id="EDL13369.1"
FT                   /translation="MEELVGLREGASKKPVPLQELWGPCPRIRRNIQGGLEWLKERLFR
FT                   VGEDWYFLVALGVLMALISYAMNFTIGRVVRAHKWLYREIGDGHLLRYLSWTVYPVALL
FT                   SFSSGFSQSITPSSGGSGIPEVKTILTGVVLEDYLDIKNFGAKVVGLSCTLATGSTIFL
FT                   GKLGPFVHLSVMIAAYLGRVRTKTVGEPESKTKEMELLAAGAAVGVATVFAAPISGVLF
FT                   SIEVMSSHFSVWDYWRGFFAATCGAFMFHLLAVFNNEQETITSIYKTSFPVDIPFDLPE
FT                   IFFFVALGAICGILSCGYNYSQRTFLFFLKANGFTSKLLATSKPLYSALAAVVLASITY
FT                   PPGVGHFMASRLSMSEHLETLFDNNSWALMTKNSSPPWAAEPDPQKLWLEWCHPQLTVF
FT                   GTLVFFLVMKFWMLILATTIPIPAGYFLPIFIYGAVIGRLFGEVLSVAFPEGIVAGGRV
FT                   NPIMPGAYALAGAAAFSGAVTHTLSTALLAFEVTGQLVHALPVLMAVLAANAISQSFQP
FT                   SFYDGTIIVKKLPYLPWIRGRQIGSHSVTVGHFMNCALTTLAKDMPLEQVIQVVISTDV
FT                   TQYPLVETTESQTLVGVVKRTHLVQALQTEPASWAPGQQPCLQDILANGCPTQPVTLQL
FT                   SLETSLHETHNLFELLNLQTLFVTSRGRAVGSVSWVEVLGS"
FT   CDS             3447525..3447893
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050981"
FT                   /product="mCG1050981"
FT                   /note="gene_id=mCG1050981.0 transcript_id=mCT194770.0
FT                   protein_id=mCP115799.0"
FT                   /protein_id="EDL13366.1"
FT                   /translation="MEVMVSEEGRKKVGILCQPSTPRLRITRARMGVASDLTPNFPGIL
FT                   GTAVALNLRILTSLGITYQTPCVSDIYILIHNSHQVTGWGNASAVKSTDCSSRGPEFKS
FT                   QQPHGGSQPSVMGSDALF"
FT   mRNA            complement(join(3448364..3448582,3448954..3449093,
FT                   3450647..3450775,3451207..3451335,3451958..3452064,
FT                   3452710..3452743))
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, transcript variant
FT                   mCT169177"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169177.0 created
FT                   on 27-MAY-2002"
FT   CDS             complement(join(3448463..3448582,3448954..3449093,
FT                   3450647..3450775,3451207..3451335,3451958..3452057))
FT                   /codon_start=1
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, isoform CRA_b"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169177.0
FT                   protein_id=mCP92051.0 isoform=CRA_b"
FT                   /protein_id="EDL13368.1"
FT                   /translation="MEELVGLREGASKKPVPLQELWGPCPRIRRNIQGGLEWLKERLFR
FT                   VGEDWYFLVALGVLMALISYAMNFTIGRVVRAHKWLYREIGDGHLLRYLSWTVYPVALL
FT                   SFSSGFSQSITPSSGGSGIPEVKTILTGVVLEDYLDIKNFGAKVVGLSCTLATGSTIFL
FT                   GKLGPFVHLSVMIAAYLGRVRTKTVGEPEVRGTGLGLLGERV"
FT   mRNA            complement(join(3449355..3449549,3450647..3450775,
FT                   3451207..3451335,3451958..3452064,3452710..3452738))
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, transcript variant
FT                   mCT169180"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169180.0 created
FT                   on 27-MAY-2002"
FT   CDS             complement(join(3449467..3449549,3450647..3450775,
FT                   3451207..3451335,3451958..3452057))
FT                   /codon_start=1
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, isoform CRA_e"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169180.0
FT                   protein_id=mCP92042.0 isoform=CRA_e"
FT                   /protein_id="EDL13371.1"
FT                   /translation="MEELVGLREGASKKPVPLQELWGPCPRIRRNIQGGLEWLKERLFR
FT                   VGEDWYFLVALGVLMALISYAMNFTIGRVVRAHKWLYREIGDGHLLRYLSWTVYPVALL
FT                   SFSSGFSQSITPSSGDRFSLGWRDGTVVKSTHCSSRGPEFNF"
FT   mRNA            complement(join(3450994..3451335,3451958..3452064,
FT                   3452710..3452776))
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, transcript variant
FT                   mCT169179"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169179.0 created
FT                   on 27-MAY-2002"
FT   CDS             complement(join(3451115..3451335,3451958..3452057))
FT                   /codon_start=1
FT                   /gene="Clcnkb"
FT                   /locus_tag="mCG_10040"
FT                   /product="chloride channel Kb, isoform CRA_d"
FT                   /note="gene_id=mCG10040.2 transcript_id=mCT169179.0
FT                   protein_id=mCP92032.0 isoform=CRA_d"
FT                   /protein_id="EDL13370.1"
FT                   /translation="MEELVGLREGASKKPVPLQELWGPCPRIRRNIQGGLEWLKERLFR
FT                   VGEDWYFLVALGVLMALISYAMNFTIGRVVRGKASLACTRLQAMGFLYMAGISTGLLGA
FT                   VG"
FT   gene            3458486..3462075
FT                   /gene="Hspb7"
FT                   /locus_tag="mCG_10038"
FT                   /note="gene_id=mCG10038.2"
FT   mRNA            join(3458486..3458740,3459261..3459394,3460639..3462075)
FT                   /gene="Hspb7"
FT                   /locus_tag="mCG_10038"
FT                   /product="heat shock protein family, member 7
FT                   (cardiovascular)"
FT                   /note="gene_id=mCG10038.2 transcript_id=mCT9986.2 created
FT                   on 27-MAY-2002"
FT   CDS             join(3458545..3458740,3459261..3459394,3460639..3460818)
FT                   /codon_start=1
FT                   /gene="Hspb7"
FT                   /locus_tag="mCG_10038"
FT                   /product="heat shock protein family, member 7
FT                   (cardiovascular)"
FT                   /note="gene_id=mCG10038.2 transcript_id=mCT9986.2
FT                   protein_id=mCP9984.1"
FT                   /db_xref="GOA:P35385"
FT                   /db_xref="InterPro:IPR001436"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="MGI:MGI:1352494"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35385"
FT                   /protein_id="EDL13373.1"
FT                   /translation="MSHRTSSAFRAERSFRSSSSSSSSSSSSASRALPAQDPPMEKALS
FT                   MFSDDFGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTFNNHI
FT                   EVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTF
FT                   RTEIKI"
FT   gene            complement(3469434..3472879)
FT                   /locus_tag="mCG_123832"
FT                   /note="gene_id=mCG123832.0"
FT   mRNA            complement(join(3469434..3470218,3472749..3472879))
FT                   /locus_tag="mCG_123832"
FT                   /product="mCG123832"
FT                   /note="gene_id=mCG123832.0 transcript_id=mCT125071.0
FT                   created on 27-MAY-2002"
FT   CDS             complement(join(3469791..3470218,3472749..3472812))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123832"
FT                   /product="mCG123832"
FT                   /note="gene_id=mCG123832.0 transcript_id=mCT125071.0
FT                   protein_id=mCP53344.1"
FT                   /db_xref="GOA:Q3ULG3"
FT                   /db_xref="InterPro:IPR027852"
FT                   /db_xref="MGI:MGI:2685540"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ULG3"
FT                   /protein_id="EDL13374.1"
FT                   /translation="MAFSKDPRRTSLRDSSVEMSSGTQPSCAPKAMPTAHVTFLIDCAT
FT                   GKQVSLAASTAPPHASRANQGCVAPPMKTFVMFRGKTTMLGTQNISLSRGALDGAKDTL
FT                   PPYRGLGAPHSLPASLPGPQNDPKAQGSSLKPGATEKHSTREKVKHSLKALTCLCGQVE
FT                   "
FT   gene            <3481437..3505466
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /note="gene_id=mCG123808.1"
FT   mRNA            join(<3481437..3481557,3484006..3484092,3499305..3499511,
FT                   3500071..3500259,3500803..3500943,3501209..3501331,
FT                   3501773..3502238,3502325..3502625,3502885..3502972,
FT                   3503060..3503176,3503258..3503378,3503513..3503643,
FT                   3503884..3504093,3504210..3504299,3504379..3505466)
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /product="zinc finger and BTB domain containing 17,
FT                   transcript variant mCT190703"
FT                   /note="gene_id=mCG123808.1 transcript_id=mCT190703.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(3481439..3481557,3484006..3484092,3499305..3499511,
FT                   3500071..3500259,3500803..3500943,3501209..3501331,
FT                   3501773..3502014,3502096..3502238,3502325..3502625,
FT                   3502885..3502972,3503060..3503176,3503258..3503378,
FT                   3503513..3503643,3503884..3504093,3504210..3504299,
FT                   3504379..3504765)
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /product="zinc finger and BTB domain containing 17,
FT                   transcript variant mCT125042"
FT                   /note="gene_id=mCG123808.1 transcript_id=mCT125042.0
FT                   created on 27-MAY-2002"
FT   mRNA            join(<3481454..3481557,3484006..3484092,3499305..3499511,
FT                   3500071..3500259,3500803..3500943,3501209..3501331,
FT                   3501773..3502238,3502325..3502625,3502885..3502972,
FT                   3503060..3503643,3503884..3504093,3504210..3504299,
FT                   3504379..3504759)
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /product="zinc finger and BTB domain containing 17,
FT                   transcript variant mCT190704"
FT                   /note="gene_id=mCG123808.1 transcript_id=mCT190704.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3484092..3484092,3499305..3499511,3500071..3500259,
FT                   3500803..3500943,3501209..3501331,3501773..3502044)
FT                   /codon_start=1
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /product="zinc finger and BTB domain containing 17, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG123808.1 transcript_id=mCT190704.0
FT                   protein_id=mCP111657.0 isoform=CRA_c"
FT                   /protein_id="EDL13377.1"
FT                   /translation="AMDFPQHSQRVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAA
FT                   CSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVASFLQMQD
FT                   IVTACHTLKSLAEPSSTTGESADASAVEGGDKRAKDEKAAATMLSRLDQARGSSSTGPG
FT                   RELKEERGGQAESASSGAEQTEKADAPREPPPVELKPDPTSSMAAAEAEALSESSEQEM
FT                   EVEPASKGEDGQEEEGAGPATVKEEGMHLDNGEPPEENEESAGTDSGQELGMEGQNLRS
FT                   GTYGDRTESKAYGSIIHKCEVRGRGRCQP"
FT   assembly_gap    3487439..3487458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3493959..3493978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(3499307..3499511,3500071..3500259,3500803..3500943,
FT                   3501209..3501331,3501773..3502014,3502096..3502238,
FT                   3502325..3502625,3502885..3502972,3503060..3503176,
FT                   3503258..3503378,3503513..3503643,3503884..3504093,
FT                   3504210..3504299,3504379..3504662)
FT                   /codon_start=1
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /product="zinc finger and BTB domain containing 17, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG123808.1 transcript_id=mCT125042.0
FT                   protein_id=mCP53205.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q60821"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:107410"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60821"
FT                   /protein_id="EDL13378.1"
FT                   /translation="MDFPQHSQRVLEQLNQQRQLGLLCDCTFVVDGVDFKAHKAVLAAC
FT                   SEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVASFLQMQDI
FT                   VTACHTLKSLAEPSSTTGESADASAVEGGDKRAKDEKAAATMLSRLDQARGSSSTGPGR
FT                   ELKEERGGQAESASSGAEQTEKADAPREPPPVELKPDPTSSMAAAEAEALSESSEQEME
FT                   VEPASKGEDGQEEEGAGPATVKEEGMHLDNGEPPEENEESAGTDSGQELGMEGQNLRSG
FT                   TYGDRTESKAYGSIIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAAC
FT                   KAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSGEARYRCGDCGKLFTTSGNLKRH
FT                   QLVHSGQKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKI
FT                   HIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCTHCQRQFADPGALQRHVRIHTG
FT                   EKPCQCVICGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRP
FT                   HKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIK
FT                   ILEPEEGGEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAV
FT                   KQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGST
FT                   WPAGQMLQAGELVFRPRDGTEGQPTLAESPPTAPDCLPPAE"
FT   CDS             join(<3502045..3502238,3502325..3502625,3502885..3502972,
FT                   3503060..3503176,3503258..3503378,3503513..3503643,
FT                   3503884..3504093,3504210..3504299,3504379..3504662)
FT                   /codon_start=1
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /product="zinc finger and BTB domain containing 17, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG123808.1 transcript_id=mCT190703.0
FT                   protein_id=mCP111656.0 isoform=CRA_b"
FT                   /protein_id="EDL13376.1"
FT                   /translation="ASRVSAAPHAPFLLRLQDCGKEFTHTGNFKRHIRIHTGEKPFSCR
FT                   ECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSGEARYRCGDCG
FT                   KLFTTSGNLKRHQLVHSGQKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKF
FT                   NQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCTHCQRQFADP
FT                   GALQRHVRIHTGEKPCQCVICGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQL
FT                   ANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSH
FT                   VKTVHQGKAGIKILEPEEGGEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADE
FT                   TEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTD
FT                   ADFYQQYGPGSTWPAGQMLQAGELVFRPRDGTEGQPTLAESPPTAPDCLPPAE"
FT   mRNA            join(3503529..3504093,3504210..3504299,3504379..3504759)
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /product="zinc finger and BTB domain containing 17,
FT                   transcript variant mCT169216"
FT                   /note="gene_id=mCG123808.1 transcript_id=mCT169216.0
FT                   created on 27-MAY-2002"
FT   CDS             join(3504039..3504093,3504210..3504299,3504379..3504662)
FT                   /codon_start=1
FT                   /gene="Zbtb17"
FT                   /locus_tag="mCG_123808"
FT                   /product="zinc finger and BTB domain containing 17, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG123808.1 transcript_id=mCT169216.0
FT                   protein_id=mCP92034.0 isoform=CRA_a"
FT                   /protein_id="EDL13375.1"
FT                   /translation="MVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQV
FT                   QEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGSTWPA
FT                   GQMLQAGELVFRPRDGTEGQPTLAESPPTAPDCLPPAE"
FT   gene            complement(3506385..3565493)
FT                   /gene="Spen"
FT                   /locus_tag="mCG_123802"
FT                   /note="gene_id=mCG123802.0"
FT   mRNA            complement(join(3506385..3506564,3506910..3507068,
FT                   3507343..3507537,3507657..3508157,3508917..3516935,
FT                   3518292..3518360,3521271..3521371,3524163..3524276,
FT                   3526170..3526283,3526597..3526722,3528444..3528595,
FT                   3531994..3532194,3533071..3533231,3560029..3560511,
FT                   3565234..3565493))
FT                   /gene="Spen"
FT                   /locus_tag="mCG_123802"
FT                   /product="SPEN homolog, transcriptional regulator
FT                   (Drosophila), transcript variant mCT125033"
FT                   /note="gene_id=mCG123802.0 transcript_id=mCT125033.0
FT                   created on 27-MAY-2002"
FT   mRNA            complement(join(3506385..3506564,3506910..3507068,
FT                   3507343..3507537,3507657..3508157,3508917..3516935,
FT                   3521271..3521371,3524163..3524276,3526170..3526283,
FT                   3526597..3526722,3528444..3528595,3531994..3532194,
FT                   3533071..3533231,3560029..3560511,3565234..>3565433))
FT                   /gene="Spen"
FT                   /locus_tag="mCG_123802"
FT                   /product="SPEN homolog, transcriptional regulator
FT                   (Drosophila), transcript variant mCT169215"
FT                   /note="gene_id=mCG123802.0 transcript_id=mCT169215.0
FT                   created on 27-MAY-2002"
FT   CDS             complement(join(3509096..3516935,3521271..3521371,
FT                   3524163..3524276,3526170..3526283,3526597..3526722,
FT                   3528444..3528595,3531994..3532194,3533071..3533231,
FT                   3560029..3560511,3565234..3565433))
FT                   /codon_start=1
FT                   /gene="Spen"
FT                   /locus_tag="mCG_123802"
FT                   /product="SPEN homolog, transcriptional regulator
FT                   (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG123802.0 transcript_id=mCT169215.0
FT                   protein_id=mCP92033.0 isoform=CRA_b"
FT                   /protein_id="EDL13380.1"
FT                   /translation="MGDRDLRTDYNEPGTIPSAARGLDETVSIASRSREVSGFRGSAGG
FT                   PAYGPPPSLHAREGRYERRLDGASDNRERAYEHSAYGHHERGTGAFDRTRHYDQDYYRD
FT                   PRERTLQHGLYYTSRSRSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDDITREVRGR
FT                   RPERSYQHSRSRSPHSSQSRNQSPQRLASQASRPTRSPSGSGSRSRSSSSDSISSSSSS
FT                   SSNTDSSDSSSTASDDSPARSVQSAAVPAPTSQLLSSLEKDEPRKSFGIKVQNLPVRST
FT                   DTSLKDGLFHEFKKFGKVTSVQIHGASEERYGLVFFRQQEDQEKALTASKGKLFFGMQI
FT                   EVTAWVGPETESENEFRPLDERIDEFHPKATRTLFIGNLEKTTTYHDLRNIFQRFGEIV
FT                   DIDIKKVNGVPQYAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGL
FT                   SSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYSEIEDAQAAVKETKGRKIGGNKIK
FT                   VDFANRESQLAFYHCMEKSGQDMRDFYEMLTERREERRGSYEYSQERTYYENVRTPGTY
FT                   PEDSRRDYPARGREFYSEWETYQGEYYDSRYYDEPREYREYRSDPYEQDIREYSYRQRE
FT                   RERERERFESDRDHERRPIERSQSPVHLRRPQSPGVSPAHSERLPSDSERRLYRRSSER
FT                   SGSCSSVSPPRYDKLEKARLERYTKNEKADKERTFDPERVERERRIVRKEKGEKDKAER
FT                   QKRKGKAHSPSSQPSETEQENDREQSPEKPRGSTKLSRDRADKEGPAKNRLELVPCVVL
FT                   TRVKEKEGKVIEHPPPEKLKARLGRDTAKASALDQKPQAAQGEPAKSDPARGKALREKV
FT                   LPSHAEVGEKEGRTKLRKHLKAEQTPELSALDLEKLEARKRRFADSGLKIEKQKPEIKK
FT                   TSPETEDTRILLKKQPDTSRDGVLLREGESERKPVRKEILKRESKKTKLERLNSALSPK
FT                   DCQDPAAVSAGSGSRPSSDVHAGLGELTHGSVETQETQPKKAIPSKPQPKQLQLLENQG
FT                   PEKEEVRKNYCRPREEPAEHRAGQEKPHGGNAEEKLGIDIDHTQSYRKQMEQSRRKQRM
FT                   EMEIAKAEKFGSPKKDVDDYERRSLVHEVGKPPQDVTDDSPPSKKRRTDHVDFDICTKR
FT                   ERNYRSSRQISEDSERTSCSPSVRHGSFHDDDDPRGSPRLVSVKGSPKGDEKGLPYPNA
FT                   AVRDDPLKCNPYDSGKREQTADTAKIKLSVLNSEGEPSRWDPPMKQDPSRFDVSFPNSV
FT                   IKRDSLRKRSVRDLEPGEVPSDSDEDAEHRSQSPRASSFYDSPRLSFLLRDRDQKLRER
FT                   DERLASSLERNKFYSFALDKTITPDTKALLERAKSLSSSREENWSFLDWDSRFANFRNN
FT                   KDKEKVDSAPRPIPSWYMKKKKIRTDSEGKLADKKDERREEEQERQELFASRFLHSSIF
FT                   EQDSKRLQHLERKSEEPDLPPGRLYGRQASEGANSTSDSVQEPVVLFHSRFMELTRMQQ
FT                   KEKEKDQKPKEAEKQEEPETHPKTPEPAAETKEPEPKAPVSAGLPAVTVTVVTPEPASS
FT                   APEKAEEAAEAPSPAGEKPAEPAPVSEETKLVSEPASVPVEQPRQSDVPPGEDSRDSQD
FT                   SAALAPSAPQESAATDAVPCVNAEPLTPGTTVSQVESSVDPKPSSPQPLSKLTQRSEEA
FT                   EEGKVEKPDTTPSTEPDATQNAGVASEAQPPASEDVEANPPVAAKDRKTNKSKRSKTSV
FT                   QAAAASVVEKPVTRKSERIDREKLKRSSSPRGEAQKLLELKMEAEKITRTASKSSGGDT
FT                   EHPEPSLPLSRSRRRNVRSVYATMTDHESRSPAKEPVEQPRVTRKRLERELQEAVVPPT
FT                   TPRRGRPPKTRRRAEEDGEHERKEPAETPRPAEGWRSPRSQKSAAAAGPQGKRGRNEQK
FT                   VEAAAEAGAQASTREGNPKSRGEREAASEPKRDRRDPSTDKSGPDTFPVEVLERKPPEK
FT                   TYKSKRGRARSTRSAMDRAAHQRSLEMAARAAGQAADKEAGPAAASPQESESPQKGSGS
FT                   SPQLANNPADPDREAEEESASASTAPPEGTQLARQIELEQAVQNIAKLPEPSAAAASKG
FT                   TATATAASEEPAPEHGHKPAHQASETELAAAIGSIISDASGEPENFSAPPSVPPGSQTH
FT                   PREGMEPGLHEAESGILETGTATESSAPQVSALDPPEGSADTKETRGNSGDSVQEAKGS
FT                   KAEVTPPRKDKGRQKTTRRRKRNANKKVVAITETRASEAEQTQSESPAAEEATAATPEA
FT                   PQEEKQSEKPPSPPAECTFDPSKTPPAESLSQENSAAEKTPCKAPVLPALPPLSQPALM
FT                   DDGPQARFKVHSIIESDPVTPPSDSGIPPPTIPLVTIAKLPPPVIPGGVPHQSPPPKVT
FT                   EWITRQEEPRAQSTPSPALPPDTKASDMDTSSSTLRKILMDPKYVSATGVTSTSVTSAI
FT                   AEPVSAPCLQEAPAPPCDPKHPPLEGVSAAAVPNADTQASEVPVAADKEKVAPVIAPKI
FT                   TSVISRMPVSIDLENSQKITLAKPAPQTLTGLVSALTGLVNVSLVPVNALKGPVKGSVA
FT                   TLKGLVSTPAGPVNLLKGPVNVLTGPVNVLTTPVSATVGTVNAAPGPVTAACGVTATTG
FT                   TAAVTGAVTAPAAKGKQRASSNENSRFHPGSMSVIDDRPADTGSGAGLRVNTSEGVVLL
FT                   SYSGQKTEGPQRISAKISQIPPASAMDIEFQQSVSKSQVKADSITPTQSAPKGPQTPSA
FT                   FANVAAHSTLVLTAQTYNASPVISSVKTDRPSLEKPEPIHLSVSTPVTQGGTVKVLTQG
FT                   INTPPVLVHNQLVLTPSIVTTNKKLADPVTLKIETKVLQPANLGPTLTPHHPPALPSKL
FT                   PAEVNHVPSGPSTPADRTIAHLATPKPDTHSPRPTGPTPGLFPRPCHPSSTTSTALSTN
FT                   ATVMLAAGIPVPQFISSIHPEQSVIMPPHSITQTVSLGHLSQGEVRMSTPTLPSITYSI
FT                   RPETLHSPRAPLQPQQIEARAPQRVGTPQPATTGVPALATQHPPEEEVHYHLPVARAAA
FT                   PVQSEVLVMQSEYRLHPYTVPRDVRIMVHPHVTAVSEQPRATEGVVKVPPANKAPQQLV
FT                   KEAVKTSDAKAVPAPAPVPVPVPVPTLPRPLMVKPAFSRSPPAASFRGCL"
FT   CDS             complement(join(3509096..3516935,3518292..3518360,
FT                   3521271..3521371,3524163..3524276,3526170..3526283,
FT                   3526597..3526722,3528444..3528595,3531994..3532194,
FT                   3533071..3533231,3560029..3560511,3565234..3565433))
FT                   /codon_start=1
FT                   /gene="Spen"
FT                   /locus_tag="mCG_123802"
FT                   /product="SPEN homolog, transcriptional regulator
FT                   (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG123802.0 transcript_id=mCT125033.0
FT                   protein_id=mCP53279.1 isoform=CRA_a"
FT                   /protein_id="EDL13379.1"
FT                   /translation="MGDRDLRTDYNEPGTIPSAARGLDETVSIASRSREVSGFRGSAGG
FT                   PAYGPPPSLHAREGRYERRLDGASDNRERAYEHSAYGHHERGTGAFDRTRHYDQDYYRD
FT                   PRERTLQHGLYYTSRSRSPNRFDAHDPRYEPRAREQFTLPSVVHRDIYRDDITREVRGR
FT                   RPERSYQHSRSRSPHSSQSRNQSPQRLASQASRPTRSPSGSGSRSRSSSSDSISSSSSS
FT                   SSNTDSSDSSSTASDDSPARSVQSAAVPAPTSQLLSSLEKDEPRKSFGIKVQNLPVRST
FT                   DTSLKDGLFHEFKKFGKVTSVQIHGASEERYGLVFFRQQEDQEKALTASKGKLFFGMQI
FT                   EVTAWVGPETESENEFRPLDERIDEFHPKATRTLFIGNLEKTTTYHDLRNIFQRFGEIV
FT                   DIDIKKVNGVPQYAFLQYCDIASVCKAIKKMDGEYLGNNRLKLGFGKSMPTNCVWLDGL
FT                   SSNVSDQYLTRHFCRYGPVVKVVFDRLKGMALVLYSEIEDAQAAVKETKGRKIGGNKIK
FT                   VDFANRESQLAFYHCMEKSGQDMRDFYEMLTERRAGQMAQSKHEDWSADAQSPHKCREE
FT                   RRGSYEYSQERTYYENVRTPGTYPEDSRRDYPARGREFYSEWETYQGEYYDSRYYDEPR
FT                   EYREYRSDPYEQDIREYSYRQRERERERERFESDRDHERRPIERSQSPVHLRRPQSPGV
FT                   SPAHSERLPSDSERRLYRRSSERSGSCSSVSPPRYDKLEKARLERYTKNEKADKERTFD
FT                   PERVERERRIVRKEKGEKDKAERQKRKGKAHSPSSQPSETEQENDREQSPEKPRGSTKL
FT                   SRDRADKEGPAKNRLELVPCVVLTRVKEKEGKVIEHPPPEKLKARLGRDTAKASALDQK
FT                   PQAAQGEPAKSDPARGKALREKVLPSHAEVGEKEGRTKLRKHLKAEQTPELSALDLEKL
FT                   EARKRRFADSGLKIEKQKPEIKKTSPETEDTRILLKKQPDTSRDGVLLREGESERKPVR
FT                   KEILKRESKKTKLERLNSALSPKDCQDPAAVSAGSGSRPSSDVHAGLGELTHGSVETQE
FT                   TQPKKAIPSKPQPKQLQLLENQGPEKEEVRKNYCRPREEPAEHRAGQEKPHGGNAEEKL
FT                   GIDIDHTQSYRKQMEQSRRKQRMEMEIAKAEKFGSPKKDVDDYERRSLVHEVGKPPQDV
FT                   TDDSPPSKKRRTDHVDFDICTKRERNYRSSRQISEDSERTSCSPSVRHGSFHDDDDPRG
FT                   SPRLVSVKGSPKGDEKGLPYPNAAVRDDPLKCNPYDSGKREQTADTAKIKLSVLNSEGE
FT                   PSRWDPPMKQDPSRFDVSFPNSVIKRDSLRKRSVRDLEPGEVPSDSDEDAEHRSQSPRA
FT                   SSFYDSPRLSFLLRDRDQKLRERDERLASSLERNKFYSFALDKTITPDTKALLERAKSL
FT                   SSSREENWSFLDWDSRFANFRNNKDKEKVDSAPRPIPSWYMKKKKIRTDSEGKLADKKD
FT                   ERREEEQERQELFASRFLHSSIFEQDSKRLQHLERKSEEPDLPPGRLYGRQASEGANST
FT                   SDSVQEPVVLFHSRFMELTRMQQKEKEKDQKPKEAEKQEEPETHPKTPEPAAETKEPEP
FT                   KAPVSAGLPAVTVTVVTPEPASSAPEKAEEAAEAPSPAGEKPAEPAPVSEETKLVSEPA
FT                   SVPVEQPRQSDVPPGEDSRDSQDSAALAPSAPQESAATDAVPCVNAEPLTPGTTVSQVE
FT                   SSVDPKPSSPQPLSKLTQRSEEAEEGKVEKPDTTPSTEPDATQNAGVASEAQPPASEDV
FT                   EANPPVAAKDRKTNKSKRSKTSVQAAAASVVEKPVTRKSERIDREKLKRSSSPRGEAQK
FT                   LLELKMEAEKITRTASKSSGGDTEHPEPSLPLSRSRRRNVRSVYATMTDHESRSPAKEP
FT                   VEQPRVTRKRLERELQEAVVPPTTPRRGRPPKTRRRAEEDGEHERKEPAETPRPAEGWR
FT                   SPRSQKSAAAAGPQGKRGRNEQKVEAAAEAGAQASTREGNPKSRGEREAASEPKRDRRD
FT                   PSTDKSGPDTFPVEVLERKPPEKTYKSKRGRARSTRSAMDRAAHQRSLEMAARAAGQAA
FT                   DKEAGPAAASPQESESPQKGSGSSPQLANNPADPDREAEEESASASTAPPEGTQLARQI
FT                   ELEQAVQNIAKLPEPSAAAASKGTATATAASEEPAPEHGHKPAHQASETELAAAIGSII
FT                   SDASGEPENFSAPPSVPPGSQTHPREGMEPGLHEAESGILETGTATESSAPQVSALDPP
FT                   EGSADTKETRGNSGDSVQEAKGSKAEVTPPRKDKGRQKTTRRRKRNANKKVVAITETRA
FT                   SEAEQTQSESPAAEEATAATPEAPQEEKQSEKPPSPPAECTFDPSKTPPAESLSQENSA
FT                   AEKTPCKAPVLPALPPLSQPALMDDGPQARFKVHSIIESDPVTPPSDSGIPPPTIPLVT
FT                   IAKLPPPVIPGGVPHQSPPPKVTEWITRQEEPRAQSTPSPALPPDTKASDMDTSSSTLR
FT                   KILMDPKYVSATGVTSTSVTSAIAEPVSAPCLQEAPAPPCDPKHPPLEGVSAAAVPNAD
FT                   TQASEVPVAADKEKVAPVIAPKITSVISRMPVSIDLENSQKITLAKPAPQTLTGLVSAL
FT                   TGLVNVSLVPVNALKGPVKGSVATLKGLVSTPAGPVNLLKGPVNVLTGPVNVLTTPVSA
FT                   TVGTVNAAPGPVTAACGVTATTGTAAVTGAVTAPAAKGKQRASSNENSRFHPGSMSVID
FT                   DRPADTGSGAGLRVNTSEGVVLLSYSGQKTEGPQRISAKISQIPPASAMDIEFQQSVSK
FT                   SQVKADSITPTQSAPKGPQTPSAFANVAAHSTLVLTAQTYNASPVISSVKTDRPSLEKP
FT                   EPIHLSVSTPVTQGGTVKVLTQGINTPPVLVHNQLVLTPSIVTTNKKLADPVTLKIETK
FT                   VLQPANLGPTLTPHHPPALPSKLPAEVNHVPSGPSTPADRTIAHLATPKPDTHSPRPTG
FT                   PTPGLFPRPCHPSSTTSTALSTNATVMLAAGIPVPQFISSIHPEQSVIMPPHSITQTVS
FT                   LGHLSQGEVRMSTPTLPSITYSIRPETLHSPRAPLQPQQIEARAPQRVGTPQPATTGVP
FT                   ALATQHPPEEEVHYHLPVARAAAPVQSEVLVMQSEYRLHPYTVPRDVRIMVHPHVTAVS
FT                   EQPRATEGVVKVPPANKAPQQLVKEAVKTSDAKAVPAPAPVPVPVPVPTLPRPLMVKPA
FT                   FSRSPPAASFRGCL"
FT   assembly_gap    3522869..3522888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3532740..3532996
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    3549013..3552826
FT                   /estimated_length=3814
FT                   /gap_type="unknown"
FT   assembly_gap    3574624..3574643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3619122..3649096)
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /note="gene_id=mCG20002.2"
FT   mRNA            complement(join(3619122..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638535,3638951..3639004,
FT                   3648976..3649096))
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, transcript variant
FT                   mCT169593"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169593.0 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(3619122..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638535,3638951..3639004,
FT                   3644622..3644764,3645038..3645145,3648976..3649035))
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, transcript variant
FT                   mCT18493"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT18493.2 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(3619122..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638535,3638951..3639004,
FT                   3642904..3642941))
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, transcript variant
FT                   mCT169589"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169589.0 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(3619122..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638535,3638951..3639004,
FT                   3642778..3642891))
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, transcript variant
FT                   mCT169590"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169590.0 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(3619122..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638535,3638951..3639004,
FT                   3641546..3641572))
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, transcript variant
FT                   mCT169592"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169592.0 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(3619122..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638535,3638951..3639004,
FT                   3641139..3641281))
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, transcript variant
FT                   mCT169591"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169591.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(3620892..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638526))
FT                   /codon_start=1
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169589.0
FT                   protein_id=mCP92464.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q71FD7"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="MGI:MGI:1921452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q71FD7"
FT                   /protein_id="EDL13381.1"
FT                   /translation="MASKPEKRVASSVFITLAPPRRDVAVSEEVGQAACEARRARPWEM
FT                   LPTKTPGAAVGRSPKTWTPSGKTNASLSGVTPQLSNGGCSLPPPSLNEEDLDLPPPPPP
FT                   PSAYLPLPEEEPPVLPGKSLISDLEQLHLPPPPPPPPPQAPSKGSSVHPPPGHAIPSEE
FT                   ELPPPPEEPVTLPEREVSTDVCGFCHKPVSPRELAVEAMKRQYHAQCFTCRTCRRQLAG
FT                   QRFYQKDGRPLCEPCYQDTLEKCGKCGEVVQEHVIRALGKAFHPPCFTCVTCARCISDE
FT                   SFALDSQNQVYCVADFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDC
FT                   SVLLSVEPTDQGCYPLNDHLFCKPCHLKRSAAGCC"
FT   CDS             complement(join(3620892..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638526))
FT                   /codon_start=1
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169590.0
FT                   protein_id=mCP92450.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q71FD7"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="MGI:MGI:1921452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q71FD7"
FT                   /protein_id="EDL13382.1"
FT                   /translation="MASKPEKRVASSVFITLAPPRRDVAVSEEVGQAACEARRARPWEM
FT                   LPTKTPGAAVGRSPKTWTPSGKTNASLSGVTPQLSNGGCSLPPPSLNEEDLDLPPPPPP
FT                   PSAYLPLPEEEPPVLPGKSLISDLEQLHLPPPPPPPPPQAPSKGSSVHPPPGHAIPSEE
FT                   ELPPPPEEPVTLPEREVSTDVCGFCHKPVSPRELAVEAMKRQYHAQCFTCRTCRRQLAG
FT                   QRFYQKDGRPLCEPCYQDTLEKCGKCGEVVQEHVIRALGKAFHPPCFTCVTCARCISDE
FT                   SFALDSQNQVYCVADFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDC
FT                   SVLLSVEPTDQGCYPLNDHLFCKPCHLKRSAAGCC"
FT   CDS             complement(join(3620892..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638526))
FT                   /codon_start=1
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169591.0
FT                   protein_id=mCP92451.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q71FD7"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="MGI:MGI:1921452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q71FD7"
FT                   /protein_id="EDL13383.1"
FT                   /translation="MASKPEKRVASSVFITLAPPRRDVAVSEEVGQAACEARRARPWEM
FT                   LPTKTPGAAVGRSPKTWTPSGKTNASLSGVTPQLSNGGCSLPPPSLNEEDLDLPPPPPP
FT                   PSAYLPLPEEEPPVLPGKSLISDLEQLHLPPPPPPPPPQAPSKGSSVHPPPGHAIPSEE
FT                   ELPPPPEEPVTLPEREVSTDVCGFCHKPVSPRELAVEAMKRQYHAQCFTCRTCRRQLAG
FT                   QRFYQKDGRPLCEPCYQDTLEKCGKCGEVVQEHVIRALGKAFHPPCFTCVTCARCISDE
FT                   SFALDSQNQVYCVADFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDC
FT                   SVLLSVEPTDQGCYPLNDHLFCKPCHLKRSAAGCC"
FT   CDS             complement(join(3620892..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638526))
FT                   /codon_start=1
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169592.0
FT                   protein_id=mCP92459.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q71FD7"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="MGI:MGI:1921452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q71FD7"
FT                   /protein_id="EDL13384.1"
FT                   /translation="MASKPEKRVASSVFITLAPPRRDVAVSEEVGQAACEARRARPWEM
FT                   LPTKTPGAAVGRSPKTWTPSGKTNASLSGVTPQLSNGGCSLPPPSLNEEDLDLPPPPPP
FT                   PSAYLPLPEEEPPVLPGKSLISDLEQLHLPPPPPPPPPQAPSKGSSVHPPPGHAIPSEE
FT                   ELPPPPEEPVTLPEREVSTDVCGFCHKPVSPRELAVEAMKRQYHAQCFTCRTCRRQLAG
FT                   QRFYQKDGRPLCEPCYQDTLEKCGKCGEVVQEHVIRALGKAFHPPCFTCVTCARCISDE
FT                   SFALDSQNQVYCVADFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDC
FT                   SVLLSVEPTDQGCYPLNDHLFCKPCHLKRSAAGCC"
FT   CDS             complement(join(3620892..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638526))
FT                   /codon_start=1
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT18493.2
FT                   protein_id=mCP14207.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q71FD7"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="MGI:MGI:1921452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q71FD7"
FT                   /protein_id="EDL13385.1"
FT                   /translation="MASKPEKRVASSVFITLAPPRRDVAVSEEVGQAACEARRARPWEM
FT                   LPTKTPGAAVGRSPKTWTPSGKTNASLSGVTPQLSNGGCSLPPPSLNEEDLDLPPPPPP
FT                   PSAYLPLPEEEPPVLPGKSLISDLEQLHLPPPPPPPPPQAPSKGSSVHPPPGHAIPSEE
FT                   ELPPPPEEPVTLPEREVSTDVCGFCHKPVSPRELAVEAMKRQYHAQCFTCRTCRRQLAG
FT                   QRFYQKDGRPLCEPCYQDTLEKCGKCGEVVQEHVIRALGKAFHPPCFTCVTCARCISDE
FT                   SFALDSQNQVYCVADFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDC
FT                   SVLLSVEPTDQGCYPLNDHLFCKPCHLKRSAAGCC"
FT   CDS             complement(join(3620892..3621005,3624045..3624162,
FT                   3626110..3626288,3627752..3627921,3632354..3632471,
FT                   3633000..3633181,3638280..3638526))
FT                   /codon_start=1
FT                   /gene="Fblim1"
FT                   /locus_tag="mCG_20002"
FT                   /product="filamin binding LIM protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG20002.2 transcript_id=mCT169593.0
FT                   protein_id=mCP92461.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q71FD7"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="MGI:MGI:1921452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q71FD7"
FT                   /protein_id="EDL13386.1"
FT                   /translation="MASKPEKRVASSVFITLAPPRRDVAVSEEVGQAACEARRARPWEM
FT                   LPTKTPGAAVGRSPKTWTPSGKTNASLSGVTPQLSNGGCSLPPPSLNEEDLDLPPPPPP
FT                   PSAYLPLPEEEPPVLPGKSLISDLEQLHLPPPPPPPPPQAPSKGSSVHPPPGHAIPSEE
FT                   ELPPPPEEPVTLPEREVSTDVCGFCHKPVSPRELAVEAMKRQYHAQCFTCRTCRRQLAG
FT                   QRFYQKDGRPLCEPCYQDTLEKCGKCGEVVQEHVIRALGKAFHPPCFTCVTCARCISDE
FT                   SFALDSQNQVYCVADFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDC
FT                   SVLLSVEPTDQGCYPLNDHLFCKPCHLKRSAAGCC"
FT   gene            complement(3657332..3661334)
FT                   /gene="BC025833"
FT                   /locus_tag="mCG_19987"
FT                   /note="gene_id=mCG19987.2"
FT   mRNA            complement(join(3657332..3657803,3658042..3658232,
FT                   3659301..3659718,3660392..3660566,3660737..3660809,
FT                   3660996..3661334))
FT                   /gene="BC025833"
FT                   /locus_tag="mCG_19987"
FT                   /product="cDNA sequence BC025833, transcript variant
FT                   mCT169579"
FT                   /note="gene_id=mCG19987.2 transcript_id=mCT169579.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(3657678..3657803,3658042..3658232,
FT                   3659301..3659718,3660392..3660566,3660737..3660809,
FT                   3660996..3661083))
FT                   /codon_start=1
FT                   /gene="BC025833"
FT                   /locus_tag="mCG_19987"
FT                   /product="cDNA sequence BC025833, isoform CRA_a"
FT                   /note="gene_id=mCG19987.2 transcript_id=mCT169579.0
FT                   protein_id=mCP92457.0 isoform=CRA_a"
FT                   /protein_id="EDL13387.1"
FT                   /translation="MFSLPSLSSWLPSLPSFEWGSSLFDSLLQGLIGALGVSVLNSLLK
FT                   VYFFVACVNDPQRQPQKQRLSAQWASLEMLHLAGLTLFLTLIGSRVAALVVLEFSLRAV
FT                   STLLSLGKGSGNKERLQLFLVCQFSLGCGLSCGLSFLQEGAPHRSLNLLLSLGLAVLLA
FT                   LGARRLTRHICSLYELHSSQRYCGVCLGLLASQHGMPRLLSRTLTVAFAVSDLAAVALI
FT                   NKDFLSSSEAVRFWTPLTICYTLLVIYMQEEQWQHRFSLQGQVQTVLVRMGGLFLLLMT
FT                   VGRWLDLLSIFFSLLGELWCLAGIRALIDLCQIQGFPPQRPTVTAAVTAEGESGWTDPC
FT                   EPRPSTPAPARSAVPS"
FT   mRNA            complement(join(3658706..3659718,3660392..3660566,
FT                   3660737..3660809,3660996..3661334))
FT                   /gene="BC025833"
FT                   /locus_tag="mCG_19987"
FT                   /product="cDNA sequence BC025833, transcript variant
FT                   mCT18148"
FT                   /note="gene_id=mCG19987.2 transcript_id=mCT18148.1 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(3659218..3659718,3660392..3660566,
FT                   3660737..3660809,3660996..3661083))
FT                   /codon_start=1
FT                   /gene="BC025833"
FT                   /locus_tag="mCG_19987"
FT                   /product="cDNA sequence BC025833, isoform CRA_b"
FT                   /note="gene_id=mCG19987.2 transcript_id=mCT18148.1
FT                   protein_id=mCP14220.1 isoform=CRA_b"
FT                   /protein_id="EDL13388.1"
FT                   /translation="MFSLPSLSSWLPSLPSFEWGSSLFDSLLQGLIGALGVSVLNSLLK
FT                   VYFFVACVNDPQRQPQKQRLSAQWASLEMLHLAGLTLFLTLIGSRVAALVVLEFSLRAV
FT                   STLLSLGKGSGNKERLQLFLVCQFSLGCGLSCGLSFLQEGAPHRSLNLLLSLGLAVLLA
FT                   LGARRLTRHICSLYELHSSQRYCGVCLGLLASQHGMPRLLSRTLTVAFAVSDLAAVALI
FT                   NKDFLSSSEAVRFWTPLTICYTLLVIYMQGESPRTGVPSIAHTPLVIPAIQSGDRT"
FT   assembly_gap    3662278..3662297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3662419..3667392)
FT                   /locus_tag="mCG_20001"
FT                   /note="gene_id=mCG20001.2"
FT   mRNA            complement(join(3662419..3663698,3665028..3665162,
FT                   3665854..3666006,3666092..3666157,3666927..3667392))
FT                   /locus_tag="mCG_20001"
FT                   /product="mCG20001"
FT                   /note="gene_id=mCG20001.2 transcript_id=mCT18162.2 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(3663516..3663698,3665028..3665162,
FT                   3665854..3666006,3666092..3666157,3666927..3667346))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20001"
FT                   /product="mCG20001"
FT                   /note="gene_id=mCG20001.2 transcript_id=mCT18162.2
FT                   protein_id=mCP14229.2"
FT                   /protein_id="EDL13389.1"
FT                   /translation="MKPTQAQMAPAMDSREMVSPAVDLVLGASACCLACVFTNPLEVVK
FT                   TRLQLQGELQAPGTYPRPYRGFVSSVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYC
FT                   YSLACQAGLTQQPGGTVVAGAAAGALGAFVGSPAYLVKTQLQAQTVATMAVGHQHQHQG
FT                   VLSALETIWRQQGMLGLWRGVGGAVPRVTVGSAAQLATFTSAKAWVQDRQWFLEDSWLV
FT                   TLAGGMISSIAVVAVMTPLDVVSTRLYNQPVDRAGRGQLYGGLADCLVKTCQQEGPLAL
FT                   YKGLGPAYLRLGPHTILSMFFWDELRKLVARAQHQGT"
FT   assembly_gap    3663932..3664614
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   gene            complement(3669384..>3708696)
FT                   /locus_tag="mCG_19999"
FT                   /note="gene_id=mCG19999.2"
FT   mRNA            complement(join(3669384..3670357,3671401..3671517,
FT                   3671599..3671778,3671931..3672090,3672731..3672796,
FT                   3673100..3673290,3673560..3673692,3674222..3674310,
FT                   3674642..3674706,3674940..3675030,3675160..3675229,
FT                   3675363..3676225,3677902..3678127,3681074..3681133,
FT                   3683325..3683511,3685066..3685153,3685644..3685743,
FT                   3686055..3686164,3686299..3686405,3708580..>3708696))
FT                   /locus_tag="mCG_19999"
FT                   /product="mCG19999, transcript variant mCT18492"
FT                   /note="gene_id=mCG19999.2 transcript_id=mCT18492.2 created
FT                   on 04-SEP-2002"
FT   mRNA            complement(join(3669384..3670357,3671401..3671517,
FT                   3671599..3671778,3671931..3672090,3672731..3672796,
FT                   3673100..3673290,3673560..3673692,3674222..3674310,
FT                   3674642..3674706,3674940..3675030,3675160..3675229,
FT                   3675363..3675606,3675675..3676225,3677902..3678127,
FT                   3683325..3683511,3685066..3685153,3685644..3685831))
FT                   /locus_tag="mCG_19999"
FT                   /product="mCG19999, transcript variant mCT169586"
FT                   /note="gene_id=mCG19999.2 transcript_id=mCT169586.0 created
FT                   on 04-SEP-2002"
FT   CDS             complement(join(3670220..3670357,3671401..3671517,
FT                   3671599..3671778,3671931..3672090,3672731..3672796,
FT                   3673100..3673290,3673560..3673692,3674222..3674310,
FT                   3674642..3674706,3674940..3675030,3675160..3675229,
FT                   3675363..3675606,3675675..3676225,3677902..3678127,
FT                   3683325..3683481))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19999"
FT                   /product="mCG19999, isoform CRA_a"
FT                   /note="gene_id=mCG19999.2 transcript_id=mCT169586.0
FT                   protein_id=mCP92445.0 isoform=CRA_a"
FT                   /protein_id="EDL13390.1"
FT                   /translation="MPDYYKPQYLLDFEDRLPSSVHGSDSLSLNSFNSVTSTNLEWDDS
FT                   AIAPSSEDGDLTDTISGPRSTASDLTSSKTSTKSPTQRHNPFNEEQAETASSDTTPVHT
FT                   TSQEKEEAQAPDQPDACTELEVIRVTKKKKIGKKKKTKLDEDASPLHPTSSQQKCGQQG
FT                   EGDGLVGTPGLARDPSDTVLASPQEQGEGLSSTAGSSELSELSQMGLLIPEMKDTSMEC
FT                   LGQPLSKVIDKLHGQLDPSTWCSHADPPEQSFRAGSPGEAPEKPPFCDFSEGLPAPMDF
FT                   YRFTVESPSTVAPGGGHHDPPGPSQPLHVPAPRRPARRGDSGARAQEPDSQLPLVSQEP
FT                   VPEPVSQPEPGTHEALCKLKRDQPSPCLSSAEDSGVEEGQGSPSEMTHPSEFRVDNNHL
FT                   LLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGATEKPYLVEEA
FT                   VSYNELDYVSVGLDQQTVKLVCTNRRKQFLLDTADVALAELFLASLKSAMIKGCREPPY
FT                   PSILTDATMEKLALAKFVAQESKCEASAVTVHFYGLVHWEDPMEEALGPVPCQCSPAEG
FT                   TITKEGMLHYKASTSYLGKEHWKACFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGC
FT                   RRSNTTDRPHAFQVILADRPCLELSADSEAEMADWMQHLCQAVSKGVIPQGIAPSPCIP
FT                   CCLVITEDRLFTCHEDCQTSFFRSLGTARLADITAISTELGKEYCVLEFSQDSPQLLQP
FT                   WVIYLSCTSELDRFLTALSSGWKAIYQVDLPHKAIHEASIKQKFEDALSLIHSAWQRSD
FT                   SLCRGRASRDPWC"
FT   CDS             complement(join(3675436..3676225,3677902..3678127,
FT                   3681074..3681133,3683325..3683511,3685066..3685153,
FT                   3685644..3685743,3686055..3686164,3686299..3686405,
FT                   3708580..>3708696))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19999"
FT                   /product="mCG19999, isoform CRA_b"
FT                   /note="gene_id=mCG19999.2 transcript_id=mCT18492.2
FT                   protein_id=mCP14227.2 isoform=CRA_b"
FT                   /protein_id="EDL13391.1"
FT                   /translation="LENGELECWRGWRAELWHQGNVGCWSGSRRSKPRNPGVCLQSYFA
FT                   ACEDETPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIRQIEVLQH
FT                   VATNLGRSRAWLYLALNENSLESYLRLFQENLGLLQKYYVRNALVCSHDHLTLFLTLVS
FT                   GLEFIRFDLDLDAPYLDLAPYMPDYYKPQYLLDFEDRLPSSVHGSDSLSLNSFNSVTST
FT                   NLEWDDSAIAPSSEDYDFGDVFPAVPSVPSTDWEDGDLTDTISGPRSTASDLTSSKTST
FT                   KSPTQRHNPFNEEQAETASSDTTPVHTTSQEKEEAQAPDQPDACTELEVIRVTKKKKIG
FT                   KKKKTKLDEDASPLHPTSSQQKCGQQGEGDGLVGTPGLARDPSDTVLASPQEQGEGLSS
FT                   TAGSSELSELSQMGLLIPEMKDTSMECLGQPLSKVIDKLHGQLDPSTWCSHADPPEQSF
FT                   RAGSPGEAPEKPPFCDFSEGLPAPMDFYRFTVESPSTVAPGGGHHDPPGPSQPLHVPGS
FT                   PAAALQEEEEGGGRGEGQTSQPLEDRQGEEIQEPELRNRTASCHWSARSPCPNLCPSLN
FT                   LEPTRLFASSSETSPVLV"
FT   assembly_gap    3686673..3686692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3707614..3707775
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            complement(3721393..3722298)
FT                   /locus_tag="mCG_147457"
FT                   /note="gene_id=mCG147457.0"
FT   mRNA            complement(join(3721393..3721795,3721845..3722298))
FT                   /locus_tag="mCG_147457"
FT                   /product="mCG147457"
FT                   /note="gene_id=mCG147457.0 transcript_id=mCT187720.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(3721645..3721795,3721845..3721951))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147457"
FT                   /product="mCG147457"
FT                   /note="gene_id=mCG147457.0 transcript_id=mCT187720.0
FT                   protein_id=mCP108139.0"
FT                   /protein_id="EDL13392.1"
FT                   /translation="MHLAWETNSAFVSRSLHGKQGPMASMPPPPKSFSPHLFGFLQLPE
FT                   CHEVFLAWTLLHLLRSGLVSKTCLPVALPATVRCFESLGD"
FT   gene            complement(3727406..3729567)
FT                   /gene="Rsc1a1"
FT                   /locus_tag="mCG_19994"
FT                   /note="gene_id=mCG19994.1"
FT   mRNA            complement(3727406..3729567)
FT                   /gene="Rsc1a1"
FT                   /locus_tag="mCG_19994"
FT                   /product="regulatory solute carrier protein, family 1,
FT                   member 1"
FT                   /note="gene_id=mCG19994.1 transcript_id=mCT18156.1 created
FT                   on 28-MAY-2002"
FT   CDS             complement(3727692..3729440)
FT                   /codon_start=1
FT                   /gene="Rsc1a1"
FT                   /locus_tag="mCG_19994"
FT                   /product="regulatory solute carrier protein, family 1,
FT                   member 1"
FT                   /note="gene_id=mCG19994.1 transcript_id=mCT18156.1
FT                   protein_id=mCP14223.0"
FT                   /db_xref="GOA:Q9ER99"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="MGI:MGI:3526447"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ER99"
FT                   /protein_id="EDL13393.1"
FT                   /translation="MSSLPTSDGFDHPAPSGQSPEVGSPTSLARSVSASVCAIKPGDPN
FT                   SIESLAMEATKASAEFQTNSKKTDPPPLQVLPDLASSAEQSLAMPFHKSSKEAVVAGNL
FT                   EKSVEKGTQGLRVYLHTRQDASLTLTTTGMREPQIFAEEKSWHPENQTPSPVNGLQQHR
FT                   ETGSVQREAGQQSVPQDQGCLCDAEDLELHEEVVSLEALRKGELQRHAHLPSAEKGLPA
FT                   SGLCSCPCSEALMEVDTAEQSLVAMCSSTGRQDAVIKSPSVAHLASDNPTMEVETLQSN
FT                   PSCEPVEHSILTRELQLPEDNVDMSTMDNKDDNSSSLLSGHGQPSVESAEEFCSSVTVA
FT                   LKELHELLVISCKPASEESPEHVTCQSEIGAESQPSVSDLSGRRVQSVHLTPSDQYSQG
FT                   SCHQATSESGKTEIVGTAPCAAVEDEASTSFEGLGDGLSPDREDVRRSTESARKSCSVA
FT                   ITSAKLSEQLPCTSGVEIAPELAASEGAHSQPSEHVHNPGPDRPETSSVCPGAGLPRSG
FT                   LDQPPTQSLSTPSVLPPFIFPAADVDRILGAGFTLQEALGALHRVGGNADLALLVLLAK
FT                   NIVVPT"
FT   assembly_gap    3761281..3761342
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    3762441..3762579
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    3770281..3770361
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    3780929..3781016
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    3783556..3783590
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    3787484..3789753
FT                   /estimated_length=2270
FT                   /gap_type="unknown"
FT   gene            3791143..3804484
FT                   /locus_tag="mCG_19993"
FT                   /note="gene_id=mCG19993.1"
FT   mRNA            join(3791143..3791574,3794050..3794252,3800045..3800093,
FT                   3801019..3801214,3802608..3802787,3803561..3803645,
FT                   3804220..3804484)
FT                   /locus_tag="mCG_19993"
FT                   /product="mCG19993, transcript variant mCT18155"
FT                   /note="gene_id=mCG19993.1 transcript_id=mCT18155.1 created
FT                   on 28-MAY-2002"
FT   mRNA            join(3791267..3791574,3794050..3794252,3800045..3800093,
FT                   3801019..3801132,3803580..3803645,3804220..3804483)
FT                   /locus_tag="mCG_19993"
FT                   /product="mCG19993, transcript variant mCT169585"
FT                   /note="gene_id=mCG19993.1 transcript_id=mCT169585.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(3791285..3791574,3794050..3794252,3800045..3800093,
FT                   3801019..3801214,3802608..3802787,3803561..3803645,
FT                   3804220..3804293)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19993"
FT                   /product="mCG19993, isoform CRA_a"
FT                   /note="gene_id=mCG19993.1 transcript_id=mCT18155.1
FT                   protein_id=mCP14222.2 isoform=CRA_a"
FT                   /protein_id="EDL13394.1"
FT                   /translation="MLRLLRSSWARGLGSGVATWRPSAGLFRPGCPGIRQASGASDTPH
FT                   HQSPSSESPVQPVGVGVCSMMRLPLQSSPEGLDAAFIGVPLDTGTSNRPGARFGPCRIR
FT                   EESLMLGAVNPSTGALPFQSLRVADLGNVNVNLYNLQDSCLLIREAYQNVLAAGCIPLT
FT                   LGGDQTITYPILQAVAKEHGPVGLVHVGAHTNTTDKPREEKVYHRTPFRRSVDEGLLDS
FT                   KRVVQIGIRGSSRTLDPYRYSRSQGFRVVLAEDCWMKSLVPLMAEVRQQMGGKPLYISF
FT                   AIDALDPAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALL
FT                   AANLLFEMLCALPKVTTV"
FT   CDS             join(3791285..3791574,3794050..3794252,3800045..3800093,
FT                   3801019..3801132,3803580..3803637)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19993"
FT                   /product="mCG19993, isoform CRA_b"
FT                   /note="gene_id=mCG19993.1 transcript_id=mCT169585.0
FT                   protein_id=mCP92470.0 isoform=CRA_b"
FT                   /protein_id="EDL13395.1"
FT                   /translation="MLRLLRSSWARGLGSGVATWRPSAGLFRPGCPGIRQASGASDTPH
FT                   HQSPSSESPVQPVGVGVCSMMRLPLQSSPEGLDAAFIGVPLDTGTSNRPGARFGPCRIR
FT                   EESLMLGAVNPSTGALPFQSLRVADLGNVNVNLYNLQDSCLLIREAYQNVLAAGCIPLT
FT                   LGGDQTITYPILQAVAKEHGPVGLVHVGAHTNTTDKPREEKVYHRTPFRRSVDEGLLPR
FT                   PECGGLRSCGSLPAV"
FT   assembly_gap    3794754..3795975
FT                   /estimated_length=1222
FT                   /gap_type="unknown"
FT   assembly_gap    3797728..3797853
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            complement(3808358..3836301)
FT                   /gene="Dnajc16"
FT                   /locus_tag="mCG_19985"
FT                   /note="gene_id=mCG19985.2"
FT   mRNA            complement(join(3808358..3809116,3809808..3809978,
FT                   3811725..3811823,3811903..3811983,3812949..3813025,
FT                   3813132..3813314,3815094..3815277,3816148..3816278,
FT                   3819746..3819904,3820611..3820715,3822140..3822324,
FT                   3828142..3828475,3830057..3830123,3834258..3834442,
FT                   3836131..3836301))
FT                   /gene="Dnajc16"
FT                   /locus_tag="mCG_19985"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 16,
FT                   transcript variant mCT18146"
FT                   /note="gene_id=mCG19985.2 transcript_id=mCT18146.2 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(3808358..3809116,3809808..3809978,
FT                   3811725..3811823,3811903..3811983,3812949..3813025,
FT                   3813132..3813314,3815094..3815277,3816148..3816278,
FT                   3819746..3819904,3820611..3820715,3822140..3822324,
FT                   3828142..3828475,3830057..3830123,3834258..3834442,
FT                   3835960..3836014))
FT                   /gene="Dnajc16"
FT                   /locus_tag="mCG_19985"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 16,
FT                   transcript variant mCT169577"
FT                   /note="gene_id=mCG19985.2 transcript_id=mCT169577.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(3808741..3809116,3809808..3809978,
FT                   3811725..3811823,3811903..3811983,3812949..3813025,
FT                   3813132..3813314,3815094..3815277,3816148..3816278,
FT                   3819746..3819904,3820611..3820715,3822140..3822324,
FT                   3828142..3828475,3830057..3830123,3834258..3834424))
FT                   /codon_start=1
FT                   /gene="Dnajc16"
FT                   /locus_tag="mCG_19985"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 16,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19985.2 transcript_id=mCT169577.0
FT                   protein_id=mCP92446.0 isoform=CRA_a"
FT                   /protein_id="EDL13396.1"
FT                   /translation="MELKRLGVSWRFLMVLVLILQSLSALDFDPYRVLGVSRTASQADI
FT                   KKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNYDHYGDAGENQGYQKQ
FT                   QREHRFRHFHENFYFDESFFHFPFNAERRDSGDEKYLLHFSHYVNEVLPESFKRPYLIK
FT                   ITSDWCFSCIHIEPVWKEVVQELEGLGVGIGVVHAGYERRLAHHLGAHSTPSILGVISG
FT                   KITFFHNAVVHENLRQFVESLLPGNLVEKVTNKNYVRFLSGWQQENKPHALLFGQTPAV
FT                   PLMYKLTAFAYKDYVSFGYVYVGLRGVEEMTRQYNVNLYTPTMLIFKEHINKPADVIQA
FT                   RGLKKQVIEDFIAQNKYLLASRLTSQRLFHELCPVKRSHRQRKYCVVLLTAETNKVSKP
FT                   FEAFLSFALANTQDTVRFVHVYSNRQQEFASTLLPDMEAFQGKSGVSILERRNTAGRVV
FT                   FKTLEDPWTGSESDKFVLLGYLDQLRKDPAFLSSEAVLPDLTDELAPVFFLRWLYSVSD
FT                   YLSDFWESLLHSNWREMMPLLSLIFSALFILFGTVMVQAFSDSNEERESHPADKEEVPE
FT                   KAGKTEPSFTKESSSKIPKKGFVEVTELTDVTYTSNLVRLRPGHMNVVLILSNSTKTSL
FT                   LQKFALEVYTFTGSSSLHFSFLTLDKHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTG
FT                   YVLALNGHKKYFCLFKPLKTVDEETVASCDPDSSRGKPSCGLGPKPLKGKLSKLSLWME
FT                   RLLEGSLQRFYIPSWPELD"
FT   CDS             complement(join(3808741..3809116,3809808..3809978,
FT                   3811725..3811823,3811903..3811983,3812949..3813025,
FT                   3813132..3813314,3815094..3815277,3816148..3816278,
FT                   3819746..3819904,3820611..3820715,3822140..3822324,
FT                   3828142..3828475,3830057..3830123,3834258..3834424))
FT                   /codon_start=1
FT                   /gene="Dnajc16"
FT                   /locus_tag="mCG_19985"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 16,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19985.2 transcript_id=mCT18146.2
FT                   protein_id=mCP14209.2 isoform=CRA_a"
FT                   /protein_id="EDL13397.1"
FT                   /translation="MELKRLGVSWRFLMVLVLILQSLSALDFDPYRVLGVSRTASQADI
FT                   KKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNYDHYGDAGENQGYQKQ
FT                   QREHRFRHFHENFYFDESFFHFPFNAERRDSGDEKYLLHFSHYVNEVLPESFKRPYLIK
FT                   ITSDWCFSCIHIEPVWKEVVQELEGLGVGIGVVHAGYERRLAHHLGAHSTPSILGVISG
FT                   KITFFHNAVVHENLRQFVESLLPGNLVEKVTNKNYVRFLSGWQQENKPHALLFGQTPAV
FT                   PLMYKLTAFAYKDYVSFGYVYVGLRGVEEMTRQYNVNLYTPTMLIFKEHINKPADVIQA
FT                   RGLKKQVIEDFIAQNKYLLASRLTSQRLFHELCPVKRSHRQRKYCVVLLTAETNKVSKP
FT                   FEAFLSFALANTQDTVRFVHVYSNRQQEFASTLLPDMEAFQGKSGVSILERRNTAGRVV
FT                   FKTLEDPWTGSESDKFVLLGYLDQLRKDPAFLSSEAVLPDLTDELAPVFFLRWLYSVSD
FT                   YLSDFWESLLHSNWREMMPLLSLIFSALFILFGTVMVQAFSDSNEERESHPADKEEVPE
FT                   KAGKTEPSFTKESSSKIPKKGFVEVTELTDVTYTSNLVRLRPGHMNVVLILSNSTKTSL
FT                   LQKFALEVYTFTGSSSLHFSFLTLDKHREWLEYLLEFAQDAAPIPNQYDKHFMERDYTG
FT                   YVLALNGHKKYFCLFKPLKTVDEETVASCDPDSSRGKPSCGLGPKPLKGKLSKLSLWME
FT                   RLLEGSLQRFYIPSWPELD"
FT   assembly_gap    3809627..3809739
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    3824340..3824628
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   gene            3839078..3859555
FT                   /gene="Casp9"
FT                   /locus_tag="mCG_19990"
FT                   /note="gene_id=mCG19990.2"
FT   mRNA            join(3839078..3839356,3841805..3842204,3849038..3849072,
FT                   3850579..3850755,3851047..3851136,3852332..3852479,
FT                   3856756..3856935,3857424..3857533,3858812..3859518)
FT                   /gene="Casp9"
FT                   /locus_tag="mCG_19990"
FT                   /product="caspase 9, transcript variant mCT18152"
FT                   /note="gene_id=mCG19990.2 transcript_id=mCT18152.2 created
FT                   on 28-MAY-2002"
FT   mRNA            join(3839100..3839356,3841805..3842204,3849038..3849072,
FT                   3850579..3850755,3851047..3851136,3852332..3852479,
FT                   3856756..3856935,3858812..3859555)
FT                   /gene="Casp9"
FT                   /locus_tag="mCG_19990"
FT                   /product="caspase 9, transcript variant mCT169580"
FT                   /note="gene_id=mCG19990.2 transcript_id=mCT169580.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(3839225..3839356,3841805..3842204,3849038..3849072,
FT                   3850579..3850755,3851047..3851136,3852332..3852479,
FT                   3856756..3856935,3857424..3857533,3858812..3858904)
FT                   /codon_start=1
FT                   /gene="Casp9"
FT                   /locus_tag="mCG_19990"
FT                   /product="caspase 9, isoform CRA_b"
FT                   /note="gene_id=mCG19990.2 transcript_id=mCT18152.2
FT                   protein_id=mCP14215.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C3Q9"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR033139"
FT                   /db_xref="InterPro:IPR033171"
FT                   /db_xref="MGI:MGI:1277950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C3Q9"
FT                   /protein_id="EDL13399.1"
FT                   /translation="MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQ
FT                   AGSGSRRDQARQLVTDLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVK
FT                   PLDHLVPVVLGPMGLTAKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPET
FT                   PRPVDIGSGGAHDVCVPGKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSN
FT                   LDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASH
FT                   LQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTS
FT                   SQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGS
FT                   WYIETLDGILEQWARSEDLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS"
FT   CDS             join(3839225..3839356,3841805..3842204,3849038..3849072,
FT                   3850579..3850755,3851047..3851136,3852332..3852479,
FT                   3856756..3856935,3858812..3858867)
FT                   /codon_start=1
FT                   /gene="Casp9"
FT                   /locus_tag="mCG_19990"
FT                   /product="caspase 9, isoform CRA_a"
FT                   /note="gene_id=mCG19990.2 transcript_id=mCT169580.0
FT                   protein_id=mCP92462.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AS93"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR033139"
FT                   /db_xref="InterPro:IPR033171"
FT                   /db_xref="MGI:MGI:1277950"
FT                   /db_xref="UniProtKB/TrEMBL:A2AS93"
FT                   /protein_id="EDL13398.1"
FT                   /translation="MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQ
FT                   AGSGSRRDQARQLVTDLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVK
FT                   PLDHLVPVVLGPMGLTAKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPET
FT                   PRPVDIGSGGAHDVCVPGKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSN
FT                   LDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASH
FT                   LQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTS
FT                   SQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGCQCCFCERDLQ
FT                   ADSWLF"
FT   assembly_gap    3844600..3844619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3845869..3846477
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   gene            complement(3860179..3892726)
FT                   /locus_tag="mCG_1050228"
FT                   /note="gene_id=mCG1050228.0"
FT   mRNA            complement(join(3860179..3860272,3863086..3863238,
FT                   3864203..3864260,3889604..3889665,3890867..3890964,
FT                   3891048..3891139,3892669..3892726))
FT                   /locus_tag="mCG_1050228"
FT                   /product="mCG1050228"
FT                   /note="gene_id=mCG1050228.0 transcript_id=mCT169582.1
FT                   created on 19-MAR-2004"
FT   gene            complement(3860179..3871388)
FT                   /locus_tag="mCG_19991"
FT                   /note="gene_id=mCG19991.3"
FT   mRNA            complement(join(3860179..3860272,3863086..3863238,
FT                   3864203..3864316,3866580..3866682,3866923..3867051,
FT                   3867451..3867548,3870751..3870845,3871164..3871388))
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, transcript variant mCT169581"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT169581.1 created
FT                   on 19-MAR-2004"
FT   mRNA            complement(join(3860179..3860272,3863086..3863238,
FT                   3864203..3864260,3866546..3866682,3866923..3867051,
FT                   3867451..3867548,3870751..3870845,3871164..3871388))
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, transcript variant mCT169583"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT169583.1 created
FT                   on 19-MAR-2004"
FT   mRNA            complement(join(3860179..3860272,3863086..3863238,
FT                   3864203..3864348,3866546..3866682,3866923..3867051,
FT                   3867451..3867548,3870751..3870845,3871164..3871388))
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, transcript variant mCT18153"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT18153.2 created
FT                   on 19-MAR-2004"
FT   mRNA            complement(join(3860179..3860272,3863086..3863238,
FT                   3864203..>3864406))
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, transcript variant mCT169584"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT169584.1 created
FT                   on 19-MAR-2004"
FT   CDS             complement(join(3860255..3860272,3863086..3863238,
FT                   3864203..3864316,3866580..3866682,3866923..3867051,
FT                   3867451..3867548,3870751..3870845,3871164..3871203))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, isoform CRA_a"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT169581.1
FT                   protein_id=mCP92448.1 isoform=CRA_a"
FT                   /protein_id="EDL13401.1"
FT                   /translation="MIRTLLLSALVAGALSCGYPTYEVEDDVSRVVGGQEATPNTWPWQ
FT                   VSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQV
FT                   SKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYGRLLVVDY
FT                   ATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLG
FT                   CNYPRKPSVFTRVSNYIDWINSVMARN"
FT   CDS             complement(join(3860255..3860272,3863086..3863238,
FT                   3864203..3864348,3866546..3866682,3866923..3867051,
FT                   3867451..3867548,3870751..3870845,3871164..3871203))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, isoform CRA_d"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT18153.2
FT                   protein_id=mCP14219.2 isoform=CRA_d"
FT                   /protein_id="EDL13404.1"
FT                   /translation="MIRTLLLSALVAGALSCGYPTYEVEDDVSRVVGGQEATPNTWPWQ
FT                   VSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQV
FT                   SKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWG
FT                   LLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPL
FT                   NCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN"
FT   CDS             complement(join(3860255..3860272,3863086..3863238,
FT                   3864203..3864406))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, isoform CRA_b"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT169584.1
FT                   protein_id=mCP92463.1 isoform=CRA_b"
FT                   /protein_id="EDL13402.1"
FT                   /translation="MVSSLLGSPPHAFSPWSHSANGNSPDTLRQGRLLVVDYATCSSAS
FT                   WWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKP
FT                   SVFTRVSNYIDWINSVMARN"
FT   CDS             complement(join(3864253..3864260,3889604..3889665,
FT                   3890867..3890964,3891048..3891139,3892669..3892708))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050228"
FT                   /product="mCG1050228"
FT                   /note="gene_id=mCG1050228.0 transcript_id=mCT169582.1
FT                   protein_id=mCP92466.1"
FT                   /protein_id="EDL13400.1"
FT                   /translation="MLGITVLAAILACASSCGDPTFPPNLSARVVGGEDAVPNSWPWQV
FT                   SLQYLRDDTWRHTCGGSLITTSHVLTAAHCINTNLTYRVGLGKYNLTVEDEEAL"
FT   CDS             complement(join(3864253..3864260,3866546..3866682,
FT                   3866923..3867051,3867451..3867548,3870751..3870845,
FT                   3871164..3871203))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, isoform CRA_e"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT169583.1
FT                   protein_id=mCP92449.1 isoform=CRA_e"
FT                   /protein_id="EDL13405.1"
FT                   /translation="MIRTLLLSALVAGALSCGYPTYEVEDDVSRVVGGQEATPNTWPWQ
FT                   VSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQV
FT                   SKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWG
FT                   LLQTL"
FT   mRNA            complement(join(3870178..3870845,3871164..3871388))
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, transcript variant mCT181046"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT181046.1 created
FT                   on 19-MAR-2004"
FT   CDS             complement(join(3870697..3870845,3871164..3871203))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19991"
FT                   /product="mCG19991, isoform CRA_c"
FT                   /note="gene_id=mCG19991.3 transcript_id=mCT181046.1
FT                   protein_id=mCP103968.1 isoform=CRA_c"
FT                   /protein_id="EDL13403.1"
FT                   /translation="MIRTLLLSALVAGALSCGYPTYEVEDDVSRVVGGQEATPNTWPWQ
FT                   VSQPHMWVYCVNMDEAW"
FT   assembly_gap    3878769..3879005
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    3883580..3883599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3884114..3892726)
FT                   /locus_tag="mCG_20000"
FT                   /note="gene_id=mCG20000.3"
FT   mRNA            complement(join(3884114..3884189,3884528..3884680,
FT                   3886128..3886273,3887372..3887508,3889540..3889665,
FT                   3891048..3891139,3892669..3892726))
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, transcript variant mCT185873"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT185873.0 created
FT                   on 23-JUN-2003"
FT   mRNA            complement(join(3884114..3884189,3884528..3884680,
FT                   3886128..3886273,3887372..3887508,3889540..3889665,
FT                   3890867..3890964,3891048..3891139,3892669..3892726))
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, transcript variant mCT18161"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT18161.3 created
FT                   on 23-JUN-2003"
FT   mRNA            complement(join(3884114..3884189,3884528..3884680,
FT                   3886128..3886273,3887372..3887508,3889540..3889665,
FT                   3891048..3891139,3892095..3892206))
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, transcript variant mCT169588"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT169588.1 created
FT                   on 23-JUN-2003"
FT   mRNA            complement(join(3884114..3884189,3884528..3884680,
FT                   3886128..3886273,3887372..3887508,3889540..3889665,
FT                   3890867..3890964,3891048..3891139,3892095..3892206))
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, transcript variant mCT169587"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT169587.1 created
FT                   on 23-JUN-2003"
FT   CDS             complement(join(3884175..3884189,3884528..3884680,
FT                   3886128..3886273,3887372..3887508,3889540..3889665,
FT                   3890867..3890964,3891048..3891139,3892669..3892708))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, isoform CRA_b"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT18161.3
FT                   protein_id=mCP14228.2 isoform=CRA_b"
FT                   /protein_id="EDL13407.1"
FT                   /translation="MLGITVLAAILACASSCGDPTFPPNLSARVVGGEDAVPNSWPWQV
FT                   SLQYLRDDTWRHTCGGSLITTSHVLTAAHCINTNLTYRVGLGKYNLTVEDEEGSVYAEV
FT                   DTIYVHEKWNRLLLWNDIAIIKLAEPVELSDTIQVACIPEQDSLLPGDYPCYVTGWGRL
FT                   WTNGPIAEVLQQGLQPIVNHTTCSRLDWWFIKVRETMVCAGGDGVISACNGDSGGPLNC
FT                   PVEDGLWQVHGIVSFGSSRGCNTYKKPVVFTRVSAYIDWIKEKIQL"
FT   CDS             complement(join(3884175..3884189,3884528..3884680,
FT                   3886128..3886273,3887372..3887508,3889540..3889665,
FT                   3890867..3890964,3891048..3891139,3892095..3892134))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, isoform CRA_d"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT169587.1
FT                   protein_id=mCP92455.0 isoform=CRA_d"
FT                   /protein_id="EDL13410.1"
FT                   /translation="MLGITVLAAILACASSCGDPTFPPNLSARVVGGEDAVPNSWPWQV
FT                   SLQYLRDDTWRHTCGGSLITTSHVLTAAHCINTNLTYRVGLGKYNLTVEDEEGSVYAEV
FT                   DTIYVHEKWNRLLLWNDIAIIKLAEPVELSDTIQVACIPEQDSLLPGDYPCYVTGWGRL
FT                   WTNGPIAEVLQQGLQPIVNHTTCSRLDWWFIKVRETMVCAGGDGVISACNGDSGGPLNC
FT                   PVEDGLWQVHGIVSFGSSRGCNTYKKPVVFTRVSAYIDWIKEKIQL"
FT   CDS             complement(join(3884175..3884189,3884528..3884680,
FT                   3886128..3886273,3887372..3887508,3889540..3889665,
FT                   3891048..3891076))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, isoform CRA_a"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT169588.1
FT                   protein_id=mCP92458.0 isoform=CRA_a"
FT                   /protein_id="EDL13406.1"
FT                   /translation="MLSPIAGLGSTNLTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEK
FT                   WNRLLLWNDIAIIKLAEPVELSDTIQVACIPEQDSLLPGDYPCYVTGWGRLWTNGPIAE
FT                   VLQQGLQPIVNHTTCSRLDWWFIKVRETMVCAGGDGVISACNGDSGGPLNCPVEDGLWQ
FT                   VHGIVSFGSSRGCNTYKKPVVFTRVSAYIDWIKEKIQL"
FT   CDS             complement(join(3884175..3884189,3884528..3884680,
FT                   3886128..3886273,3887372..3887508,3889540..3889665,
FT                   3891048..3891076))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, isoform CRA_a"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT185873.0
FT                   protein_id=mCP107131.0 isoform=CRA_a"
FT                   /protein_id="EDL13408.1"
FT                   /translation="MLSPIAGLGSTNLTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEK
FT                   WNRLLLWNDIAIIKLAEPVELSDTIQVACIPEQDSLLPGDYPCYVTGWGRLWTNGPIAE
FT                   VLQQGLQPIVNHTTCSRLDWWFIKVRETMVCAGGDGVISACNGDSGGPLNCPVEDGLWQ
FT                   VHGIVSFGSSRGCNTYKKPVVFTRVSAYIDWIKEKIQL"
FT   gene            <3890189..3893430
FT                   /locus_tag="mCG_146147"
FT                   /note="gene_id=mCG146147.0"
FT   mRNA            join(<3890189..3890222,3892368..3892423,3893198..3893430)
FT                   /locus_tag="mCG_146147"
FT                   /product="mCG146147"
FT                   /note="gene_id=mCG146147.0 transcript_id=mCT186250.0
FT                   created on 14-JUL-2003"
FT   mRNA            complement(join(3890568..3890964,3891048..3891139,
FT                   3892095..3892206))
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, transcript variant mCT186524"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT186524.0 created
FT                   on 23-JUN-2003"
FT   CDS             complement(join(3890685..3890964,3891048..3891076))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20000"
FT                   /product="mCG20000, isoform CRA_c"
FT                   /note="gene_id=mCG20000.3 transcript_id=mCT186524.0
FT                   protein_id=mCP107228.0 isoform=CRA_c"
FT                   /protein_id="EDL13409.1"
FT                   /translation="MLSPIAGLGRSLFSTSGMTLGGTPVGAVSSPPATSSLLPTASSEW
FT                   ERHLETSEEPTVQALGSVSCCPRLTRLFVNSVDISLLGLLAKIKCSSIQLAYEQVYV"
FT   assembly_gap    3892550..3892569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <3893221..3893358
FT                   /codon_start=1
FT                   /locus_tag="mCG_146147"
FT                   /product="mCG146147"
FT                   /note="gene_id=mCG146147.0 transcript_id=mCT186250.0
FT                   protein_id=mCP107292.0"
FT                   /protein_id="EDL13411.1"
FT                   /translation="VHCSCLQTHQKRTSDPMTDGCEPPCGCWELNSGPLEEQATRALNR
FT                   "
FT   assembly_gap    3893742..3895967
FT                   /estimated_length=2226
FT                   /gap_type="unknown"
FT   gene            complement(3895972..3912310)
FT                   /gene="Efhd2"
FT                   /locus_tag="mCG_19988"
FT                   /note="gene_id=mCG19988.2"
FT   mRNA            complement(join(3895972..3897318,3897988..3898122,
FT                   3899245..3899392,3911943..3912310))
FT                   /gene="Efhd2"
FT                   /locus_tag="mCG_19988"
FT                   /product="EF hand domain containing 2"
FT                   /note="gene_id=mCG19988.2 transcript_id=mCT18149.2 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(3897187..3897318,3897988..3898122,
FT                   3899245..3899392,3911943..3912256))
FT                   /codon_start=1
FT                   /gene="Efhd2"
FT                   /locus_tag="mCG_19988"
FT                   /product="EF hand domain containing 2"
FT                   /note="gene_id=mCG19988.2 transcript_id=mCT18149.2
FT                   protein_id=mCP14213.2"
FT                   /protein_id="EDL13412.1"
FT                   /translation="MATDELASKLSRRLQMEGEGGEATEQPGLNGAAAAAAAAAEAPDE
FT                   TAQALGSADDELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFK
FT                   QYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAA
FT                   AGELQEDSGLHVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKK
FT                   QAEEVKQRKAAFKELQSTFK"
FT   assembly_gap    3904477..3904496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3922451..3922931
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    3925689..3928018
FT                   /estimated_length=2330
FT                   /gap_type="unknown"
FT   gene            complement(3929401..3990676)
FT                   /gene="Fhad1"
FT                   /locus_tag="mCG_140448"
FT                   /note="gene_id=mCG140448.0"
FT   mRNA            complement(join(3929401..3929918,3935423..3935476,
FT                   3938053..3938118,3942715..3942880,3943827..3944047,
FT                   3944413..3944508,3947845..3947972,3948599..3948728,
FT                   3954295..3954421,3954755..3954914,3956636..3956742,
FT                   3957110..3957194,3959110..3959335,3960617..3960790,
FT                   3966745..3966849,3967896..3968003,3971161..3971298,
FT                   3977551..3977687,3990072..3990267,3990555..3990676))
FT                   /gene="Fhad1"
FT                   /locus_tag="mCG_140448"
FT                   /product="forkhead-associated (FHA) phosphopeptide binding
FT                   domain 1"
FT                   /note="gene_id=mCG140448.0 transcript_id=mCT169594.0
FT                   created on 28-MAY-2002"
FT   CDS             complement(join(3929808..3929918,3935423..3935476,
FT                   3938053..3938118,3942715..3942880,3943827..3944047,
FT                   3944413..3944508,3947845..3947972,3948599..3948728,
FT                   3954295..3954421,3954755..3954914,3956636..3956742,
FT                   3957110..3957194,3959110..3959335,3960617..3960790,
FT                   3966745..3966849,3967896..3968003,3971161..3971298,
FT                   3977551..3977687,3990072..3990261))
FT                   /codon_start=1
FT                   /gene="Fhad1"
FT                   /locus_tag="mCG_140448"
FT                   /product="forkhead-associated (FHA) phosphopeptide binding
FT                   domain 1"
FT                   /note="gene_id=mCG140448.0 transcript_id=mCT169594.0
FT                   protein_id=mCP92469.0"
FT                   /protein_id="EDL13413.1"
FT                   /translation="MRDSCSSIDLKKEVELLQHLPLSPLVSGLQKTVVNILRVSLSWLE
FT                   ETEQLLGDLDIELSDSDKAQMNASRETQKSLRQEHLAEKEKLAEKLEQEEKLKAKIQQL
FT                   TEEKAADSTAAVGLQALEESIGQEKSRSEEALEKAQARVRELENHLASQKEALENSVAQ
FT                   EKRKMREMLEAERRKAQDLENQLTQQKEISENNTYEKLKMRDTLEKEKRKIQDLENRLT
FT                   KQKEEIELKEQKENVLNNKLKDALVMVEDAQQMKTTESQRAETLALKLKETLAELETTK
FT                   TKMILTDDRLKLQQQSMKALQDERESQKHGFEEEISEYKEQIKQHSQTIVSLEERLCQV
FT                   TQYYQKIEGEITTLKNNDTGPKEEAPQDLTAGPPLDSGDKEIACDHLIDDLLMAQKEIL
FT                   SQQEIIMKLRTDLGEAHSRMSDLRGELSEKQKMELERQVALVRQQSGELSMLKAKVAQT
FT                   TGLMEKKDRELKVLREALRASQEKPRPHLSTEQKPRTLSQKCDISLQIEPAHPDSFSSF
FT                   QEEQSFSDLGVKCKGSRHEETIQRQRKALSELRTRVRELEKANSCNHKDHVNESFLELR
FT                   TLRMEKNVQKILLDAKPDLTTLARVEIRPPQNSPFNSGSTLVMEKSVKTDAGEALELSE
FT                   KLYTDMIKTLGSLMNIKDMSSHTSLKHLSPKEREKVNHLRQKDLDLVFDKITQLKTRLQ
FT                   RKEELLKGYEQELEQLRHSKVSVQMYQTQVAKLEDDVHKEAEEKALLKEALERTEQQLS
FT                   QERRFNRVFKQQKDRGEDPEQRNMSYSPFKDNEKQRRLFVEMVKSKMQNSSVQAGAKKA
FT                   TLKTGQERETKKEAYKSTQSLSFVKPGGKN"
FT   assembly_gap    3936326..3936717
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    3976377..3976663
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    3978480..3978683
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   gene            complement(4001448..4051680)
FT                   /locus_tag="mCG_117086"
FT                   /note="gene_id=mCG117086.1"
FT   mRNA            complement(join(4001448..4002093,4003161..4003250,
FT                   4010964..4011094,4012455..4012578,4020094..4020336,
FT                   4023422..4023531,4029050..4029290,4038223..4038429,
FT                   4048153..4048259,4049592..4049785,4051557..4051680))
FT                   /locus_tag="mCG_117086"
FT                   /product="mCG117086"
FT                   /note="gene_id=mCG117086.1 transcript_id=mCT118219.1
FT                   created on 11-FEB-2003"
FT   CDS             complement(join(4001953..4002093,4003161..4003250,
FT                   4010964..4011094,4012455..4012578,4020094..4020336,
FT                   4023422..4023531,4029050..4029290,4038223..4038429,
FT                   4048153..4048245))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117086"
FT                   /product="mCG117086"
FT                   /note="gene_id=mCG117086.1 transcript_id=mCT118219.1
FT                   protein_id=mCP53331.1"
FT                   /protein_id="EDL13414.1"
FT                   /translation="MKAYLKSADGFFVLNKSTTIGKHADSDLVLQSADIDNHHALIEFN
FT                   EAEGTFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGMTYELVIENPSPVSCP
FT                   WVRGPAPWPSPQPHLSSSPPDMPFHHGIQPATVQRSWSQGCPRPTMVPPAPHQRPMSAS
FT                   GKMFSFVMDPKSPVINQVWANAMDMSEQCMMDGLSGTIPPTEIFMDHDLSQQDKDEIIL
FT                   LLGREVNRLSDFEMESKYKDALIMNLQAEVADLSQRLSETAAVAAARQSNRCDPKLQGV
FT                   DEGDDLRQKEIESMKSQINALQKGYSQVLSQTLAERNTEIESLKNEGENLKRDHAITSG
FT                   MVTSLQKDMSARNEQVQQLQEEVNRLRIENREKEYQLEALSSRCSVMKEELRKEEAQKD
FT                   RREAQEKELKLCRSQMQDMEKEVRKLREELKKNYMGQNIISKTLREKNKVRASRKLDCV
FT                   P"
FT   assembly_gap    4003502..4004111
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    4005368..4006035
FT                   /estimated_length=668
FT                   /gap_type="unknown"
FT   assembly_gap    4007725..4007744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4019258..4019277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4020937..4024743
FT                   /locus_tag="mCG_145203"
FT                   /note="gene_id=mCG145203.0"
FT   mRNA            join(<4020937..4020986,4021172..4021314,4023030..4023359,
FT                   4024269..4024743)
FT                   /locus_tag="mCG_145203"
FT                   /product="mCG145203"
FT                   /note="gene_id=mCG145203.0 transcript_id=mCT184627.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4020939..4020986,4021172..4021314,4023030..4023156)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145203"
FT                   /product="mCG145203"
FT                   /note="gene_id=mCG145203.0 transcript_id=mCT184627.0
FT                   protein_id=mCP105184.0"
FT                   /protein_id="EDL13415.1"
FT                   /translation="GKHGNQDVSVSPKLEQHFTQPHPQRATLGLHTQQHRIDYLFVPQR
FT                   STGHLLCAGLCTGCKQTFSWCVFSPLLCHHLGMTRCMREMPDLGSDSVLFFTLCILGHA
FT                   S"
FT   assembly_gap    4025924..4026127
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    4030548..4030567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4035320..4035898
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    4040327..4040346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4043379..4043429
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            4054699..4065443
FT                   /locus_tag="mCG_147453"
FT                   /note="gene_id=mCG147453.0"
FT   mRNA            join(4054699..4054738,4065209..4065443)
FT                   /locus_tag="mCG_147453"
FT                   /product="mCG147453"
FT                   /note="gene_id=mCG147453.0 transcript_id=mCT187716.0
FT                   created on 13-JAN-2004"
FT   CDS             4065250..4065399
FT                   /codon_start=1
FT                   /locus_tag="mCG_147453"
FT                   /product="mCG147453"
FT                   /note="gene_id=mCG147453.0 transcript_id=mCT187716.0
FT                   protein_id=mCP108135.0"
FT                   /protein_id="EDL13416.1"
FT                   /translation="MFSYDSPRTATEDICLLLKLHTVSEFSAALRLISGRHTVLSEVFF
FT                   LSSS"
FT   gene            complement(4067601..4121726)
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /note="gene_id=mCG19986.3"
FT   mRNA            complement(join(4067601..4068702,4073977..4074505,
FT                   4121278..4121726))
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /product="transmembrane protein 51, transcript variant
FT                   mCT185881"
FT                   /note="gene_id=mCG19986.3 transcript_id=mCT185881.0 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(4067601..4068702,4073977..4074505,
FT                   4120855..4121097))
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /product="transmembrane protein 51, transcript variant
FT                   mCT18147"
FT                   /note="gene_id=mCG19986.3 transcript_id=mCT18147.3 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(4067601..4068702,4073977..4074505,
FT                   4113813..4113888))
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /product="transmembrane protein 51, transcript variant
FT                   mCT169578"
FT                   /note="gene_id=mCG19986.3 transcript_id=mCT169578.1 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(4067601..4068702,4073977..4074505,
FT                   4084853..4085159))
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /product="transmembrane protein 51, transcript variant
FT                   mCT185882"
FT                   /note="gene_id=mCG19986.3 transcript_id=mCT185882.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(4068294..4068702,4073977..4074317))
FT                   /codon_start=1
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /product="transmembrane protein 51, isoform CRA_a"
FT                   /note="gene_id=mCG19986.3 transcript_id=mCT169578.1
FT                   protein_id=mCP92456.0 isoform=CRA_a"
FT                   /protein_id="EDL13417.1"
FT                   /translation="MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTS
FT                   QGNKTEGGGGILKSKTFSVAYVLVGAGMMLLLLAICLSIRDKRRMRQSEELARIQQQAG
FT                   TVPHSQEEDSQEEEEDVSSRYYVPSYEEVMNTGYPETRGQEQNPRLSISLPSYESLTGL
FT                   DEATPTSTRAETETSPGHAPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRITLPDKNVP
FT                   PPSIEPLTPPPLYDEVQAKAPDARPPD"
FT   CDS             complement(join(4068294..4068702,4073977..4074317))
FT                   /codon_start=1
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /product="transmembrane protein 51, isoform CRA_a"
FT                   /note="gene_id=mCG19986.3 transcript_id=mCT18147.3
FT                   protein_id=mCP14214.3 isoform=CRA_a"
FT                   /protein_id="EDL13418.1"
FT                   /translation="MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTS
FT                   QGNKTEGGGGILKSKTFSVAYVLVGAGMMLLLLAICLSIRDKRRMRQSEELARIQQQAG
FT                   TVPHSQEEDSQEEEEDVSSRYYVPSYEEVMNTGYPETRGQEQNPRLSISLPSYESLTGL
FT                   DEATPTSTRAETETSPGHAPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRITLPDKNVP
FT                   PPSIEPLTPPPLYDEVQAKAPDARPPD"
FT   CDS             complement(join(4068294..4068702,4073977..4074317))
FT                   /codon_start=1
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /product="transmembrane protein 51, isoform CRA_a"
FT                   /note="gene_id=mCG19986.3 transcript_id=mCT185881.0
FT                   protein_id=mCP107140.0 isoform=CRA_a"
FT                   /protein_id="EDL13419.1"
FT                   /translation="MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTS
FT                   QGNKTEGGGGILKSKTFSVAYVLVGAGMMLLLLAICLSIRDKRRMRQSEELARIQQQAG
FT                   TVPHSQEEDSQEEEEDVSSRYYVPSYEEVMNTGYPETRGQEQNPRLSISLPSYESLTGL
FT                   DEATPTSTRAETETSPGHAPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRITLPDKNVP
FT                   PPSIEPLTPPPLYDEVQAKAPDARPPD"
FT   CDS             complement(join(4068294..4068702,4073977..4074317))
FT                   /codon_start=1
FT                   /gene="Tmem51"
FT                   /locus_tag="mCG_19986"
FT                   /product="transmembrane protein 51, isoform CRA_a"
FT                   /note="gene_id=mCG19986.3 transcript_id=mCT185882.0
FT                   protein_id=mCP107139.0 isoform=CRA_a"
FT                   /protein_id="EDL13420.1"
FT                   /translation="MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTS
FT                   QGNKTEGGGGILKSKTFSVAYVLVGAGMMLLLLAICLSIRDKRRMRQSEELARIQQQAG
FT                   TVPHSQEEDSQEEEEDVSSRYYVPSYEEVMNTGYPETRGQEQNPRLSISLPSYESLTGL
FT                   DEATPTSTRAETETSPGHAPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRITLPDKNVP
FT                   PPSIEPLTPPPLYDEVQAKAPDARPPD"
FT   assembly_gap    4106292..4106671
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    4110913..4110932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4126184..4126215
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4134135..4134935
FT                   /estimated_length=801
FT                   /gap_type="unknown"
FT   gene            complement(4139968..4154293)
FT                   /locus_tag="mCG_19984"
FT                   /note="gene_id=mCG19984.2"
FT   mRNA            complement(join(4139968..4142631,4144489..4144603,
FT                   4146221..4146387,4146952..4147053,4149205..4149436,
FT                   4154144..4154293))
FT                   /locus_tag="mCG_19984"
FT                   /product="mCG19984"
FT                   /note="gene_id=mCG19984.2 transcript_id=mCT18145.2 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(4142467..4142631,4144489..4144603,
FT                   4146221..4146387,4146952..4147053,4149205..4149436,
FT                   4154144..4154268))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19984"
FT                   /product="mCG19984"
FT                   /note="gene_id=mCG19984.2 transcript_id=mCT18145.2
FT                   protein_id=mCP14210.2"
FT                   /protein_id="EDL13421.1"
FT                   /translation="MQVLLSLSDEDLELGLGVCSSLHRRKLRLAIEDYRDAEAGRSLSK
FT                   AADLDHHWVAKAWLNDIGLSQYSQAFQNHLVDGRMLNSLMKRDLEKHLNVSKKFHQVSI
FT                   LLGIELLYQVNFSREALQERRARCETQNTDPVVWTNQRVLKWVRDIDLKEYADNLTNSG
FT                   VHGAVLVLEPTFNAEAMATALGIPSGKHILRRHLAEEMSTIFHPSNSTGIRESERFGTP
FT                   PGRASSITRAGREDSGGNSKHRAGRLPLGKIGRGFSSKEPDFHDDYGSLENEDCGDEDL
FT                   QGRPEQCRLEGYGSLEVTNV"
FT   assembly_gap    4158661..4159693
FT                   /estimated_length=1033
FT                   /gap_type="unknown"
FT   assembly_gap    4163301..4163845
FT                   /estimated_length=545
FT                   /gap_type="unknown"
FT   gene            complement(4176632..4277335)
FT                   /locus_tag="mCG_19998"
FT                   /note="gene_id=mCG19998.2"
FT   mRNA            complement(join(4176632..4179184,4180682..4180732,
FT                   4184392..4184519,4188239..4188428,4191813..4191983,
FT                   4196408..4196544,4247678..4247869,4276942..4277335))
FT                   /locus_tag="mCG_19998"
FT                   /product="mCG19998"
FT                   /note="gene_id=mCG19998.2 transcript_id=mCT18160.2 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(4179017..4179184,4180682..4180732,
FT                   4184392..4184519,4188239..4188428,4191813..4191983,
FT                   4196408..4196544,4247678..4247869,4276942..4277149))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19998"
FT                   /product="mCG19998"
FT                   /note="gene_id=mCG19998.2 transcript_id=mCT18160.2
FT                   protein_id=mCP14225.2"
FT                   /protein_id="EDL13422.1"
FT                   /translation="MRAADSGSWERVRQLAAYGQPTPSCGRDTGSARVPEPGACKLCAD
FT                   TTRLREQQGAGAVPDAADGFGIQPVLLREEVVQLQEEVHLLRQMKEMLAKDLEESQGGK
FT                   CSEVLSATELRVQLVQKEQELARAKEALQAMKADRKRLKGEKTDLVSQMQQLYATLESR
FT                   EEQLRDFIRNYEQHRKESEDAVKALAKEKDLLEREKWELRRQAKEATDHAAALRSQLDL
FT                   KDNRMKELEAELAMAKQSLATLTKDVPKRHSLAMPGETVLNGNQEWVVQADLPLTAAIR
FT                   QSQQTLYHSHPPHPADRQVRVSPCHSRQPSVISDASAAEGDRSSTPSDINSPRHRTHSL
FT                   CNGDSPGPVQKSLHNPIVQSLEDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLF
FT                   DGTAPDYYIEEDADW"
FT   assembly_gap    4199724..4199778
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    4202616..4202859
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    4207025..4207044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4235531..4235689
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    4236744..4236763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4238306..4238495
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    4239620..4239775
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    4266351..4266679
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    4281353..4281372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4283109..4284377
FT                   /estimated_length=1269
FT                   /gap_type="unknown"
FT   assembly_gap    4310783..4311042
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    4315326..4315345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4318840..4319076
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    4333869..4333966
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    4341707..4341726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4354374..4354396
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    4369440..4369459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4378589..4378706
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    4389119..4389379
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    4434207..4434350
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    4456916..4456935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4462631..4462717
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    4464066..4464228
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    4468894..4469170
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    4470178..4470481
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    4471509..4471531
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    4487903..4487922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4491163..4491626
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   assembly_gap    4494546..4494965
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    4497255..4497274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4500652..4501281
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    4502512..4502531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4522108..4522127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4523593..4523612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4543960..4543979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4545944..4545963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4548776..4548795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4551066..4551085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4557216..4557235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4560303..4560322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4561329..4561348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4574953..4575750
FT                   /estimated_length=798
FT                   /gap_type="unknown"
FT   assembly_gap    4577369..4577388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4585414..4585477
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    4599096..4599115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4607976..4608229
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    4608688..4608707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4634969..4635037
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    4654918..4654937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4665346..4672191
FT                   /estimated_length=6846
FT                   /gap_type="unknown"
FT   assembly_gap    4677334..4678592
FT                   /estimated_length=1259
FT                   /gap_type="unknown"
FT   assembly_gap    4686601..4686797
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    4697996..4698257
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    4701140..4701159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4719938..4720000
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    4738232..4738793
FT                   /estimated_length=562
FT                   /gap_type="unknown"
FT   assembly_gap    4739880..4739957
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4757232..4757448
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    4759530..4759764
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    4808882..4808972
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    4816014..4816433
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    4819890..4821109
FT                   /estimated_length=1220
FT                   /gap_type="unknown"
FT   assembly_gap    4822414..4822758
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    4846419..4846438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4857385..4857687
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    4874828..4874907
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    4880013..4880145
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    4904988..4905209
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    4911203..4911222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4912625..4912644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4916253..4916530
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    4927797..4927816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4945325..4945344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4953394..4961518
FT                   /estimated_length=8125
FT                   /gap_type="unknown"
FT   assembly_gap    4963177..4963447
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    4978076..4978095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4997901..4997962
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    5011306..5011438
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    5012639..5013008
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    5020041..5020159
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    5028408..5028489
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    5045056..5045395
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    5052250..5052467
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    5053995..5054309
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    5062045..5062064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5067523..5067542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5096942..5097226
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    5114803..5119399
FT                   /estimated_length=4597
FT                   /gap_type="unknown"
FT   gene            complement(5139997..5248536)
FT                   /locus_tag="mCG_7295"
FT                   /note="gene_id=mCG7295.2"
FT   mRNA            complement(join(5139997..5140141,5163012..5164800,
FT                   5165168..5167141,5195583..5195709,5203553..5203705,
FT                   5212810..5212886,5214368..5214482,5228613..5228686,
FT                   5248442..5248536))
FT                   /locus_tag="mCG_7295"
FT                   /product="mCG7295, transcript variant mCT6354"
FT                   /note="gene_id=mCG7295.2 transcript_id=mCT6354.2 created on
FT                   28-MAY-2002"
FT   CDS             complement(join(5140021..5140141,5163012..5164800,
FT                   5165168..5167141,5195583..5195709,5203553..5203705,
FT                   5212810..5212886,5214368..5214482,5228613..5228621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7295"
FT                   /product="mCG7295, isoform CRA_a"
FT                   /note="gene_id=mCG7295.2 transcript_id=mCT6354.2
FT                   protein_id=mCP14216.2 isoform=CRA_a"
FT                   /protein_id="EDL13423.1"
FT                   /translation="MHQNTESVAVTETLAEVPEHVLRGLPEEVRLLPSAVDKTRIGVWA
FT                   TKPILKGKKFGPFVGDKKKRSQVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLF
FT                   PLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRRDMP
FT                   NESSVKEPEIRCEEKPEDLLEEPRSVPTETSEGSPGTTPPPHAPRAREEANGEGLETFM
FT                   FPCQHCERKFATKQGLERHMHIHISTINHAFKCKYCGKPFGTQINRRRHERRHETGLKR
FT                   RPSMALQSSEDPDDGKGENVTSKDESSPPQLGQDCLILNSEKTSQEILNSSFVEENGEV
FT                   KELHPCKYCKKVFGTHTNMRRHQRRVHERHLIPKGVRRKGGLLEEPQPPAEQAPPSQNV
FT                   YVPSTEPEEDGDADDVYIMDISSNISENLNYYIDGKIQTNNSTSDCDVIEMESNSAHLY
FT                   GIDCLLTPVTVEITQNIKSTQGSVTDDLLKESPSSTNCESKKRRTASPPVLPKIKAETD
FT                   SDSTAPSCSLSLPLSISTTEVVSFHKEKGVYLSSKLKQLLQTQDKLTPPAGISTAEIPK
FT                   LGPVCVSAPASMLAVTSSRFKRRTSSPPSSPQHSPALRDFGKQSDGKAAWTDTALTSKK
FT                   PKLESRSDSPAWSLSGRDERETGSPPCFDEYKISKEWAASSTFSSVCNQQPLDLSSGVK
FT                   QKSEGTGKTPVPWESVLDLSVHKKPCDSEGKEFKENHLAQPAAKKKKPTTCMLQKVLLN
FT                   EYNGVSLPTESTPEATRSPSPCKSPDTQPDPELATDSSCSAPTAESPPEVVGPSSPPLQ
FT                   AASLSSVSSVVSSGDNLEASLPAITLKQEESESEGLKRKEEAPAAGGQSAVQETFSRNF
FT                   VCNVCASPFLSIKDLTKHLSVHAEEWPFKCEFCVQLFKGKTDLSEHRFLLHGVGNIFVC
FT                   SVCKKEFAFLCNLQQHQRDLHPDELCTHHEFESGTLRPQNFTDPSKAHVEHMPSLPEEP
FT                   AEASREEELNDSSEELYTTIKIMASGIKTKEPDVRLGLNQHYPSFKPPPFQYHHRNPMG
FT                   IGVTATNFTTHNIPQTFTTAIRCTKCGKSVDNMPELHKHILACASASDKKRYTPKKNPV
FT                   PLRQTVQPKNGVLVLDNSGKNAFRRMGQPKRLSFNVELSKMSPNKLKLNALKKKNQLVQ
FT                   KAILQKNRSAKQKADLRDTSEASSHICPYCDREFTYIGSLNKHAAFSCPKKPLSPSKRK
FT                   VSHSSKKGGHTSSASSDRNSSSNPRRRTADTEIKMQSMQAPLGKTRARSTGPAQASLPS
FT                   SSFRSRQNVKFAASVKSKKASSSSLRNSSPVRMAKITHVEGKKSKAVAKSHSTQLSSKA
FT                   SRSLHVKVQKSKAVLQSKTALASKKRTDRFIVKSRERSGGPITRSLQLAAAADLSESRR
FT                   EDSSARHELKDLSYSLRLASRCASSTAPYITRQCRKVKAAAATQFQGPFFKE"
FT   assembly_gap    5140973..5140992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5143309..5143347
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    5150327..5150346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5152859..5152878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5155036..5155055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5159440..5160276,5163012..5164800,
FT                   5165168..5167141,5195583..5195709,5203553..5203705,
FT                   5212810..5212886,5214368..5214482,5228613..5228686,
FT                   5248442..5248536))
FT                   /locus_tag="mCG_7295"
FT                   /product="mCG7295, transcript variant mCT169602"
FT                   /note="gene_id=mCG7295.2 transcript_id=mCT169602.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(5160264..5160276,5163012..5164800,
FT                   5165168..5167141,5195583..5195709,5203553..5203705,
FT                   5212810..5212886,5214368..5214482,5228613..5228621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7295"
FT                   /product="mCG7295, isoform CRA_b"
FT                   /note="gene_id=mCG7295.2 transcript_id=mCT169602.0
FT                   protein_id=mCP92453.0 isoform=CRA_b"
FT                   /protein_id="EDL13424.1"
FT                   /translation="MHQNTESVAVTETLAEVPEHVLRGLPEEVRLLPSAVDKTRIGVWA
FT                   TKPILKGKKFGPFVGDKKKRSQVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLF
FT                   PLEINRAIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRRDMP
FT                   NESSVKEPEIRCEEKPEDLLEEPRSVPTETSEGSPGTTPPPHAPRAREEANGEGLETFM
FT                   FPCQHCERKFATKQGLERHMHIHISTINHAFKCKYCGKPFGTQINRRRHERRHETGLKR
FT                   RPSMALQSSEDPDDGKGENVTSKDESSPPQLGQDCLILNSEKTSQEILNSSFVEENGEV
FT                   KELHPCKYCKKVFGTHTNMRRHQRRVHERHLIPKGVRRKGGLLEEPQPPAEQAPPSQNV
FT                   YVPSTEPEEDGDADDVYIMDISSNISENLNYYIDGKIQTNNSTSDCDVIEMESNSAHLY
FT                   GIDCLLTPVTVEITQNIKSTQGSVTDDLLKESPSSTNCESKKRRTASPPVLPKIKAETD
FT                   SDSTAPSCSLSLPLSISTTEVVSFHKEKGVYLSSKLKQLLQTQDKLTPPAGISTAEIPK
FT                   LGPVCVSAPASMLAVTSSRFKRRTSSPPSSPQHSPALRDFGKQSDGKAAWTDTALTSKK
FT                   PKLESRSDSPAWSLSGRDERETGSPPCFDEYKISKEWAASSTFSSVCNQQPLDLSSGVK
FT                   QKSEGTGKTPVPWESVLDLSVHKKPCDSEGKEFKENHLAQPAAKKKKPTTCMLQKVLLN
FT                   EYNGVSLPTESTPEATRSPSPCKSPDTQPDPELATDSSCSAPTAESPPEVVGPSSPPLQ
FT                   AASLSSVSSVVSSGDNLEASLPAITLKQEESESEGLKRKEEAPAAGGQSAVQETFSRNF
FT                   VCNVCASPFLSIKDLTKHLSVHAEEWPFKCEFCVQLFKGKTDLSEHRFLLHGVGNIFVC
FT                   SVCKKEFAFLCNLQQHQRDLHPDELCTHHEFESGTLRPQNFTDPSKAHVEHMPSLPEEP
FT                   AEASREEELNDSSEELYTTIKIMASGIKTKEPDVRLGLNQHYPSFKPPPFQYHHRNPMG
FT                   IGVTATNFTTHNIPQTFTTAIRCTKCGKSVDNMPELHKHILACASASDKKRYTPKKNPV
FT                   PLRQTVQPKNGVLVLDNSGKNAFRRMGQPKRLSFNVELSKMSPNKLKLNALKKKNQLVQ
FT                   KAILQKNRSAKQKADLRDTSEASSHICPYCDREFTYIGSLNKHAAFSCPKKPLSPSKRK
FT                   VSHSSKKGGHTSSASSDRNSSSNPRRRTADTEIKMQSMQAPLGKTRARSTGPAQASLPS
FT                   SSFRSRQNVKFAASVKSKKASSSSLRNSSPVRMAKITHVEGKKSKAVAKSHSTQLSSKA
FT                   SRSLHVKVQKSKAVLQSKTALASKKRTDRFIVKSRERSGGPITRSLQLAAAADLSESRR
FT                   EDSSARHELKDLRNFL"
FT   assembly_gap    5168197..5170781
FT                   /estimated_length=2585
FT                   /gap_type="unknown"
FT   assembly_gap    5171958..5171977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5172985..5173004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5174140..5174159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5175352..5175371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5176970..5176989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5186113..5186526
FT                   /pseudo
FT                   /locus_tag="mCG_49277"
FT                   /note="gene_id=mCG49277.2"
FT   mRNA            5186113..5186526
FT                   /pseudo
FT                   /locus_tag="mCG_49277"
FT                   /note="gene_id=mCG49277.2 transcript_id=mCT49460.2 created
FT                   on 28-MAY-2002"
FT   gene            5200124..5200953
FT                   /pseudo
FT                   /locus_tag="mCG_7292"
FT                   /note="gene_id=mCG7292.2"
FT   mRNA            5200124..5200953
FT                   /pseudo
FT                   /locus_tag="mCG_7292"
FT                   /note="gene_id=mCG7292.2 transcript_id=mCT6352.2 created on
FT                   28-MAY-2002"
FT   assembly_gap    5215316..5215335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5221028..5221047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5231261..5231280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5257777..5258814
FT                   /estimated_length=1038
FT                   /gap_type="unknown"
FT   assembly_gap    5260149..5261056
FT                   /estimated_length=908
FT                   /gap_type="unknown"
FT   assembly_gap    5269605..5269624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5270946..5274896
FT                   /estimated_length=3951
FT                   /gap_type="unknown"
FT   assembly_gap    5277344..5277391
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    5280829..5280848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5280928..5282681)
FT                   /pseudo
FT                   /locus_tag="mCG_117449"
FT                   /note="gene_id=mCG117449.1"
FT   mRNA            complement(5280928..5282681)
FT                   /pseudo
FT                   /locus_tag="mCG_117449"
FT                   /note="gene_id=mCG117449.1 transcript_id=mCT118589.1
FT                   created on 28-MAY-2002"
FT   assembly_gap    5291038..5291057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5292199..5292218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5300217..5300236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5305911..5305930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5307099..5307118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5308210..5343071)
FT                   /gene="Pdpn"
FT                   /locus_tag="mCG_7294"
FT                   /note="gene_id=mCG7294.2"
FT   mRNA            complement(join(5308210..5308604,5310235..5310813,
FT                   5311577..5311688,5319800..5319938,5342813..5343028))
FT                   /gene="Pdpn"
FT                   /locus_tag="mCG_7294"
FT                   /product="podoplanin, transcript variant mCT169601"
FT                   /note="gene_id=mCG7294.2 transcript_id=mCT169601.0 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(5308211..5308607,5309821..5310813,
FT                   5311577..5311688,5319800..5319938,5342813..5343028))
FT                   /gene="Pdpn"
FT                   /locus_tag="mCG_7294"
FT                   /product="podoplanin, transcript variant mCT6353"
FT                   /note="gene_id=mCG7294.2 transcript_id=mCT6353.2 created on
FT                   28-MAY-2002"
FT   assembly_gap    5308608..5308627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5309834..5310813,5311577..5311688,
FT                   5314203..5314243,5319800..5319938,5342813..5343071))
FT                   /gene="Pdpn"
FT                   /locus_tag="mCG_7294"
FT                   /product="podoplanin, transcript variant mCT169600"
FT                   /note="gene_id=mCG7294.2 transcript_id=mCT169600.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(5310799..5310813,5311577..5311688,
FT                   5319800..5319938,5342813..5342879))
FT                   /codon_start=1
FT                   /gene="Pdpn"
FT                   /locus_tag="mCG_7294"
FT                   /product="podoplanin, isoform CRA_a"
FT                   /note="gene_id=mCG7294.2 transcript_id=mCT169601.0
FT                   protein_id=mCP92460.0 isoform=CRA_a"
FT                   /protein_id="EDL13425.1"
FT                   /translation="MWTVPVLFWVLGSVWFWDSAQGGTIGVNEDDIVTPGTGDGMVPPG
FT                   IEDKITTTGATGGLNESTGKAPLVWLASSHPGWNHSWRLVSHWLRRRDLHCCYEEDFWK
FT                   VLALKS"
FT   CDS             complement(join(5310799..5310813,5311577..5311688,
FT                   5319800..5319938,5342813..5342879))
FT                   /codon_start=1
FT                   /gene="Pdpn"
FT                   /locus_tag="mCG_7294"
FT                   /product="podoplanin, isoform CRA_a"
FT                   /note="gene_id=mCG7294.2 transcript_id=mCT6353.2
FT                   protein_id=mCP14212.2 isoform=CRA_a"
FT                   /protein_id="EDL13426.1"
FT                   /translation="MWTVPVLFWVLGSVWFWDSAQGGTIGVNEDDIVTPGTGDGMVPPG
FT                   IEDKITTTGATGGLNESTGKAPLVWLASSHPGWNHSWRLVSHWLRRRDLHCCYEEDFWK
FT                   VLALKS"
FT   CDS             complement(join(5310807..5310813,5311577..5311688,
FT                   5314203..5314243,5319800..5319938,5342813..5342879))
FT                   /codon_start=1
FT                   /gene="Pdpn"
FT                   /locus_tag="mCG_7294"
FT                   /product="podoplanin, isoform CRA_b"
FT                   /note="gene_id=mCG7294.2 transcript_id=mCT169600.0
FT                   protein_id=mCP92467.0 isoform=CRA_b"
FT                   /protein_id="EDL13427.1"
FT                   /translation="MWTVPVLFWVLGSVWFWDSAQGGTIGVNEDDIVTPGTGDGMVPPG
FT                   IEDKITTTGATGGLNESTGKAPLVDNAGDETQTTDKKDGLPVVTLVGIIVGVLLAIGFV
FT                   GGIFIVVMKKISGRFSP"
FT   assembly_gap    5312661..5312680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5313787..5313806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5317526..5318010
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    5321201..5321220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5330655..5330872
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    5331771..5332965
FT                   /estimated_length=1195
FT                   /gap_type="unknown"
FT   assembly_gap    5338804..5338823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5340174..5340458
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    5343324..5343343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5347679..5347698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5355236..5355276
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    5356628..5358159
FT                   /estimated_length=1532
FT                   /gap_type="unknown"
FT   assembly_gap    5359568..5360685
FT                   /estimated_length=1118
FT                   /gap_type="unknown"
FT   assembly_gap    5367776..5368083
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   gene            5393289..5414472
FT                   /locus_tag="mCG_147460"
FT                   /note="gene_id=mCG147460.0"
FT   mRNA            join(5393289..5394324,5413320..5414472)
FT                   /locus_tag="mCG_147460"
FT                   /product="mCG147460"
FT                   /note="gene_id=mCG147460.0 transcript_id=mCT187723.0
FT                   created on 13-JAN-2004"
FT   CDS             join(5393682..5394324,5413320..5413573)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147460"
FT                   /product="mCG147460"
FT                   /note="gene_id=mCG147460.0 transcript_id=mCT187723.0
FT                   protein_id=mCP108142.0"
FT                   /protein_id="EDL13428.1"
FT                   /translation="MSLCVAPRHPTGAAAALGLGSLLVLLGPGRACPAGCACTDPHTVD
FT                   CRDRGLPSVPDPFPLDVRKLLVAGNRIQQIPEDFFIFHGDLVYLDFRNNSLRSLEEGTF
FT                   SGSGKLAFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNHLAGVHEAAFESLESLQVLEL
FT                   NDNNLRSLNVAALDALPALRTVRLDGNPWLCDCDFAHLFSWIQENTSKLPKGLDAIQCS
FT                   LPMEDRRVALRELSEASFSECKFSLSLTDLFIIIFSGVAVSIAAIISSFFLATVVQCFQ
FT                   RCAPNKDTEDEDDDEDD"
FT   assembly_gap    5407752..5407771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5429948..5429967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5432647..5434086
FT                   /pseudo
FT                   /locus_tag="mCG_142209"
FT                   /note="gene_id=mCG142209.0"
FT   mRNA            join(5432647..5433526,5433623..5434086)
FT                   /pseudo
FT                   /locus_tag="mCG_142209"
FT                   /note="gene_id=mCG142209.0 transcript_id=mCT179414.0
FT                   created on 06-FEB-2003"
FT   assembly_gap    5437488..5437880
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   gene            5439678..5443399
FT                   /gene="Pramel1"
FT                   /locus_tag="mCG_62087"
FT                   /note="gene_id=mCG62087.1"
FT   mRNA            join(5439678..5440001,5440304..5440870,5441622..5443399)
FT                   /gene="Pramel1"
FT                   /locus_tag="mCG_62087"
FT                   /product="preferentially expressed antigen in melanoma-like
FT                   1"
FT                   /note="gene_id=mCG62087.1 transcript_id=mCT62270.1 created
FT                   on 28-MAY-2002"
FT   CDS             join(5439709..5440001,5440304..5440870,5441622..5442138)
FT                   /codon_start=1
FT                   /gene="Pramel1"
FT                   /locus_tag="mCG_62087"
FT                   /product="preferentially expressed antigen in melanoma-like
FT                   1"
FT                   /note="gene_id=mCG62087.1 transcript_id=mCT62270.1
FT                   protein_id=mCP29091.2"
FT                   /db_xref="GOA:Q99MW3"
FT                   /db_xref="InterPro:IPR026271"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1890541"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99MW3"
FT                   /protein_id="EDL13429.1"
FT                   /translation="MSCKTPPTLQELAENSLLKNQDLAISALDDIPSLFFPSLFKKACR
FT                   NRYVGIIKAMVQAWPFPCLPLGAMISRKTAYRRILEIILYGLDALLSQKVPHSRCKLQV
FT                   LDLRVMPLKLWNRLPVFGTAGCSENPAVVGHSGTEVKQPVKVLVDLVLKESPLDSTESF
FT                   LVQWVDNRNGLVSLCCCKLQIWAMSMYYHRKLLEILDLDSVQELRMYCISNPVCLLNFA
FT                   PYLGRMRNLRCLILSHLWQTFSMTPVEKQQVITQFTSQFLKLKCLQILHLDTVFFLEGH
FT                   LDELFWWLKTPLETLSVIDCNLSKSDWFHISEFQCTSQLKHLNLKWVKLTHLSPEPLRV
FT                   LLLKSASTLTSLDLEGCQMMDSQLSAILPALRCCTQLTKFNFHGNYISMPILRELAYNV
FT                   VKQKSQQSKIRFIPSCSHHSGLEFEAISQPHIVFVDVDRTTGEQEQVLFYAICSGEYVL
FT                   "
FT   assembly_gap    5443400..5443419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5447008..5447027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5450333..5450438
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            5455481..5462748
FT                   /gene="4732496O08Rik"
FT                   /locus_tag="mCG_18887"
FT                   /note="gene_id=mCG18887.1"
FT   mRNA            join(5455481..5456145,5458402..5458466,5459693..5460005,
FT                   5460425..5461012,5461890..5462748)
FT                   /gene="4732496O08Rik"
FT                   /locus_tag="mCG_18887"
FT                   /product="RIKEN cDNA 4732496O08, transcript variant
FT                   mCT169576"
FT                   /note="gene_id=mCG18887.1 transcript_id=mCT169576.0 created
FT                   on 28-MAY-2002"
FT   mRNA            join(5455481..5456145,5459693..5460005,5460425..5461012,
FT                   5461890..5462748)
FT                   /gene="4732496O08Rik"
FT                   /locus_tag="mCG_18887"
FT                   /product="RIKEN cDNA 4732496O08, transcript variant
FT                   mCT16080"
FT                   /note="gene_id=mCG18887.1 transcript_id=mCT16080.1 created
FT                   on 28-MAY-2002"
FT   CDS             join(5459719..5460005,5460425..5461012,5461890..5462457)
FT                   /codon_start=1
FT                   /gene="4732496O08Rik"
FT                   /locus_tag="mCG_18887"
FT                   /product="RIKEN cDNA 4732496O08, isoform CRA_a"
FT                   /note="gene_id=mCG18887.1 transcript_id=mCT16080.1
FT                   protein_id=mCP6566.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8CE24"
FT                   /db_xref="InterPro:IPR026271"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2140473"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CE24"
FT                   /protein_id="EDL13430.1"
FT                   /translation="MSVQDPPTLLQLSVQRLLRDEALAISSLQYLPRALFPLLFKEAFN
FT                   HRQTNVLRAMVAVWPFPFLPLGTLMKTPHLEILQAVLDGVDMLWTQKVLPRRRKLQVLD
FT                   LRNVYHDFWDVWVGPEDGDHSAETVCEKQIAKRLHQYALRRRLKVVTDLCLRFHLNEHQ
FT                   AYLLQWAQQRRSSIRLCCVKMQIWALPVYTVRKVLMVFQPDSIQELELNTGWSLSTLVH
FT                   FASYLDQMRNLQKLLLTRIHKNTFKVLNTSSDIQKCITKFVSQFSKLNSLQHLSMNGIY
FT                   FSSEHMKQLFRYLKTPLETLSITMCKLSHLDLNSLSQSQSLHQLKQLNLRLVKLIDLRP
FT                   VPFHDLLRSVAGTLQTLELEGCWMVDSQLTALLPALSQCSQLTRVNFYDNDISMAVLKD
FT                   LLYHTASLSQLTQELYPAPLECYDDTGDVLMGRFVQLCPELMETLITVRQPKNVSFATY
FT                   ICHECCQRCVYGLETKLCRCRQ"
FT   CDS             join(5459719..5460005,5460425..5461012,5461890..5462457)
FT                   /codon_start=1
FT                   /gene="4732496O08Rik"
FT                   /locus_tag="mCG_18887"
FT                   /product="RIKEN cDNA 4732496O08, isoform CRA_a"
FT                   /note="gene_id=mCG18887.1 transcript_id=mCT169576.0
FT                   protein_id=mCP92452.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8CE24"
FT                   /db_xref="InterPro:IPR026271"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2140473"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CE24"
FT                   /protein_id="EDL13431.1"
FT                   /translation="MSVQDPPTLLQLSVQRLLRDEALAISSLQYLPRALFPLLFKEAFN
FT                   HRQTNVLRAMVAVWPFPFLPLGTLMKTPHLEILQAVLDGVDMLWTQKVLPRRRKLQVLD
FT                   LRNVYHDFWDVWVGPEDGDHSAETVCEKQIAKRLHQYALRRRLKVVTDLCLRFHLNEHQ
FT                   AYLLQWAQQRRSSIRLCCVKMQIWALPVYTVRKVLMVFQPDSIQELELNTGWSLSTLVH
FT                   FASYLDQMRNLQKLLLTRIHKNTFKVLNTSSDIQKCITKFVSQFSKLNSLQHLSMNGIY
FT                   FSSEHMKQLFRYLKTPLETLSITMCKLSHLDLNSLSQSQSLHQLKQLNLRLVKLIDLRP
FT                   VPFHDLLRSVAGTLQTLELEGCWMVDSQLTALLPALSQCSQLTRVNFYDNDISMAVLKD
FT                   LLYHTASLSQLTQELYPAPLECYDDTGDVLMGRFVQLCPELMETLITVRQPKNVSFATY
FT                   ICHECCQRCVYGLETKLCRCRQ"
FT   gene            complement(5480228..5493215)
FT                   /gene="Oog4"
FT                   /locus_tag="mCG_117446"
FT                   /note="gene_id=mCG117446.1"
FT   mRNA            complement(join(5480228..5481098,5481715..5482299,
FT                   5482957..5483267,5483722..5483864,5493144..5493215))
FT                   /gene="Oog4"
FT                   /locus_tag="mCG_117446"
FT                   /product="oogenesin 4, transcript variant mCT118586"
FT                   /note="gene_id=mCG117446.1 transcript_id=mCT118586.1
FT                   created on 28-MAY-2002"
FT   mRNA            complement(join(5480230..5481098,5481715..5482299,
FT                   5482957..5483267,5493144..>5493195))
FT                   /gene="Oog4"
FT                   /locus_tag="mCG_117446"
FT                   /product="oogenesin 4, transcript variant mCT190698"
FT                   /note="gene_id=mCG117446.1 transcript_id=mCT190698.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(5480516..5481098,5481715..5482299,
FT                   5482957..5483267,5493144..>5493194))
FT                   /codon_start=1
FT                   /gene="Oog4"
FT                   /locus_tag="mCG_117446"
FT                   /product="oogenesin 4, isoform CRA_b"
FT                   /note="gene_id=mCG117446.1 transcript_id=mCT190698.0
FT                   protein_id=mCP111655.0 isoform=CRA_b"
FT                   /protein_id="EDL13433.1"
FT                   /translation="TAFPCLNMASCEECPPQNVSFEEDIVNINPPPALQNLAIQSLLRD
FT                   EALAISALKNLPQNLFPAIFEAAVIGGRIEILKAMIPVWPFPYLSLGKLIKNCNLETLK
FT                   AMLEGVDILLAQNDRSSRCKLRVLDLRNEYHTLWRIWGGSYEGRGLPEFMTQQQPMENC
FT                   PDCGVNKELKVTTDLNLVDGGLDESATYLLQWAQQKKDSIHLCCTMLRIHSLPKDIFRD
FT                   ILKIVNTGCIQELHLKELYTEELVFLIPYLREMNNLLTFMLSSIRETCRMDNSTRLDEE
FT                   NISRFISRLPKFHCLQNLYVNDITLLGNNLKDFLRCLGKPLETLCLTSCDLSQSDLDYL
FT                   PCCQNTSALKRLNLTATSLRGLVFHPLGVLLESVRGTLQSLELELCFMEDSQISAILPA
FT                   LSQCSHLTKVNFYDNELSLPILRQLLYHTANLSQLTYEVYPAPLECYNDMNIILTHKLE
FT                   NFCPELLDIIRANRQPNRVTFATSKCLICCGSYVYDLETQSCLYQKDLLED"
FT   CDS             complement(join(5480516..5481098,5481715..5482299,
FT                   5482957..5483081))
FT                   /codon_start=1
FT                   /gene="Oog4"
FT                   /locus_tag="mCG_117446"
FT                   /product="oogenesin 4, isoform CRA_a"
FT                   /note="gene_id=mCG117446.1 transcript_id=mCT118586.1
FT                   protein_id=mCP53283.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BHX9"
FT                   /db_xref="InterPro:IPR026271"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2684051"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BHX9"
FT                   /protein_id="EDL13432.1"
FT                   /translation="MIPVWPFPYLSLGKLIKNCNLETLKAMLEGVDILLAQNDRSSRCK
FT                   LRVLDLRNEYHTLWRIWGGSYEGRGLPEFMTQQQPMENCPDCGVNKELKVTTDLNLVDG
FT                   GLDESATYLLQWAQQKKDSIHLCCTMLRIHSLPKDIFRDILKIVNTGCIQELHLKELYT
FT                   EELVFLIPYLREMNNLLTFMLSSIRETCRMDNSTRLDEENISRFISRLPKFHCLQNLYV
FT                   NDITLLGNNLKDFLRCLGKPLETLCLTSCDLSQSDLDYLPCCQNTSALKRLNLTATSLR
FT                   GLVFHPLGVLLESVRGTLQSLELELCFMEDSQISAILPALSQCSHLTKVNFYDNELSLP
FT                   ILRQLLYHTANLSQLTYEVYPAPLECYNDMNIILTHKLENFCPELLDIIRANRQPNRVT
FT                   FATSKCLICCGSYVYDLETQSCLYQKDLLED"
FT   assembly_gap    5492120..5492237
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    5499610..5501132
FT                   /estimated_length=1523
FT                   /gap_type="unknown"
FT   gene            complement(5501161..5502841)
FT                   /pseudo
FT                   /locus_tag="mCG_18888"
FT                   /note="gene_id=mCG18888.2"
FT   mRNA            complement(5501161..5502841)
FT                   /pseudo
FT                   /locus_tag="mCG_18888"
FT                   /note="gene_id=mCG18888.2 transcript_id=mCT16081.2 created
FT                   on 28-MAY-2002"
FT   assembly_gap    5504634..5504653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5505745..5505764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5506997..5507016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5513167..5513186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5520868..5524206
FT                   /estimated_length=3339
FT                   /gap_type="unknown"
FT   assembly_gap    5536857..5536876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5538066..5538085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5546032..5548599
FT                   /pseudo
FT                   /locus_tag="mCG_117442"
FT                   /note="gene_id=mCG117442.1"
FT   mRNA            join(5546032..5546318,5546651..5547237,5548040..5548599)
FT                   /pseudo
FT                   /locus_tag="mCG_117442"
FT                   /note="gene_id=mCG117442.1 transcript_id=mCT118582.1
FT                   created on 28-MAY-2002"
FT   assembly_gap    5552488..5552507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5553557..5553576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5554668..5593884
FT                   /estimated_length=39217
FT                   /gap_type="unknown"
FT   assembly_gap    5595995..5596159
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    5599127..5599146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5601710..5601729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5603052..5603444
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    5605368..5605699
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   gene            complement(5609403..5612285)
FT                   /pseudo
FT                   /locus_tag="mCG_117445"
FT                   /note="gene_id=mCG117445.1"
FT   mRNA            complement(join(5609403..5609997,5610891..5611453,
FT                   5611985..5612285))
FT                   /pseudo
FT                   /locus_tag="mCG_117445"
FT                   /note="gene_id=mCG117445.1 transcript_id=mCT118585.1
FT                   created on 28-MAY-2002"
FT   assembly_gap    5614518..5614537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5617010..5630919
FT                   /estimated_length=13910
FT                   /gap_type="unknown"
FT   gene            5634449..5637146
FT                   /pseudo
FT                   /locus_tag="mCG_117443"
FT                   /note="gene_id=mCG117443.0"
FT   mRNA            join(5634449..5634735,5635059..5635648,5636458..5637146)
FT                   /pseudo
FT                   /locus_tag="mCG_117443"
FT                   /note="gene_id=mCG117443.0 transcript_id=mCT118583.1
FT                   created on 28-MAY-2002"
FT   assembly_gap    5659051..5659070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5663554..5664050
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    5667425..5670738
FT                   /estimated_length=3314
FT                   /gap_type="unknown"
FT   assembly_gap    5671790..5671809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5672912..5672931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5674600..5675819
FT                   /estimated_length=1220
FT                   /gap_type="unknown"
FT   gene            complement(<5675847..>5681856)
FT                   /locus_tag="mCG_117447"
FT                   /note="gene_id=mCG117447.1"
FT   mRNA            complement(join(<5675847..5675895,5676569..5677135,
FT                   5677659..5677969,5681827..>5681856))
FT                   /locus_tag="mCG_117447"
FT                   /product="mCG117447"
FT                   /note="gene_id=mCG117447.1 transcript_id=mCT118587.1
FT                   created on 28-MAY-2002"
FT   CDS             complement(join(<5675847..5675895,5676569..5677135,
FT                   5677659..5677969,5681827..5681856))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117447"
FT                   /product="mCG117447"
FT                   /note="gene_id=mCG117447.1 transcript_id=mCT118587.1
FT                   protein_id=mCP53286.1"
FT                   /protein_id="EDL13434.1"
FT                   /translation="MVICQQCPDQDDSSEEETIDVYSPPTLLKLAMHRLLREEALAISS
FT                   LKDLPNMLFPVLFEEAFIFGYTKILKAMIPEWPFPYLSIAVLIDNCNLESLKAVLEGLD
FT                   ILLAQKVHSSRCKLKEISWRDTNHDLDGIRPGSHEVEGLSEFMEQKHPNCVEKKELKVT
FT                   TELSVMNGRLNESDTYLLEWTQQRKDSIHLFCRKLVIQSLTKATVIEIFKIVNADCIPE
FT                   LELCSLCLEDLAFLNPYLRQMDNLLELTLDHITDSLSIGDSEMLEERMITLVSQLPTFP
FT                   CLQKLCINDVYFIYGNLKEFLGCLKKPLVSFCISNCEL"
FT   gene            5693866..5695264
FT                   /pseudo
FT                   /locus_tag="mCG_1029768"
FT                   /note="gene_id=mCG1029768.1"
FT   mRNA            5693866..5695264
FT                   /pseudo
FT                   /locus_tag="mCG_1029768"
FT                   /note="gene_id=mCG1029768.1 transcript_id=mCT147472.1
FT                   created on 28-MAY-2002"
XX
CO   join(AAHY01041076.1:1..1311,gap(547),AAHY01041077.1:1..1637,gap(4918),
CO   complement(AAHY01041078.1:1..844),gap(829),AAHY01041079.1:1..5534,
CO   gap(2651),AAHY01041080.1:1..943,gap(105),AAHY01041081.1:1..7570,gap(464),
CO   AAHY01041082.1:1..6115,gap(20),AAHY01041083.1:1..3267,gap(591),
CO   AAHY01041084.1:1..1404,gap(1249),AAHY01041085.1:1..7341,gap(1007),
CO   complement(AAHY01041086.1:1..1679),gap(1971),AAHY01041087.1:1..7918,
CO   gap(415),AAHY01041088.1:1..31066,gap(44),AAHY01041089.1:1..5747,gap(20),
CO   AAHY01041090.1:1..8548,gap(370),AAHY01041091.1:1..8247,gap(20),
CO   AAHY01041092.1:1..5863,gap(20),AAHY01041093.1:1..2470,gap(20),
CO   complement(AAHY01041094.1:1..1170),gap(20),
CO   complement(AAHY01041095.1:1..1101),gap(20),
CO   complement(AAHY01041096.1:1..1027),gap(587),AAHY01041097.1:1..4627,
CO   gap(153),AAHY01041098.1:1..16193,gap(571),AAHY01041099.1:1..4466,gap(798),
CO   AAHY01041100.1:1..17438,gap(171),AAHY01041101.1:1..14844,gap(20),
CO   complement(AAHY01041102.1:1..1413),gap(20),
CO   complement(AAHY01041103.1:1..3348),gap(20),
CO   complement(AAHY01041104.1:1..1032),gap(20),AAHY01041105.1:1..22027,
CO   gap(261),AAHY01041106.1:1..8310,gap(20),AAHY01041107.1:1..24507,gap(387),
CO   AAHY01041108.1:1..17541,gap(30),AAHY01041109.1:1..5510,gap(20),
CO   AAHY01041110.1:1..5507,gap(20),AAHY01041111.1:1..30769,gap(892),
CO   AAHY01041112.1:1..9452,gap(20),complement(AAHY01041113.1:1..3216),gap(144),
CO   complement(AAHY01041114.1:1..2600),gap(20),AAHY01041115.1:1..1241,gap(20),
CO   complement(AAHY01041116.1:1..1024),gap(20),AAHY01041117.1:1..1327,gap(20),
CO   AAHY01041118.1:1..2328,gap(1204),AAHY01041119.1:1..29641,gap(1313),
CO   complement(AAHY01041120.1:1..4653),gap(289),AAHY01041121.1:1..7683,
CO   gap(2679),complement(AAHY01041122.1:1..2796),gap(925),
CO   complement(AAHY01041123.1:1..1186),gap(255),AAHY01041124.1:1..4838,gap(20),
CO   complement(AAHY01041125.1:1..9125),gap(260),AAHY01041126.1:1..10341,
CO   gap(20),AAHY01041127.1:1..1616,gap(20),complement(AAHY01041128.1:1..1116),
CO   gap(1392),AAHY01041129.1:1..1221,gap(20),AAHY01041130.1:1..1794,gap(20),
CO   complement(AAHY01041131.1:1..2693),gap(20),
CO   complement(AAHY01041132.1:1..1905),gap(20),AAHY01041133.1:1..1091,
CO   gap(1749),complement(AAHY01041134.1:1..999),gap(82),
CO   AAHY01041135.1:1..13431,gap(947),AAHY01041136.1:1..6522,gap(26),
CO   AAHY01041137.1:1..9213,gap(897),AAHY01041138.1:1..5583,gap(699),
CO   complement(AAHY01041139.1:1..1367),gap(496),AAHY01041140.1:1..4062,
CO   gap(163),AAHY01041141.1:1..324,gap(43),AAHY01041142.1:1..3563,gap(20),
CO   AAHY01041143.1:1..11827,gap(2779),AAHY01041144.1:1..12442,gap(237),
CO   AAHY01041145.1:1..7032,gap(20),AAHY01041146.1:1..2576,gap(20),
CO   AAHY01041147.1:1..2154,gap(462),AAHY01041148.1:1..5418,gap(509),
CO   AAHY01041149.1:1..1632,gap(94),AAHY01041150.1:1..6819,gap(178),
CO   AAHY01041151.1:1..1745,gap(282),AAHY01041152.1:1..3771,gap(246),
CO   AAHY01041153.1:1..5925,gap(180),AAHY01041154.1:1..1493,gap(123),
CO   AAHY01041155.1:1..10881,gap(116),AAHY01041156.1:1..7434,gap(446),
CO   AAHY01041157.1:1..4337,gap(45),AAHY01041158.1:1..7286,gap(204),
CO   AAHY01041159.1:1..14543,gap(202),AAHY01041160.1:1..8144,gap(366),
CO   AAHY01041161.1:1..3573,gap(20),AAHY01041162.1:1..25846,gap(27),
CO   AAHY01041163.1:1..7019,gap(20),AAHY01041164.1:1..4621,gap(1590),
CO   AAHY01041165.1:1..8672,gap(115),AAHY01041166.1:1..10406,gap(44),
CO   AAHY01041167.1:1..5108,gap(171),AAHY01041168.1:1..9703,gap(574),
CO   AAHY01041169.1:1..667,gap(6259),AAHY01041170.1:1..1244,gap(20),
CO   complement(AAHY01041171.1:1..1042),gap(16003),
CO   complement(AAHY01041172.1:1..7051),gap(305),AAHY01041173.1:1..11527,
CO   gap(141),AAHY01041174.1:1..2532,gap(20),AAHY01041175.1:1..35541,gap(20),
CO   AAHY01041176.1:1..11502,gap(20),AAHY01041177.1:1..7229,gap(246),
CO   complement(AAHY01041178.1:1..3351),gap(106),AAHY01041179.1:1..3974,gap(71),
CO   AAHY01041180.1:1..12490,gap(20),AAHY01041181.1:1..1354,gap(20),
CO   AAHY01041182.1:1..4561,gap(20),AAHY01041183.1:1..6226,gap(44),
CO   AAHY01041184.1:1..8578,gap(20),AAHY01041185.1:1..11784,gap(56),
CO   AAHY01041186.1:1..26373,gap(20),AAHY01041187.1:1..17967,gap(139),
CO   complement(AAHY01041188.1:1..15014),gap(194),
CO   complement(AAHY01041189.1:1..10142),gap(53),AAHY01041190.1:1..29175,
CO   gap(359),AAHY01041191.1:1..4697,gap(2157),AAHY01041192.1:1..1370,gap(378),
CO   complement(AAHY01041193.1:1..11629),gap(20),AAHY01041194.1:1..49226,
CO   gap(20),AAHY01041195.1:1..32418,gap(434),AAHY01041196.1:1..12671,gap(5142),
CO   AAHY01041197.1:1..3986,gap(20),AAHY01041198.1:1..2592,gap(42),
CO   AAHY01041199.1:1..16658,gap(110),AAHY01041200.1:1..4182,gap(191),
CO   AAHY01041201.1:1..6089,gap(20),AAHY01041202.1:1..6781,gap(1333),
CO   AAHY01041203.1:1..14488,gap(146),AAHY01041204.1:1..3451,gap(20),
CO   AAHY01041205.1:1..35551,gap(20),AAHY01041206.1:1..1521,gap(20),
CO   complement(AAHY01041207.1:1..2502),gap(22),AAHY01041208.1:1..3915,gap(20),
CO   complement(AAHY01041209.1:1..9417),gap(392),
CO   complement(AAHY01041210.1:1..1922),gap(113),
CO   complement(AAHY01041211.1:1..7685),gap(236),
CO   complement(AAHY01041212.1:1..7662),gap(20),AAHY01041213.1:1..25704,gap(20),
CO   complement(AAHY01041214.1:1..52445),gap(20),
CO   complement(AAHY01041215.1:1..51388),gap(123),
CO   complement(AAHY01041216.1:1..14469),gap(198),
CO   complement(AAHY01041217.1:1..2986),gap(20),
CO   complement(AAHY01041218.1:1..2814),gap(288),
CO   complement(AAHY01041219.1:1..1388),gap(20),AAHY01041220.1:1..10414,gap(20),
CO   complement(AAHY01041221.1:1..3708),gap(20),AAHY01041222.1:1..31298,
CO   gap(323),AAHY01041223.1:1..7650,gap(20),complement(AAHY01041224.1:1..9823),
CO   gap(59),AAHY01041225.1:1..8129,gap(95),complement(AAHY01041226.1:1..29490),
CO   gap(274),complement(AAHY01041227.1:1..38622),gap(81),
CO   AAHY01041228.1:1..52273,gap(70),AAHY01041229.1:1..11753,gap(20),
CO   complement(AAHY01041230.1:1..2601),gap(20),
CO   complement(AAHY01041231.1:1..1051),gap(20),AAHY01041232.1:1..20650,gap(20),
CO   complement(AAHY01041233.1:1..4192),gap(341),
CO   complement(AAHY01041234.1:1..3742),gap(873),AAHY01041235.1:1..3499,
CO   gap(1018),AAHY01041236.1:1..1499,gap(38),AAHY01041237.1:1..2289,gap(1136),
CO   AAHY01041238.1:1..7885,gap(481),complement(AAHY01041239.1:1..1083),gap(20),
CO   complement(AAHY01041240.1:1..1135),gap(20),
CO   complement(AAHY01041241.1:1..4307),gap(186),AAHY01041242.1:1..14596,
CO   gap(1228),AAHY01041243.1:1..9560,gap(180),AAHY01041244.1:1..6796,gap(313),
CO   AAHY01041245.1:1..5455,gap(20),AAHY01041246.1:1..27661,gap(87),
CO   AAHY01041247.1:1..9953,gap(20),AAHY01041248.1:1..5856,gap(20),
CO   AAHY01041249.1:1..15464,gap(347),AAHY01041250.1:1..1041,gap(20),
CO   complement(AAHY01041251.1:1..13075),gap(20),
CO   complement(AAHY01041252.1:1..5598),gap(1010),AAHY01041253.1:1..31976,
CO   gap(49),AAHY01041254.1:1..15880,gap(40),AAHY01041255.1:1..4939,gap(138),
CO   complement(AAHY01041256.1:1..1950),gap(245),AAHY01041257.1:1..17039,
CO   gap(20),AAHY01041258.1:1..22891,gap(20),AAHY01041259.1:1..5373,gap(20),
CO   complement(AAHY01041260.1:1..1156),gap(20),AAHY01041261.1:1..1955,gap(20),
CO   complement(AAHY01041262.1:1..5194),gap(20),AAHY01041263.1:1..720,gap(20),
CO   AAHY01041264.1:1..11960,gap(551),AAHY01041265.1:1..6307,gap(144),
CO   complement(AAHY01041266.1:1..854),gap(159),AAHY01041267.1:1..774,gap(361),
CO   AAHY01041268.1:1..15926,gap(20),AAHY01041269.1:1..8648,gap(178),
CO   AAHY01041270.1:1..3640,gap(148),AAHY01041271.1:1..6099,gap(697),
CO   AAHY01041272.1:1..2119,gap(1303),AAHY01041273.1:1..11032,gap(104),
CO   AAHY01041274.1:1..23546,gap(736),AAHY01041275.1:1..2705,gap(20),
CO   AAHY01041276.1:1..5972,gap(20),AAHY01041277.1:1..6148,gap(656),
CO   AAHY01041278.1:1..1686,gap(433),AAHY01041279.1:1..2847,gap(20),
CO   AAHY01041280.1:1..6265,gap(20),AAHY01041281.1:1..10233,gap(1059),
CO   AAHY01041282.1:1..6607,gap(20),AAHY01041283.1:1..1197,gap(20),
CO   AAHY01041284.1:1..1685,gap(1198),AAHY01041285.1:1..9799,gap(843),
CO   AAHY01041286.1:1..3609,gap(104),AAHY01041287.1:1..18170,gap(139),
CO   AAHY01041288.1:1..14134,gap(180),AAHY01041289.1:1..754,gap(867),
CO   AAHY01041290.1:1..2142,gap(20),AAHY01041291.1:1..11962,gap(20),
CO   AAHY01041292.1:1..1983,gap(574),AAHY01041293.1:1..22607,gap(20),
CO   complement(AAHY01041294.1:1..5091),gap(48),AAHY01041295.1:1..2909,gap(20),
CO   AAHY01041296.1:1..34350,gap(352),AAHY01041297.1:1..13556,gap(1158),
CO   AAHY01041298.1:1..2156,gap(283),AAHY01041299.1:1..6971,gap(447),
CO   AAHY01041300.1:1..9517,gap(319),AAHY01041301.1:1..16485,gap(329),
CO   AAHY01041302.1:1..6357,gap(357),AAHY01041303.1:1..15907,gap(20),
CO   AAHY01041304.1:1..10927,gap(147),complement(AAHY01041305.1:1..687),
CO   gap(259),AAHY01041306.1:1..9149,gap(502),AAHY01041307.1:1..6099,gap(76),
CO   AAHY01041308.1:1..14912,gap(111),AAHY01041309.1:1..4818,gap(43),
CO   AAHY01041310.1:1..5281,gap(201),AAHY01041311.1:1..26699,gap(20),
CO   complement(AAHY01041312.1:1..3867),gap(20),AAHY01041313.1:1..1075,gap(20),
CO   complement(AAHY01041314.1:1..3369),gap(20),
CO   complement(AAHY01041315.1:1..1010),gap(20),
CO   complement(AAHY01041316.1:1..5496),gap(20),AAHY01041317.1:1..4844,gap(205),
CO   complement(AAHY01041318.1:1..3021),gap(235),
CO   complement(AAHY01041319.1:1..7887),gap(219),AAHY01041320.1:1..6846,
CO   gap(10039),AAHY01041321.1:1..3522,gap(20),AAHY01041322.1:1..30811,gap(20),
CO   AAHY01041323.1:1..1614,gap(1302),AAHY01041324.1:1..3259,gap(20),
CO   complement(AAHY01041325.1:1..2269),gap(363),
CO   complement(AAHY01041326.1:1..961),gap(152),
CO   complement(AAHY01041327.1:1..15110),gap(106),
CO   complement(AAHY01041328.1:1..8282),gap(188),
CO   complement(AAHY01041329.1:1..18095),gap(109),
CO   complement(AAHY01041330.1:1..11009),gap(20),
CO   complement(AAHY01041331.1:1..1089),gap(20),AAHY01041332.1:1..32590,
CO   gap(225),AAHY01041333.1:1..11696,gap(20),
CO   complement(AAHY01041334.1:1..1608),gap(20),AAHY01041335.1:1..8745,gap(20),
CO   AAHY01041336.1:1..4218,gap(240),complement(AAHY01041337.1:1..4650),
CO   gap(301),AAHY01041338.1:1..12764,gap(20),
CO   complement(AAHY01041339.1:1..8650),gap(408),AAHY01041340.1:1..4242,gap(20),
CO   AAHY01041341.1:1..21726,gap(20),AAHY01041342.1:1..728,gap(20),
CO   complement(AAHY01041343.1:1..1702),gap(20),
CO   complement(AAHY01041344.1:1..3436),gap(828),AAHY01041345.1:1..2860,gap(62),
CO   AAHY01041346.1:1..14385,gap(20),AAHY01041347.1:1..1345,gap(20),
CO   AAHY01041348.1:1..9372,gap(20),AAHY01041349.1:1..19027,gap(20),
CO   complement(AAHY01041350.1:1..4899),gap(20),AAHY01041351.1:1..1547,gap(20),
CO   AAHY01041352.1:1..4379,gap(137),AAHY01041353.1:1..6440,gap(50),
CO   complement(AAHY01041354.1:1..11156),gap(12634),AAHY01041355.1:1..1085,
CO   gap(1249),complement(AAHY01041356.1:1..4725),gap(20),
CO   complement(AAHY01041357.1:1..8147),gap(552),AAHY01041358.1:1..8841,gap(20),
CO   AAHY01041359.1:1..4811,gap(260),AAHY01041360.1:1..942,gap(443),
CO   complement(AAHY01041361.1:1..977),gap(1633),AAHY01041362.1:1..2452,
CO   gap(415),AAHY01041363.1:1..3482,gap(745),AAHY01041364.1:1..8255,gap(722),
CO   AAHY01041365.1:1..5139,gap(20),AAHY01041366.1:1..2329,gap(20),
CO   AAHY01041367.1:1..10571,gap(20),AAHY01041368.1:1..1189,gap(20),
CO   complement(AAHY01041369.1:1..1495),gap(20),AAHY01041370.1:1..1118,gap(20),
CO   AAHY01041371.1:1..3196,gap(1568),complement(AAHY01041372.1:1..911),
CO   gap(941),AAHY01041373.1:1..2837,gap(1540),
CO   complement(AAHY01041374.1:1..1066),gap(2212),AAHY01041375.1:1..2832,
CO   gap(855),AAHY01041376.1:1..4926,gap(2158),AAHY01041377.1:1..1280,gap(466),
CO   complement(AAHY01041378.1:1..2279),gap(20),AAHY01041379.1:1..1188,gap(65),
CO   complement(AAHY01041380.1:1..1524),gap(1010),AAHY01041381.1:1..1016,
CO   gap(20),complement(AAHY01041382.1:1..1991),gap(622),AAHY01041383.1:1..1391,
CO   gap(20),AAHY01041384.1:1..3982,gap(536),AAHY01041385.1:1..809,gap(613),
CO   complement(AAHY01041386.1:1..4221),gap(507),
CO   complement(AAHY01041387.1:1..2866),gap(306),AAHY01041388.1:1..2963,gap(20),
CO   AAHY01041389.1:1..7270,gap(1739),AAHY01041390.1:1..20322,gap(20),
CO   AAHY01041391.1:1..22265,gap(2147),complement(AAHY01041392.1:1..5123),
CO   gap(792),AAHY01041393.1:1..7444,gap(48),AAHY01041394.1:1..4874,gap(849),
CO   AAHY01041395.1:1..2177,gap(43),AAHY01041396.1:1..648,gap(1180),
CO   AAHY01041397.1:1..9218,gap(218),AAHY01041398.1:1..21731,gap(20),
CO   complement(AAHY01041399.1:1..3817),gap(280),AAHY01041400.1:1..3904,gap(20),
CO   AAHY01041401.1:1..2827,gap(358),AAHY01041402.1:1..28079,gap(20),
CO   AAHY01041403.1:1..1345,gap(20),complement(AAHY01041404.1:1..4063),gap(20),
CO   complement(AAHY01041405.1:1..9945),gap(20),
CO   complement(AAHY01041406.1:1..2354),gap(5636),AAHY01041407.1:1..21296,
CO   gap(1284),AAHY01041408.1:1..3225,gap(20),
CO   complement(AAHY01041409.1:1..2981),gap(20),AAHY01041410.1:1..4035,gap(493),
CO   AAHY01041411.1:1..1101,gap(20),AAHY01041412.1:1..7867,gap(20),
CO   AAHY01041413.1:1..3184,gap(5910),AAHY01041414.1:1..14441,gap(2254),
CO   AAHY01041415.1:1..11162,gap(313),AAHY01041416.1:1..10509,gap(340),
CO   AAHY01041417.1:1..2262,gap(54),complement(AAHY01041418.1:1..470),gap(106),
CO   AAHY01041419.1:1..11945,gap(20),AAHY01041420.1:1..2795,gap(20),
CO   AAHY01041421.1:1..17910,gap(20),AAHY01041422.1:1..1518,gap(29),
CO   complement(AAHY01041423.1:1..748),gap(472),AAHY01041424.1:1..1434,gap(417),
CO   AAHY01041425.1:1..900,gap(139),AAHY01041426.1:1..18210,gap(196),
CO   AAHY01041427.1:1..11201,gap(69),AAHY01041428.1:1..17022,gap(20),
CO   AAHY01041429.1:1..3839,gap(20),AAHY01041430.1:1..3191,gap(20),
CO   AAHY01041431.1:1..1799,gap(20),AAHY01041432.1:1..23459,gap(129),
CO   AAHY01041433.1:1..4369,gap(41),AAHY01041434.1:1..8439,gap(1822),
CO   AAHY01041435.1:1..6158,gap(20),AAHY01041436.1:1..2248,gap(20),
CO   AAHY01041437.1:1..1255,gap(20),AAHY01041438.1:1..1969,gap(427),
CO   complement(AAHY01041439.1:1..2738),gap(20),AAHY01041440.1:1..36194,gap(20),
CO   complement(AAHY01041441.1:1..3536),gap(20),
CO   complement(AAHY01041442.1:1..4939),gap(134),
CO   complement(AAHY01041443.1:1..19278),gap(20),
CO   complement(AAHY01041444.1:1..1457),gap(20),AAHY01041445.1:1..26123,
CO   gap(214),complement(AAHY01041446.1:1..7291),gap(20),AAHY01041447.1:1..1902,
CO   gap(20),complement(AAHY01041448.1:1..1157),gap(20),AAHY01041449.1:1..1386,
CO   gap(20),AAHY01041450.1:1..58940,gap(20),AAHY01041451.1:1..32045,gap(20),
CO   AAHY01041452.1:1..22041,gap(20),AAHY01041453.1:1..18716,gap(20),
CO   AAHY01041454.1:1..1887,gap(20),AAHY01041455.1:1..4947,gap(20),
CO   AAHY01041456.1:1..14244,gap(760),complement(AAHY01041457.1:1..27936),
CO   gap(2134),AAHY01041458.1:1..6028,gap(1957),AAHY01041459.1:1..55835,gap(20),
CO   AAHY01041460.1:1..6500,gap(20),AAHY01041461.1:1..28890,gap(20),
CO   AAHY01041462.1:1..9851,gap(257),AAHY01041463.1:1..16016,gap(3814),
CO   AAHY01041464.1:1..21797,gap(20),complement(AAHY01041465.1:1..87634),
CO   gap(20),complement(AAHY01041466.1:1..1634),gap(683),
CO   AAHY01041467.1:1..22058,gap(20),AAHY01041468.1:1..20921,gap(162),
CO   AAHY01041469.1:1..53505,gap(62),AAHY01041470.1:1..1098,gap(139),
CO   AAHY01041471.1:1..7701,gap(81),complement(AAHY01041472.1:1..10567),gap(88),
CO   AAHY01041473.1:1..2539,gap(35),AAHY01041474.1:1..3893,gap(2270),
CO   complement(AAHY01041475.1:1..5000),gap(1222),AAHY01041476.1:1..1752,
CO   gap(126),AAHY01041477.1:1..11773,gap(113),
CO   complement(AAHY01041478.1:1..14600),gap(289),
CO   complement(AAHY01041479.1:1..19971),gap(20),AAHY01041480.1:1..1249,
CO   gap(609),AAHY01041481.1:1..32291,gap(237),AAHY01041482.1:1..4574,gap(20),
CO   AAHY01041483.1:1..8950,gap(20),AAHY01041484.1:1..1172,gap(2226),
CO   AAHY01041485.1:1..8509,gap(20),complement(AAHY01041486.1:1..17954),
CO   gap(481),complement(AAHY01041487.1:1..2757),gap(2330),
CO   AAHY01041488.1:1..8307,gap(392),AAHY01041489.1:1..39659,gap(287),
CO   complement(AAHY01041490.1:1..1816),gap(204),AAHY01041491.1:1..24818,
CO   gap(610),AAHY01041492.1:1..1256,gap(668),AAHY01041493.1:1..1689,gap(20),
CO   AAHY01041494.1:1..11513,gap(20),AAHY01041495.1:1..6646,gap(204),
CO   AAHY01041496.1:1..4420,gap(20),AAHY01041497.1:1..4752,gap(579),
CO   AAHY01041498.1:1..4428,gap(20),AAHY01041499.1:1..3032,gap(51),
CO   AAHY01041500.1:1..62862,gap(380),AAHY01041501.1:1..4241,gap(20),
CO   complement(AAHY01041502.1:1..15251),gap(32),AAHY01041503.1:1..7919,
CO   gap(801),complement(AAHY01041504.1:1..23725),gap(1033),
CO   complement(AAHY01041505.1:1..3607),gap(545),AAHY01041506.1:1..35878,
CO   gap(55),AAHY01041507.1:1..2837,gap(244),AAHY01041508.1:1..4165,gap(20),
CO   AAHY01041509.1:1..28486,gap(159),AAHY01041510.1:1..1054,gap(20),
CO   complement(AAHY01041511.1:1..1542),gap(190),AAHY01041512.1:1..1124,
CO   gap(156),AAHY01041513.1:1..26575,gap(329),AAHY01041514.1:1..14673,gap(20),
CO   AAHY01041515.1:1..1736,gap(1269),complement(AAHY01041516.1:1..26405),
CO   gap(260),complement(AAHY01041517.1:1..4283),gap(20),AAHY01041518.1:1..3494,
CO   gap(237),AAHY01041519.1:1..14792,gap(98),
CO   complement(AAHY01041520.1:1..7740),gap(20),
CO   complement(AAHY01041521.1:1..12647),gap(23),
CO   complement(AAHY01041522.1:1..15043),gap(20),
CO   complement(AAHY01041523.1:1..9129),gap(118),
CO   complement(AAHY01041524.1:1..10412),gap(261),
CO   complement(AAHY01041525.1:1..44827),gap(144),
CO   complement(AAHY01041526.1:1..22565),gap(20),
CO   complement(AAHY01041527.1:1..5695),gap(87),AAHY01041528.1:1..1348,gap(163),
CO   AAHY01041529.1:1..4665,gap(277),complement(AAHY01041530.1:1..1007),
CO   gap(304),AAHY01041531.1:1..1027,gap(23),AAHY01041532.1:1..16371,gap(20),
CO   AAHY01041533.1:1..3240,gap(464),AAHY01041534.1:1..2919,gap(420),
CO   AAHY01041535.1:1..2289,gap(20),complement(AAHY01041536.1:1..3377),gap(630),
CO   complement(AAHY01041537.1:1..1230),gap(20),AAHY01041538.1:1..19576,gap(20),
CO   complement(AAHY01041539.1:1..1465),gap(20),AAHY01041540.1:1..20347,gap(20),
CO   complement(AAHY01041541.1:1..1964),gap(20),AAHY01041542.1:1..2812,gap(20),
CO   AAHY01041543.1:1..2270,gap(20),complement(AAHY01041544.1:1..6130),gap(20),
CO   AAHY01041545.1:1..3067,gap(20),complement(AAHY01041546.1:1..1006),gap(20),
CO   complement(AAHY01041547.1:1..13604),gap(798),
CO   complement(AAHY01041548.1:1..1618),gap(20),AAHY01041549.1:1..8025,gap(64),
CO   AAHY01041550.1:1..13618,gap(20),complement(AAHY01041551.1:1..8860),
CO   gap(254),complement(AAHY01041552.1:1..458),gap(20),
CO   complement(AAHY01041553.1:1..26261),gap(69),
CO   complement(AAHY01041554.1:1..19880),gap(20),AAHY01041555.1:1..10408,
CO   gap(6846),AAHY01041556.1:1..5142,gap(1259),
CO   complement(AAHY01041557.1:1..8008),gap(197),
CO   complement(AAHY01041558.1:1..11198),gap(262),AAHY01041559.1:1..2882,
CO   gap(20),AAHY01041560.1:1..18778,gap(63),AAHY01041561.1:1..18231,gap(562),
CO   AAHY01041562.1:1..1086,gap(78),AAHY01041563.1:1..17274,gap(217),
CO   AAHY01041564.1:1..2081,gap(235),AAHY01041565.1:1..49117,gap(91),
CO   AAHY01041566.1:1..7041,gap(420),AAHY01041567.1:1..3456,gap(1220),
CO   complement(AAHY01041568.1:1..1304),gap(345),AAHY01041569.1:1..23660,
CO   gap(20),AAHY01041570.1:1..10946,gap(303),AAHY01041571.1:1..17140,gap(80),
CO   AAHY01041572.1:1..5105,gap(133),AAHY01041573.1:1..24842,gap(222),
CO   complement(AAHY01041574.1:1..5993),gap(20),
CO   complement(AAHY01041575.1:1..1402),gap(20),
CO   complement(AAHY01041576.1:1..3608),gap(278),AAHY01041577.1:1..11266,
CO   gap(20),AAHY01041578.1:1..17508,gap(20),AAHY01041579.1:1..8049,gap(8125),
CO   complement(AAHY01041580.1:1..1658),gap(271),
CO   complement(AAHY01041581.1:1..14628),gap(20),AAHY01041582.1:1..19805,
CO   gap(62),complement(AAHY01041583.1:1..13343),gap(133),
CO   AAHY01041584.1:1..1200,gap(370),AAHY01041585.1:1..7032,gap(119),
CO   AAHY01041586.1:1..8248,gap(82),complement(AAHY01041587.1:1..16566),
CO   gap(340),complement(AAHY01041588.1:1..6854),gap(218),
CO   AAHY01041589.1:1..1527,gap(315),AAHY01041590.1:1..7735,gap(20),
CO   AAHY01041591.1:1..5458,gap(20),AAHY01041592.1:1..29399,gap(285),
CO   AAHY01041593.1:1..17576,gap(4597),AAHY01041594.1:1..21573,gap(20),
CO   complement(AAHY01041595.1:1..2316),gap(39),AAHY01041596.1:1..6979,gap(20),
CO   AAHY01041597.1:1..2512,gap(20),complement(AAHY01041598.1:1..2157),gap(20),
CO   AAHY01041599.1:1..13141,gap(2585),AAHY01041600.1:1..1176,gap(20),
CO   complement(AAHY01041601.1:1..1007),gap(20),
CO   complement(AAHY01041602.1:1..1135),gap(20),AAHY01041603.1:1..1192,gap(20),
CO   AAHY01041604.1:1..1598,gap(20),AAHY01041605.1:1..38326,gap(20),
CO   AAHY01041606.1:1..5692,gap(20),AAHY01041607.1:1..10213,gap(20),
CO   AAHY01041608.1:1..26496,gap(1038),AAHY01041609.1:1..1334,gap(908),
CO   AAHY01041610.1:1..8548,gap(20),AAHY01041611.1:1..1321,gap(3951),
CO   AAHY01041612.1:1..2447,gap(48),AAHY01041613.1:1..3437,gap(20),
CO   AAHY01041614.1:1..10189,gap(20),AAHY01041615.1:1..1141,gap(20),
CO   complement(AAHY01041616.1:1..7998),gap(20),
CO   complement(AAHY01041617.1:1..5674),gap(20),
CO   complement(AAHY01041618.1:1..1168),gap(20),
CO   complement(AAHY01041619.1:1..1489),gap(20),
CO   complement(AAHY01041620.1:1..4033),gap(20),
CO   complement(AAHY01041621.1:1..1106),gap(20),AAHY01041622.1:1..3719,gap(485),
CO   AAHY01041623.1:1..3190,gap(20),AAHY01041624.1:1..9434,gap(218),
CO   AAHY01041625.1:1..898,gap(1195),AAHY01041626.1:1..5838,gap(20),
CO   complement(AAHY01041627.1:1..1350),gap(285),AAHY01041628.1:1..2865,gap(20),
CO   AAHY01041629.1:1..4335,gap(20),AAHY01041630.1:1..7537,gap(41),
CO   AAHY01041631.1:1..1351,gap(1532),AAHY01041632.1:1..1408,gap(1118),
CO   AAHY01041633.1:1..7090,gap(308),AAHY01041634.1:1..39668,gap(20),
CO   AAHY01041635.1:1..22176,gap(20),AAHY01041636.1:1..7520,gap(393),
CO   complement(AAHY01041637.1:1..5519),gap(20),
CO   complement(AAHY01041638.1:1..3588),gap(20),
CO   complement(AAHY01041639.1:1..3305),gap(106),AAHY01041640.1:1..41681,
CO   gap(118),AAHY01041641.1:1..7372,gap(1523),
CO   complement(AAHY01041642.1:1..3501),gap(20),AAHY01041643.1:1..1091,gap(20),
CO   complement(AAHY01041644.1:1..1232),gap(20),AAHY01041645.1:1..6150,gap(20),
CO   AAHY01041646.1:1..7681,gap(3339),AAHY01041647.1:1..12650,gap(20),
CO   AAHY01041648.1:1..1189,gap(20),AAHY01041649.1:1..14402,gap(20),
CO   complement(AAHY01041650.1:1..1049),gap(20),AAHY01041651.1:1..1091,
CO   gap(39217),complement(AAHY01041652.1:1..2110),gap(165),
CO   AAHY01041653.1:1..2967,gap(20),AAHY01041654.1:1..2563,gap(20),
CO   AAHY01041655.1:1..1322,gap(393),complement(AAHY01041656.1:1..1923),
CO   gap(332),complement(AAHY01041657.1:1..8818),gap(20),AAHY01041658.1:1..2472,
CO   gap(13910),AAHY01041659.1:1..28131,gap(20),AAHY01041660.1:1..4483,gap(497),
CO   AAHY01041661.1:1..3374,gap(3314),complement(AAHY01041662.1:1..1051),
CO   gap(20),AAHY01041663.1:1..1102,gap(20),AAHY01041664.1:1..1668,gap(1220),
CO   AAHY01041665.1:1..27009)
//