Dbfetch

ID   CH466612; SV 1; linear; genomic DNA; CON; MUS; 6250012 BP.
XX
AC   CH466612;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009819958 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6250012
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-6250012
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; c3479e5abe61cae116a61872ad0f7833.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000227.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001750; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006456; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000010097; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024653; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024757; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024772; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024777; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024784; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024790; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024799; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024831; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024833; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024835; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024843; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024846; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024853; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024857; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024870; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024871; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024885; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024891; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024892; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024900; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024901; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024905; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024907; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024908; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024909; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024910; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024911; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024912; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024914; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024926; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024927; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024937; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024939; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024947; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024957; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024959; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024960; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032773; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034108; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038274; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038812; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040663; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041845; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045826; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047733; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047787; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049303; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050299; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053303; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054611; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056629; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059734; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060675; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061742; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067872; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067889; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069833; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071644; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071650; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071653; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071654; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071657; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000080268; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090840; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096370; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097629; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000100937; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000106695; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024621; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024623; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024624; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024625; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024626; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024630; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024632; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024633; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024638; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024643; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024644; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024650; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024651; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024657; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024658; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024660; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024662; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024663; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024664; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024666; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024670; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024671; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024674; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024675; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024676; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024682; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024685; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024687; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024693; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024694; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024696; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024699; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024706; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024708; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024709; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024710; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024712; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024714; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024718; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024719; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024724; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024725; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024734; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024742; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024743; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024745; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024749; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024754; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024755; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024757; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024759; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024765; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024769; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024772; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024774; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024775; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024776; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024778; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024784; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024794; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024797; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024798; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024802; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024803; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024805; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024807; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024814; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024817; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024819; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024821; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024827; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024828; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024829; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024588; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024590; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024591; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024592; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024593; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024597; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024599; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024600; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024606; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024609; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024610; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024616; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024617; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024623; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024624; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024626; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024628; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024629; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024630; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024632; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024636; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024637; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024640; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024641; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024642; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024648; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024651; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024653; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024659; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024660; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024662; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024665; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024670; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024672; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024674; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024675; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024676; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024678; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024680; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024684; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024685; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024690; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024691; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024700; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024708; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024709; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024711; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024715; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024720; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024721; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024723; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024725; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024731; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024735; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024738; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024740; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024741; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024743; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024745; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024751; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024761; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024764; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024765; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024770; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024771; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024773; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024775; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024782; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024785; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024787; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024789; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024795; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024796; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024797; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024559; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024561; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024562; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024563; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024564; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024568; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024570; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024571; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024577; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024582; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024583; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024590; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024596; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024597; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024599; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024601; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024602; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024603; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024605; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024609; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024610; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024612; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024613; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024614; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024615; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024621; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024624; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024626; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024632; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024633; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024635; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024638; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024643; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024645; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024647; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024648; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024649; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024651; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024653; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024657; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024658; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024663; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024664; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024673; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024681; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024682; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024684; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024688; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024693; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024694; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024696; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024698; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024704; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024708; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024711; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024713; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024714; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024716; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024718; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024724; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024734; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024737; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024738; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024745; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024746; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024748; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024750; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024757; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024760; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024762; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024764; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024770; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024771; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024772; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024586; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024588; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024589; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024590; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024591; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024595; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024597; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024598; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024604; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024609; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024610; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024616; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024617; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024623; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024624; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024626; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024628; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024629; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024630; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024632; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024636; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024637; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024640; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024641; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024642; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024648; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024651; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024653; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024659; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024660; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024662; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024665; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024672; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024674; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024675; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024676; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024678; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024680; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024684; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024685; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024690; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024691; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024700; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024705; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024706; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024708; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024709; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024711; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024715; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024720; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024721; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024723; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024725; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024731; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024735; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024738; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024740; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024741; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024743; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024745; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024751; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024761; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024764; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024765; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024770; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024771; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024773; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024775; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024782; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024785; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024787; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024789; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024795; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024796; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024797; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024355; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024357; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024358; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024359; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024360; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024364; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024366; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024367; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024372; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024377; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024378; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024384; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024385; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024391; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024392; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024394; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024396; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024397; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024398; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024400; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024404; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024405; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024408; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024409; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024410; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024416; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024419; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024421; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024427; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024428; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024430; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024433; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024438; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024440; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024442; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024443; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024444; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024446; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024448; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024452; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024453; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024458; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024459; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024468; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024473; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024476; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024477; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024479; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024483; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024488; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024489; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024491; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024493; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024499; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024503; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024506; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024508; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024509; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024511; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024513; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024519; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024528; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024531; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024532; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024536; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024537; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024539; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024541; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024548; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024551; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024553; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024555; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024561; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024562; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024563; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025034; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025036; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025037; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025038; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025039; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025043; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025045; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025046; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025052; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025057; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025058; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025065; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025071; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025072; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025074; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025076; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025077; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025078; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025080; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025083; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025084; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025086; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025087; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025088; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025089; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025095; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025100; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025106; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025107; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025109; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025112; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025117; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025119; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025121; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025122; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025123; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025125; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025127; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025131; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025132; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025137; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025138; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025147; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025152; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025154; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025155; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025157; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025161; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025166; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025167; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025169; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025171; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025177; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025181; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025184; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025186; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025187; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025189; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025191; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025197; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025207; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025210; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025211; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025217; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025218; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025220; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025222; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025229; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025232; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025234; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025236; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025242; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025244; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023827; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023829; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023830; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023831; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023832; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023836; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023838; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023839; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023844; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023849; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023850; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023857; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023863; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023864; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023866; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023869; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023870; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023872; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023876; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023877; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023879; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023880; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023881; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023882; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023888; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023891; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023893; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023899; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023900; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023902; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023905; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023910; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023912; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023914; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023915; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023916; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023918; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023920; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023924; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023925; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023930; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023932; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023940; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023948; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023949; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023951; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023955; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023960; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023961; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023963; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023965; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023971; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023975; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023977; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023981; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023983; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023985; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023991; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024001; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024004; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024005; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024009; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024010; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024012; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024014; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024021; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024024; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024026; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024028; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024034; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024035; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024036; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024325; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024327; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024328; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024329; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024330; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024334; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024336; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024337; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024343; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024348; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024349; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024355; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024356; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024362; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024363; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024365; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024367; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024368; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024369; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024371; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024375; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024376; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024379; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024380; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024381; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024390; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024392; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024398; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024399; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024402; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024405; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024410; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024412; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024414; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024415; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024416; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024418; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024420; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024424; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024425; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024430; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024431; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024440; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024448; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024449; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024451; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024455; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024460; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024461; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024463; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024465; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024471; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024475; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024478; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024480; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024481; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024483; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024485; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024491; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024501; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024504; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024505; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024510; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024511; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024513; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024515; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024522; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024525; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024527; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024529; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024535; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0024537; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024454; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024456; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024457; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024458; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024459; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024463; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024465; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024466; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024471; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024476; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024477; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024483; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024484; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024490; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024491; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024493; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024495; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024496; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024497; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024499; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024503; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024504; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024506; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024507; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024508; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024509; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024518; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024520; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024526; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024527; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024529; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024532; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024537; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024539; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024541; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024542; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024543; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024545; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024547; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024551; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024552; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024557; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024558; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024567; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024572; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024573; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024575; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024576; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024578; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024582; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024587; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024588; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024590; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024592; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024598; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024602; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024605; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024607; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024608; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024610; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024612; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024618; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024628; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024631; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024632; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024637; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024638; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024640; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024642; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024649; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024652; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024654; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024656; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024662; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0024664; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024421; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024423; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024424; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024425; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024426; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024430; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024432; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024433; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024438; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024443; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024444; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024450; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024451; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024457; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024458; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024460; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024462; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024463; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024464; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024466; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024470; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024471; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024474; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024475; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024476; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024482; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024485; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024487; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024493; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024494; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024496; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024499; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024504; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024506; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024508; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024509; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024510; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024513; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024517; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024518; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024523; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024524; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024533; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024538; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024541; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024542; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024544; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024548; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024553; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024554; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024556; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024558; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024564; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024568; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024571; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024573; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024574; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024575; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024577; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024583; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024593; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024596; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024597; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024604; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024607; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024609; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024616; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024619; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024621; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024623; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024629; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0024631; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024540; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024542; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024543; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024544; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024545; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024549; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024551; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024552; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024558; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024562; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024563; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024569; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024570; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024576; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024577; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024579; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024581; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024582; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024583; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024585; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024589; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024590; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024593; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024594; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024595; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024601; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024604; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024606; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024612; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024613; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024615; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024618; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024623; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024625; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024627; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024628; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024629; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024631; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024633; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024637; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024638; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024643; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024644; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024653; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024658; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024659; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024661; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024662; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024664; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024668; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024673; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024674; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024676; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024678; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024684; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024688; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024691; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024693; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024694; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024696; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024698; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024704; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024714; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024717; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024718; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024724; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024725; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024727; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024729; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024736; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024739; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024743; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024749; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024750; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0024751; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022785; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024451; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024453; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024454; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024455; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024456; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024460; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024462; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024463; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024469; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024473; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024474; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024480; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024481; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024487; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024488; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024490; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024492; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024493; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024494; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024496; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024500; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024501; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024503; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024504; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024505; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024506; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024512; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024515; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024517; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024523; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024524; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024526; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024529; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024536; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024538; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024539; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024540; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024543; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024547; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024548; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024553; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024554; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024563; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024568; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024570; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024571; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024573; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024577; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024582; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024583; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024585; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024587; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024593; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024597; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024600; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024602; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024603; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024605; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024607; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024613; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024623; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024626; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024627; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024631; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024632; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024634; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024636; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024643; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024646; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024648; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024656; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024657; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024658; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023392; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025082; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025084; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025085; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025086; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025087; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025091; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025093; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025094; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025100; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025104; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025105; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025111; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025112; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025118; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025119; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025121; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025123; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025124; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025125; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025127; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025131; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025132; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025134; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025135; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025136; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025137; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025143; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025146; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025148; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025154; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025155; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025157; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025160; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025165; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025167; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025169; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025170; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025171; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025173; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025175; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025179; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025180; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025185; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025186; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025195; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025200; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025202; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025203; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025205; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025209; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025214; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025215; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025217; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025219; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025225; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025229; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025232; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025234; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025235; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025237; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025239; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025245; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025255; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025258; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025259; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025266; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025267; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025269; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025271; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025278; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025281; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025283; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025285; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025291; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025293; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023573; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023576; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023577; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023578; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023582; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023584; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023585; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023591; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023595; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023596; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023602; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023603; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023609; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023610; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023612; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023614; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023615; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023616; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023618; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023622; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023623; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023625; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023626; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023627; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023628; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023634; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023637; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023639; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023645; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023646; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023648; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023651; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023656; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023658; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023660; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023661; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023662; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023664; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023666; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023670; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023671; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023676; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023678; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023686; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023694; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023695; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023697; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023701; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023706; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023707; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023709; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023711; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023717; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023721; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023723; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023726; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023727; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023729; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023731; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023737; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023747; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023750; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023751; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023754; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023755; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023757; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023759; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023766; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023769; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023771; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023773; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023779; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023781; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023890; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023892; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023893; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023894; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023895; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023899; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023901; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023902; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023907; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023911; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023912; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023918; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023919; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023925; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023926; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023928; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023930; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023931; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023932; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023934; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023938; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023939; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023942; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023943; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023944; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023950; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023953; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023955; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023961; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023962; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023964; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023967; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023974; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023976; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023977; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023978; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023980; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023982; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023986; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023987; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023992; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023994; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024002; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024008; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024010; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024011; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024013; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024017; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024022; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024023; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024025; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024027; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024033; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024037; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024040; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024042; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024043; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024045; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024047; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024053; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024063; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024066; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024067; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024071; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024072; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024074; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024076; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024083; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024086; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024088; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024090; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024096; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024098; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008893; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025695; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025698; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025713; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025760; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025764; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025834; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025842; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025847; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035444; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056888; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059295; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061086; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070878; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072055; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075606; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079327; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096251; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096253; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113423; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113451; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113500; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113504; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113526; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113825; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116563; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126070; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128694; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000136756; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145791; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159556; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159832; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164209; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165485; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174514; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174786; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178310; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178353; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178615; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202424; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202550; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202978; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209469; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050281; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050290; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050291; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050293; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050294; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050319; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050346; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050347; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050356; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050375; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050377; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050404; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050413; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050428; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050432; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050435; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050452; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050464; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050467; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050472; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050481; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050499; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050502; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050503; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050515; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050524; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050526; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050537; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050538; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050548; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050551; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050566; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050570; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050571; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050596; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050598; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050606; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050607; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050626; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050628; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050658; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050676; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050690; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050702; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050717; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050736; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050738; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050746; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050752; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050844; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050853; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050863; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050869; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050874; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050875; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050880; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050888; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050931; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050941; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050944; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050950; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050953; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050961; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050979; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051012; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051025; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051029; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051037; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051050; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051056; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051058; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050261; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050270; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050271; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050273; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050274; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050299; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050326; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050327; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050339; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050356; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050358; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050385; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050394; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050409; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050413; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050416; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050433; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050445; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050448; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050453; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050462; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050463; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050480; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050484; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050496; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050505; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050507; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050518; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050519; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050529; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050532; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050538; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050547; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050549; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050551; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050552; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050577; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050579; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050588; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050607; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050609; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050639; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050657; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050683; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050698; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050717; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050719; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050727; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050733; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050825; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050834; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050843; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050849; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050854; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050857; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050862; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050870; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050913; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050923; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050926; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050934; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050937; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050945; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050965; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0050998; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051011; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051015; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051024; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051036; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051043; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051045; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050218; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050227; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050228; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050230; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050231; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050257; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050283; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050284; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050293; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050312; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050314; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050350; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050365; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050369; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050372; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050389; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050401; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050404; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050409; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050418; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050419; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050426; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050433; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050436; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050437; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050449; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050458; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050460; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050471; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050472; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050482; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050485; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050491; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050502; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050504; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050505; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050532; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050540; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050541; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050560; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050562; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050593; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050612; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050626; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050638; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050653; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050672; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050674; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050682; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050688; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050780; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050789; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050799; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050804; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050809; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050811; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050816; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050824; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050867; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050877; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050880; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050889; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050892; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050900; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050920; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050952; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050965; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050969; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050978; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050990; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050997; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0050999; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050212; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050221; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050222; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050224; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050225; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050251; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050278; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050279; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050289; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050308; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050310; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050337; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050346; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050361; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050365; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050368; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050385; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050397; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050400; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050405; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050414; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050415; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050428; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050431; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050432; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050444; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050455; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050466; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050467; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050477; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050480; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050495; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050497; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050499; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050500; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050525; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050527; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050535; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050536; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050555; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050557; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050587; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050600; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050602; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050605; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050619; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050631; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050646; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050665; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050667; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050675; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050681; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050773; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050782; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050792; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050798; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050803; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050805; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050810; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050818; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050861; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050871; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050874; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050881; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050884; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050892; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050912; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050945; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050958; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050962; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050971; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050983; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050989; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050991; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049955; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049964; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049965; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049967; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049968; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049994; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050020; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050021; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050031; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050051; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050053; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050080; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050089; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050104; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050108; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050111; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050128; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050140; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050143; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050148; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050157; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050158; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050172; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050175; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050176; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050188; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050197; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050199; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050210; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050211; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050221; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050224; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050230; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050239; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050241; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050243; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050244; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050269; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050271; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050279; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050280; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050299; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050301; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050329; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050347; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050361; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050373; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050388; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050407; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050409; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050417; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050423; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050515; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050524; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050534; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050540; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050545; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050548; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050553; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050561; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050604; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050614; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050617; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050623; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050626; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050634; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050654; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050687; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050700; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050704; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050711; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050723; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050729; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050731; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050704; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050713; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050714; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050718; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050719; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050745; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050771; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050772; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050783; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050804; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050840; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050855; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050859; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050862; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050879; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050891; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050894; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050899; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050905; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050906; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050914; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050925; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050928; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050929; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050941; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050950; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050952; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050963; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050964; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050974; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050977; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050983; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050992; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050994; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050996; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050997; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051022; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051024; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051032; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051033; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051052; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051054; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051083; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051096; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051100; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051114; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051126; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051141; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051160; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051162; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051170; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051176; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051268; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051277; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051287; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051293; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051298; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051301; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051306; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051315; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051358; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051368; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051371; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051380; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051383; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051391; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051409; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051441; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051454; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051458; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051466; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051478; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051486; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050082; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050092; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050093; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050095; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050096; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050122; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050149; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050150; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050158; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050177; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050179; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050216; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050231; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050235; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050239; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050255; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050267; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050270; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050275; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050285; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050286; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050293; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050300; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050303; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050304; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050316; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050325; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050327; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050338; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050339; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050349; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050352; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050360; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050372; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050374; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050376; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050377; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050402; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050404; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050412; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050413; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050432; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050435; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050462; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050480; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050494; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050506; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050521; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050540; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050542; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050550; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050556; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050649; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050659; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050668; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050680; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050683; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050687; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050697; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050742; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050752; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050755; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050761; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050764; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050772; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050790; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050823; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050836; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050840; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050850; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050863; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050870; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050872; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049888; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049897; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049898; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049900; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049901; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049927; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049953; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049954; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049966; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049986; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0049988; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050015; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050024; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050039; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050043; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050046; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050064; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050076; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050079; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050084; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050093; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050094; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050106; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050109; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050110; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050131; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050133; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050144; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050145; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050156; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050159; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050165; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050174; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050176; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050178; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050179; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050204; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050206; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050214; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050215; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050234; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050236; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050266; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050284; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050310; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050325; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050344; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050346; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050354; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050360; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050452; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050461; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050471; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050477; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050482; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050484; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050489; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050497; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050540; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050550; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050553; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050562; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050565; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050573; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050593; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050626; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050639; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050643; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050652; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050664; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0050670; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049983; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049992; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049993; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049995; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0049996; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050022; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050049; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050050; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050060; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050080; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050082; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050109; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050118; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050133; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050137; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050140; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050157; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050169; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050172; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050177; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050186; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050187; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050194; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050204; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050207; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050208; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050229; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050231; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050242; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050243; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050253; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050256; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050262; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050271; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050273; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050275; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050276; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050301; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050303; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050311; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050312; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050331; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050333; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050363; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050376; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050381; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050395; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050407; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050422; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050441; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050443; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050451; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050457; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050548; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050557; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050567; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050573; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050578; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050580; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050585; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050593; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050635; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050645; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050648; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050655; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050658; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050666; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050686; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050719; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050732; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050736; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050745; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050757; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0050765; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049953; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049963; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049964; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049966; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049967; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0049993; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050019; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050020; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050028; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050047; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050049; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050076; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050085; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050100; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050104; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050107; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050124; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050136; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050139; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050144; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050153; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050154; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050171; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050174; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050175; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050187; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050196; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050198; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050209; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050220; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050223; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050229; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050238; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050240; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050242; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050243; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050269; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050277; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050278; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050297; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050299; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050328; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050341; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050346; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050360; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050387; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050406; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050408; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050416; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050422; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050514; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050533; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050539; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050544; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050545; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050550; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050558; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050601; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050611; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050614; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050624; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050627; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050635; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050653; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050686; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050699; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050703; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050711; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050723; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0050731; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050112; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050121; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050122; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050124; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050125; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050151; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050177; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050178; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050190; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050208; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050210; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050237; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050246; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050261; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050265; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050268; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050285; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050297; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050300; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050305; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050314; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050315; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050329; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050332; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050333; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050345; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050354; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050356; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050367; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050368; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050378; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050381; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050387; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050396; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050398; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050400; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050401; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050425; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050427; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050435; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050436; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050455; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050457; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050486; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050501; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050504; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050530; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050545; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050564; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050566; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050574; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050580; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050672; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050681; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050691; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050697; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050702; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050704; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050709; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050717; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050760; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050770; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050773; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050785; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050788; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050796; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050814; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050847; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050860; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050869; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050882; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050888; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0050890; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0044584; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049954; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049963; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049964; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049966; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049967; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049993; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050020; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050021; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050031; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050049; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050051; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050078; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050087; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050102; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050106; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050109; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050127; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050139; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050142; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050147; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050156; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050157; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050163; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050169; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050172; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050173; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050185; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050194; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050196; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050207; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050208; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050218; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050221; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050236; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050238; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050240; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050241; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050268; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050276; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050277; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050296; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050298; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050328; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050341; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050343; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050369; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050384; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050403; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050405; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050413; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050419; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050510; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050519; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050529; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050535; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050540; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050542; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050547; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050555; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050598; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050611; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050617; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050620; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050628; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050646; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050679; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050692; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050696; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050705; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050717; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050723; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050725; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0045390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050821; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050830; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050831; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050833; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050834; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050859; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050885; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050886; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050898; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050916; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050918; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050945; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050954; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050969; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050973; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050976; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050993; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051005; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051008; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051013; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051021; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051022; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051030; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051037; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051040; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051041; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051053; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051062; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051064; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051075; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051076; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051086; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051089; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051095; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051104; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051106; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051108; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051109; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051134; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051136; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051144; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051145; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051164; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051166; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051195; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051209; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051213; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051227; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051239; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051254; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051273; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051275; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051283; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051289; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051381; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051390; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051400; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051406; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051411; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051413; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051418; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051426; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051469; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051479; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051482; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051495; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051498; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051506; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051524; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051557; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051570; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051581; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051592; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051599; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049680; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049690; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049692; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049697; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049698; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049724; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049751; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049752; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049763; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049781; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049783; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049810; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049819; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049834; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049838; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049841; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049857; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049869; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049871; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049876; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049885; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049886; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049890; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049897; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049900; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049901; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049913; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049922; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049924; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049935; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049936; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049946; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049949; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049957; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049966; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049968; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049970; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049971; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049996; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049998; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050006; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050007; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050026; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050029; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050056; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050074; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050088; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050100; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050115; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050134; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050136; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050144; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050150; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050243; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050252; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050261; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050268; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050273; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050276; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050280; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050289; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050332; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050342; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050345; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050350; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050353; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050362; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050380; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050413; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050427; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050431; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050438; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050451; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050458; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049254; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049263; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049264; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049266; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049267; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049292; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049318; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049319; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049330; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049348; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049350; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049377; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049386; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049401; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049405; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049408; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049425; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049437; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049440; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049445; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049454; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049468; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049471; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049472; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049484; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049493; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049495; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049506; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049507; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049517; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049520; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049535; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049537; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049539; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049540; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049563; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049565; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049573; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049574; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049593; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049596; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049624; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049640; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049643; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049657; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049669; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049684; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049703; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049705; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049713; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049719; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049807; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049816; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049823; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049829; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049834; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049836; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049840; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049848; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049891; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049901; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049904; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049910; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049913; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049921; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049939; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049972; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049985; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049989; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049997; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050010; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050017; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6250012
FT                   /organism="Mus musculus"
FT                   /chromosome="19"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    2285..2304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8737..8801
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            <14479..>18684
FT                   /locus_tag="mCG_128125"
FT                   /note="gene_id=mCG128125.0"
FT   mRNA            join(<14479..14533,18320..>18684)
FT                   /locus_tag="mCG_128125"
FT                   /product="mCG128125"
FT                   /note="gene_id=mCG128125.0 transcript_id=mCT129418.0
FT                   created on 23-MAY-2002"
FT   CDS             join(14479..14533,18320..18684)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128125"
FT                   /product="mCG128125"
FT                   /note="gene_id=mCG128125.0 transcript_id=mCT129418.0
FT                   protein_id=mCP68230.0"
FT                   /protein_id="EDL32925.1"
FT                   /translation="MTMLSLAPLLSLLLLCVSDSRAETTVTQSPTSLSMATGEKVTIRC
FT                   ITSTDIDDDMNGCQQKPGDPSNLLISEGNTLRPGVPSRFSSSGYGTDFLLTIENTLSED
FT                   VADYYYLQSDIMPLTVLCPLTETCRCCQCHYISCN"
FT   gene            complement(<28759..>67091)
FT                   /locus_tag="mCG_146055"
FT                   /note="gene_id=mCG146055.0"
FT   mRNA            complement(join(<28759..28949,29479..29557,66337..66421,
FT                   66997..>67091))
FT                   /locus_tag="mCG_146055"
FT                   /product="mCG146055"
FT                   /note="gene_id=mCG146055.0 transcript_id=mCT186158.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(<28759..>28930)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146055"
FT                   /product="mCG146055"
FT                   /note="gene_id=mCG146055.0 transcript_id=mCT186158.0
FT                   protein_id=mCP107559.0"
FT                   /protein_id="EDL32926.1"
FT                   /translation="KSLASKPRGRNHCLLCEIRFEPELRHYGSTMWSTPLSPVGDTCRP
FT                   GAPSLNYLMLLH"
FT   assembly_gap    40845..40864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    44149..47351
FT                   /estimated_length=3203
FT                   /gap_type="unknown"
FT   gene            <75039..75587
FT                   /locus_tag="mCG_128129"
FT                   /note="gene_id=mCG128129.1"
FT   mRNA            <75039..75587
FT                   /locus_tag="mCG_128129"
FT                   /product="mCG128129"
FT                   /note="gene_id=mCG128129.1 transcript_id=mCT129423.1
FT                   created on 23-MAY-2002"
FT   CDS             <75039..75245
FT                   /codon_start=1
FT                   /locus_tag="mCG_128129"
FT                   /product="mCG128129"
FT                   /note="gene_id=mCG128129.1 transcript_id=mCT129423.1
FT                   protein_id=mCP68259.1"
FT                   /protein_id="EDL32927.1"
FT                   /translation="GLSAAGPLGRWAAGPLGRWAAGPLGRWAAGPGPPRVGAAHVEWRP
FT                   RRGRVQLGCGRPSPTSWRCPGWE"
FT   assembly_gap    96901..97188
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    110730..112794
FT                   /estimated_length=2065
FT                   /gap_type="unknown"
FT   assembly_gap    113501..115401
FT                   /estimated_length=1901
FT                   /gap_type="unknown"
FT   gene            118250..119690
FT                   /pseudo
FT                   /locus_tag="mCG_1045464"
FT                   /note="gene_id=mCG1045464.1"
FT   mRNA            118250..119690
FT                   /pseudo
FT                   /locus_tag="mCG_1045464"
FT                   /note="gene_id=mCG1045464.1 transcript_id=mCT163168.1
FT                   created on 23-MAY-2002"
FT   gene            complement(122955..124504)
FT                   /pseudo
FT                   /locus_tag="mCG_1045465"
FT                   /note="gene_id=mCG1045465.1"
FT   mRNA            complement(122955..124504)
FT                   /pseudo
FT                   /locus_tag="mCG_1045465"
FT                   /note="gene_id=mCG1045465.1 transcript_id=mCT163169.1
FT                   created on 23-MAY-2002"
FT   gene            complement(128514..152340)
FT                   /gene="Ighmbp2"
FT                   /locus_tag="mCG_3886"
FT                   /note="gene_id=mCG3886.1"
FT   mRNA            complement(join(128514..131073,131413..131582,
FT                   134249..135103,135774..135897,136680..136774,
FT                   137736..137854,138098..138280,140964..141138,
FT                   142326..142473,143794..143994,146194..146357,
FT                   148971..149068,149245..149434,150857..151026,
FT                   152135..152340))
FT                   /gene="Ighmbp2"
FT                   /locus_tag="mCG_3886"
FT                   /product="immunoglobulin mu binding protein 2"
FT                   /note="gene_id=mCG3886.1 transcript_id=mCT2595.0 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(130870..131073,131413..131582,
FT                   134249..135103,135774..135897,136680..136774,
FT                   137736..137854,138098..138280,140964..141138,
FT                   142326..142473,143794..143994,146194..146357,
FT                   148971..149068,149245..149434,150857..151026,
FT                   152135..152220))
FT                   /codon_start=1
FT                   /gene="Ighmbp2"
FT                   /locus_tag="mCG_3886"
FT                   /product="immunoglobulin mu binding protein 2"
FT                   /note="gene_id=mCG3886.1 transcript_id=mCT2595.0
FT                   protein_id=mCP12056.1"
FT                   /db_xref="GOA:A0A0B4J1E3"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033098"
FT                   /db_xref="MGI:MGI:99954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B4J1E3"
FT                   /protein_id="EDL32928.1"
FT                   /translation="MASSTVESFVAQQLQLLELERDAEVEERRSWQEHSSLRELQSRGV
FT                   CLLKLQVSSQRTGLYGQRLVTFEPRKFGPAVVLPSNSFTSGDIVGLYDTNENSQLATGV
FT                   LTRITQKSVTVAFDESHDLQLNLDRENTYRLLKLANDVTYKRLKKALMTLKKYHSGPAS
FT                   SLIDILLGSSTPSPAMEIPPLSFYNTTLDLSQKEAVSFALAQKELAIIHGPPGTGKTTT
FT                   VVEIILQAVKQGLKVLCCAPSNIAVDNLVERLALCKKRILRLGHPARLLESVQHHSLDA
FT                   VLARSDNAQIVADIRRDIDQVFGKNKKTQDKREKGNFRSEIKLLRKELKEREEAAIVQS
FT                   LTAADVVLATNTGASSDGPLKLLPEDYFDVVVVDECAQALEASCWIPLLKAPKCILAGD
FT                   HRQLPPTTVSHRAALAGLSRSLMERLAEKHGAGVVRMLTVQYRMHQAIMCWASEAMYHG
FT                   QLTSHPSVAGHLLKDLPGVTDTEETRVPLLLIDTAGCGLLELEEEDSQSKGNPGEVRLV
FT                   TLHIQALVDAGVQAGDIAVIAPYNLQVDLLRQSLSNKHPELEIKSVDGFQGREKEAVLL
FT                   TFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSHTVNNHAFLKTLVDYFTEHGEV
FT                   RTAFEYLDDIVPENYTHEGSQGHSRVPKPKCPSTSIRKPASDQESGQETRAAPRHGRRK
FT                   PSEKPPGSHVQSQHSSSANGSDRTGGPDRTEHFRATIEEFVASKESQLEFPTSLSSHDR
FT                   LRVHQLAEEFGLRHDSTGEGKARHITVSRRSPASSGSVAPQPSSPPSPAQAEPEPRAEE
FT                   PVTVVQAHCPVQLDLKALHLERLQRQQSSQAQTAKGQPGGDSRPQKASQKKKKKEPKGP
FT                   VMALPCEEDFDALVSAVVKADNTCSFSKCSASTTTLGQFCMHCSHRYCLSHHLPEIHGC
FT                   GEKARAHARQRISREGVLYAGSGTKDRALDPAKRAQLQRRLDKKLGELSSQRTSRKKEK
FT                   ERGT"
FT   gene            152354..162270
FT                   /locus_tag="mCG_3895"
FT                   /note="gene_id=mCG3895.1"
FT   mRNA            join(152354..152605,154193..154250,154743..154828,
FT                   156308..156471,157136..157188,158417..158520,
FT                   161869..162270)
FT                   /locus_tag="mCG_3895"
FT                   /product="mCG3895, transcript variant mCT169445"
FT                   /note="gene_id=mCG3895.1 transcript_id=mCT169445.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(152354..152605,154193..154250,154743..154828,
FT                   156308..156471,157136..157188,158417..158520,
FT                   160410..160633)
FT                   /locus_tag="mCG_3895"
FT                   /product="mCG3895, transcript variant mCT2592"
FT                   /note="gene_id=mCG3895.1 transcript_id=mCT2592.1 created on
FT                   23-MAY-2002"
FT   CDS             join(152506..152605,154193..154250,154743..154828,
FT                   156308..156471,157136..157188,158417..158520,
FT                   161869..161954)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3895"
FT                   /product="mCG3895, isoform CRA_b"
FT                   /note="gene_id=mCG3895.1 transcript_id=mCT169445.0
FT                   protein_id=mCP92424.0 isoform=CRA_b"
FT                   /protein_id="EDL32930.1"
FT                   /translation="MAAAIAASALPGAFGRLVSVCSRSILASQGSGSASLWSASRRFNS
FT                   QSASYPQGYVPKTSLSSPPWQEVVLPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVH
FT                   FASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEAT
FT                   VIEKTESWPKINMKFRKRKNFRKKKNTDPSGYLCLSACQREQFSEVGPTLHLV"
FT   CDS             join(152506..152605,154193..154250,154743..154828,
FT                   156308..156471,157136..157188,158417..158520,
FT                   160410..160474)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3895"
FT                   /product="mCG3895, isoform CRA_a"
FT                   /note="gene_id=mCG3895.1 transcript_id=mCT2592.1
FT                   protein_id=mCP11999.1 isoform=CRA_a"
FT                   /protein_id="EDL32929.1"
FT                   /translation="MAAAIAASALPGAFGRLVSVCSRSILASQGSGSASLWSASRRFNS
FT                   QSASYPQGYVPKTSLSSPPWQEVVLPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVH
FT                   FASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEAT
FT                   VIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEIAPRLL"
FT   assembly_gap    167570..168197
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    168977..169246
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    178715..178734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(186237..187038)
FT                   /pseudo
FT                   /locus_tag="mCG_49236"
FT                   /note="gene_id=mCG49236.2"
FT   mRNA            complement(186237..187038)
FT                   /pseudo
FT                   /locus_tag="mCG_49236"
FT                   /note="gene_id=mCG49236.2 transcript_id=mCT49419.2 created
FT                   on 23-MAY-2002"
FT   gene            192513..255204
FT                   /gene="Cpt1a"
FT                   /locus_tag="mCG_3883"
FT                   /note="gene_id=mCG3883.2"
FT   mRNA            join(192513..192597,218688..218841,221984..222123,
FT                   225812..225983,227671..227772,231582..231719,
FT                   233975..234052,235171..235278,235826..235913,
FT                   238351..238546,240217..240405,241082..241187,
FT                   244603..244719,245921..246085,247878..248012,
FT                   249527..249679,251144..251257,251466..251558,
FT                   253226..255204)
FT                   /gene="Cpt1a"
FT                   /locus_tag="mCG_3883"
FT                   /product="carnitine palmitoyltransferase 1a, liver,
FT                   transcript variant mCT2593"
FT                   /note="gene_id=mCG3883.2 transcript_id=mCT2593.2 created on
FT                   23-MAY-2002"
FT   mRNA            join(<192581..192608,218688..218841,221984..222123,
FT                   225812..225983,227671..227772,231582..231719,
FT                   233975..234052,235171..235278,235826..235913,
FT                   238351..238546,240217..240405,241082..241187,
FT                   244603..244719,245921..246085,247878..248012,
FT                   249527..249679,251144..251257,251466..251558,
FT                   253226..255203)
FT                   /gene="Cpt1a"
FT                   /locus_tag="mCG_3883"
FT                   /product="carnitine palmitoyltransferase 1a, liver,
FT                   transcript variant mCT193064"
FT                   /note="gene_id=mCG3883.2 transcript_id=mCT193064.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<192583..192608,218688..218841,221984..222123,
FT                   225812..225983,227671..227772,231582..231719,
FT                   233975..234052,235171..235278,235826..235913,
FT                   238351..238546,240217..240405,241082..241187,
FT                   244603..244719,245921..246085,247878..248012,
FT                   249527..249679,251144..251257,251466..251558,
FT                   253226..253312)
FT                   /codon_start=1
FT                   /gene="Cpt1a"
FT                   /locus_tag="mCG_3883"
FT                   /product="carnitine palmitoyltransferase 1a, liver, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3883.2 transcript_id=mCT193064.0
FT                   protein_id=mCP114059.0 isoform=CRA_b"
FT                   /protein_id="EDL32932.1"
FT                   /translation="FRRRRLQTRSPLKMAEAHQAVAFQFTVTPDGIDLRLSHEALKQIC
FT                   LSGLHSWKKKFIRFKNGIITGVFPASPSSWLIVVVGVISSMHTKVDPSLGMIAKINRTL
FT                   DTTGRMSSQTKNIVSGVLFGTGLWVAIIMTMRYSLKVLLSYHGWMFAEHGKMSRSTRIW
FT                   MAMVKVFSGRKPMLYSFQTSLPRLPVPAVKDTVSRYLESVRPLMKEGDFQRMTALAQDF
FT                   AVNLGPKLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPIMVNSNYYAMEMLYITPTHIQ
FT                   AARAGNTIHAILLYRRTVDREELKPIRLLGSTIPLCSAQWERLFNTSRIPGEETDTIQH
FT                   VKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELEQQMQQILDDTSEPQPGEAKLAALTAA
FT                   DRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTLDESEQGYREEDPEASIDSYAKSLLH
FT                   GRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPIVGHLWEYVMATDVFQLGYSEDGHC
FT                   KGDKNPNIPKPTRLQWDIPGECQEVIETSLSSASFLANDVDLHSFPFDTFGKGLIKKCR
FT                   TSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCNFVLAMMDP
FT                   TTTAEQRFKLFKIACEKHQHLYRLAMTGAGIDRHLFCLYVVSKYLAVDSPFLKEVLSEP
FT                   WRLSTSQTPQQQVELFDFEKYPDYVSCGGGFGPVADDGYGVSYIIVGENFIHFHISSKF
FT                   SSPETDSHRFGKHLRQAMMDIITLFGLTANSKK"
FT   assembly_gap    194720..194880
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    202041..202060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(203250..203315,218688..218841,221984..222123,
FT                   225812..225983,227671..227772,231582..231719,
FT                   233975..234052,235171..235278,235826..235913,
FT                   238351..238546,240217..240405,241082..241187,
FT                   244603..244719,245921..246085,247878..248012,
FT                   249527..249679,251144..251257,251466..251558,
FT                   253226..255204)
FT                   /gene="Cpt1a"
FT                   /locus_tag="mCG_3883"
FT                   /product="carnitine palmitoyltransferase 1a, liver,
FT                   transcript variant mCT169433"
FT                   /note="gene_id=mCG3883.2 transcript_id=mCT169433.0 created
FT                   on 23-MAY-2002"
FT   assembly_gap    211575..211640
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    216320..216339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(218701..218841,221984..222123,225812..225983,
FT                   227671..227772,231582..231719,233975..234052,
FT                   235171..235278,235826..235913,238351..238546,
FT                   240217..240405,241082..241187,244603..244719,
FT                   245921..246085,247878..248012,249527..249679,
FT                   251144..251257,251466..251558,253226..253312)
FT                   /codon_start=1
FT                   /gene="Cpt1a"
FT                   /locus_tag="mCG_3883"
FT                   /product="carnitine palmitoyltransferase 1a, liver, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3883.2 transcript_id=mCT169433.0
FT                   protein_id=mCP92437.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q7TQD5"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR032476"
FT                   /db_xref="MGI:MGI:1098296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQD5"
FT                   /protein_id="EDL32931.1"
FT                   /translation="MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIR
FT                   FKNGIITGVFPASPSSWLIVVVGVISSMHTKVDPSLGMIAKINRTLDTTGRMSSQTKNI
FT                   VSGVLFGTGLWVAIIMTMRYSLKVLLSYHGWMFAEHGKMSRSTRIWMAMVKVFSGRKPM
FT                   LYSFQTSLPRLPVPAVKDTVSRYLESVRPLMKEGDFQRMTALAQDFAVNLGPKLQWYLK
FT                   LKSWWATNYVSDWWEEYIYLRGRGPIMVNSNYYAMEMLYITPTHIQAARAGNTIHAILL
FT                   YRRTVDREELKPIRLLGSTIPLCSAQWERLFNTSRIPGEETDTIQHVKDSRHIVVYHRG
FT                   RYFKVWLYHDGRLLRPRELEQQMQQILDDTSEPQPGEAKLAALTAADRVPWAKCRQTYF
FT                   ARGKNKQSLDAVEKAAFFVTLDESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSIT
FT                   FVVFKNSKIGINAEHSWADAPIVGHLWEYVMATDVFQLGYSEDGHCKGDKNPNIPKPTR
FT                   LQWDIPGECQEVIETSLSSASFLANDVDLHSFPFDTFGKGLIKKCRTSPDAFIQLALQL
FT                   AHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCNFVLAMMDPTTTAEQRFKLFKI
FT                   ACEKHQHLYRLAMTGAGIDRHLFCLYVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQV
FT                   ELFDFEKYPDYVSCGGGFGPVADDGYGVSYIIVGENFIHFHISSKFSSPETDSHRFGKH
FT                   LRQAMMDIITLFGLTANSKK"
FT   CDS             join(218701..218841,221984..222123,225812..225983,
FT                   227671..227772,231582..231719,233975..234052,
FT                   235171..235278,235826..235913,238351..238546,
FT                   240217..240405,241082..241187,244603..244719,
FT                   245921..246085,247878..248012,249527..249679,
FT                   251144..251257,251466..251558,253226..253312)
FT                   /codon_start=1
FT                   /gene="Cpt1a"
FT                   /locus_tag="mCG_3883"
FT                   /product="carnitine palmitoyltransferase 1a, liver, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3883.2 transcript_id=mCT2593.2
FT                   protein_id=mCP11975.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q7TQD5"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="InterPro:IPR032476"
FT                   /db_xref="MGI:MGI:1098296"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQD5"
FT                   /protein_id="EDL32933.1"
FT                   /translation="MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIR
FT                   FKNGIITGVFPASPSSWLIVVVGVISSMHTKVDPSLGMIAKINRTLDTTGRMSSQTKNI
FT                   VSGVLFGTGLWVAIIMTMRYSLKVLLSYHGWMFAEHGKMSRSTRIWMAMVKVFSGRKPM
FT                   LYSFQTSLPRLPVPAVKDTVSRYLESVRPLMKEGDFQRMTALAQDFAVNLGPKLQWYLK
FT                   LKSWWATNYVSDWWEEYIYLRGRGPIMVNSNYYAMEMLYITPTHIQAARAGNTIHAILL
FT                   YRRTVDREELKPIRLLGSTIPLCSAQWERLFNTSRIPGEETDTIQHVKDSRHIVVYHRG
FT                   RYFKVWLYHDGRLLRPRELEQQMQQILDDTSEPQPGEAKLAALTAADRVPWAKCRQTYF
FT                   ARGKNKQSLDAVEKAAFFVTLDESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSIT
FT                   FVVFKNSKIGINAEHSWADAPIVGHLWEYVMATDVFQLGYSEDGHCKGDKNPNIPKPTR
FT                   LQWDIPGECQEVIETSLSSASFLANDVDLHSFPFDTFGKGLIKKCRTSPDAFIQLALQL
FT                   AHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCNFVLAMMDPTTTAEQRFKLFKI
FT                   ACEKHQHLYRLAMTGAGIDRHLFCLYVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQV
FT                   ELFDFEKYPDYVSCGGGFGPVADDGYGVSYIIVGENFIHFHISSKFSSPETDSHRFGKH
FT                   LRQAMMDIITLFGLTANSKK"
FT   assembly_gap    252412..252494
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            258354..277268
FT                   /locus_tag="mCG_3887"
FT                   /note="gene_id=mCG3887.2"
FT   mRNA            join(258354..258803,261587..261745,263411..263531,
FT                   265406..265479,266449..267654)
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, transcript variant mCT169436"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT169436.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(258386..258803,261587..261745,263411..263531,
FT                   265406..265479,266449..266540,271972..272062,
FT                   273535..273672,274419..274594,276400..277268)
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, transcript variant mCT169435"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT169435.1 created
FT                   on 07-FEB-2003"
FT   CDS             join(258420..258803,261587..261745,263411..263531,
FT                   265406..265479,266449..266540,271972..272062,
FT                   273535..273672,274419..274594,276400..276592)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, isoform CRA_d"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT169435.1
FT                   protein_id=mCP92423.1 isoform=CRA_d"
FT                   /protein_id="EDL32937.1"
FT                   /translation="MEDALLGAMTGPEDELGAELFGSERVFADGLALSPAGGAADRDEL
FT                   PVLADAYLGATEPGEPLLRALSPPPGAEVPAALLGDFPGLPELRSPDDAAPPPAYSVHV
FT                   LSSLLPGARGPALLPLSAGVRVIPVEIKEAGGSVPGGSPEDAAFQAPLAQESCCKFPSS
FT                   QEAEEASSCPRKKDSSPMVICQLKGGAQMLCIDNCGARELKALHLLPQYDDQSSFPQSE
FT                   LPKPMTTLVGRLLPVPAKLNLITQVDNGALPSAVNGAAFPSGPALQGPPKITLSGYCDC
FT                   FSSGDFCNSCSCNNLRHELERFKAIKACLDRNPEAFQPKMGKGRLGAAKLRHSKGCNCK
FT                   RSGCLKNYCECYEAKIMCSSICKCIACKNYEESPERKMLMSTPHYMEPGDFESSHYLSP
FT                   AKFSGPPKLRKNRQAFSCISWEVVEATCACLLAQGEEAEQEHCSPSLAEQMILEEFGRC
FT                   LSQILHIEFKSKGLKIE"
FT   CDS             join(258420..258803,261587..261745,263411..263531,
FT                   265406..265479,266449..266544)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, isoform CRA_a"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT169436.0
FT                   protein_id=mCP92432.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D571"
FT                   /db_xref="InterPro:IPR028307"
FT                   /db_xref="MGI:MGI:1340029"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D571"
FT                   /protein_id="EDL32934.1"
FT                   /translation="MEDALLGAMTGPEDELGAELFGSERVFADGLALSPAGGAADRDEL
FT                   PVLADAYLGATEPGEPLLRALSPPPGAEVPAALLGDFPGLPELRSPDDAAPPPAYSVHV
FT                   LSSLLPGARGPALLPLSAGVRVIPVEIKEAGGSVPGGSPEDAAFQAPLAQESCCKFPSS
FT                   QEAEEASSCPRKKDSSPMVICQLKGGAQMLCIDNCGARELKALHLLPQYDDQSSFPQSE
FT                   LPKPMTTLVGRLLPVPAKLNLITQVDNGALPSAVNGAAFPSGPALQGPPKITLSG"
FT   mRNA            join(258849..259339,261587..261745,263411..263531,
FT                   265406..265479,266449..266540,271972..272062,
FT                   273535..273672,274419..274594,276400..277268)
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, transcript variant mCT179798"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT179798.0 created
FT                   on 07-FEB-2003"
FT   mRNA            join(258849..258901,258985..259339,260544..260612,
FT                   261587..261745,263411..263531,265406..265479,
FT                   266449..266540,271972..272062,273535..273672,
FT                   274419..274594,276400..277268)
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, transcript variant mCT2596"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT2596.2 created on
FT                   07-FEB-2003"
FT   mRNA            join(<258849..259339,260544..260612,261587..261745,
FT                   263411..263531,265406..265479,266449..266540,
FT                   271972..272062,273535..273672,274419..274594,
FT                   276400..276771)
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, transcript variant mCT193070"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT193070.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<260574..260612,261587..261745,263411..263531,
FT                   265406..265479,266449..266540,271972..272062,
FT                   273535..273672,274419..274594,276400..276592)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, isoform CRA_b"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT193070.0
FT                   protein_id=mCP114060.0 isoform=CRA_b"
FT                   /protein_id="EDL32935.1"
FT                   /translation="TTARFPRQQARKSVEIKEAGGSVPGGSPEDAAFQAPLAQESCCKF
FT                   PSSQEAEEASSCPRKKDSSPMVICQLKGGAQMLCIDNCGARELKALHLLPQYDDQSSFP
FT                   QSELPKPMTTLVGRLLPVPAKLNLITQVDNGALPSAVNGAAFPSGPALQGPPKITLSGY
FT                   CDCFSSGDFCNSCSCNNLRHELERFKAIKACLDRNPEAFQPKMGKGRLGAAKLRHSKGC
FT                   NCKRSGCLKNYCECYEAKIMCSSICKCIACKNYEESPERKMLMSTPHYMEPGDFESSHY
FT                   LSPAKFSGPPKLRKNRQAFSCISWEVVEATCACLLAQGEEAEQEHCSPSLAEQMILEEF
FT                   GRCLSQILHIEFKSKGLKIE"
FT   CDS             join(261743..261745,263411..263531,265406..265479,
FT                   266449..266540,271972..272062,273535..273672,
FT                   274419..274594,276400..276592)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, isoform CRA_c"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT2596.2
FT                   protein_id=mCP12095.2 isoform=CRA_c"
FT                   /protein_id="EDL32936.1"
FT                   /translation="MVICQLKGGAQMLCIDNCGARELKALHLLPQYDDQSSFPQSELPK
FT                   PMTTLVGRLLPVPAKLNLITQVDNGALPSAVNGAAFPSGPALQGPPKITLSGYCDCFSS
FT                   GDFCNSCSCNNLRHELERFKAIKACLDRNPEAFQPKMGKGRLGAAKLRHSKGCNCKRSG
FT                   CLKNYCECYEAKIMCSSICKCIACKNYEESPERKMLMSTPHYMEPGDFESSHYLSPAKF
FT                   SGPPKLRKNRQAFSCISWEVVEATCACLLAQGEEAEQEHCSPSLAEQMILEEFGRCLSQ
FT                   ILHIEFKSKGLKIE"
FT   CDS             join(261743..261745,263411..263531,265406..265479,
FT                   266449..266540,271972..272062,273535..273672,
FT                   274419..274594,276400..276592)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3887"
FT                   /product="mCG3887, isoform CRA_c"
FT                   /note="gene_id=mCG3887.2 transcript_id=mCT179798.0
FT                   protein_id=mCP102720.0 isoform=CRA_c"
FT                   /protein_id="EDL32938.1"
FT                   /translation="MVICQLKGGAQMLCIDNCGARELKALHLLPQYDDQSSFPQSELPK
FT                   PMTTLVGRLLPVPAKLNLITQVDNGALPSAVNGAAFPSGPALQGPPKITLSGYCDCFSS
FT                   GDFCNSCSCNNLRHELERFKAIKACLDRNPEAFQPKMGKGRLGAAKLRHSKGCNCKRSG
FT                   CLKNYCECYEAKIMCSSICKCIACKNYEESPERKMLMSTPHYMEPGDFESSHYLSPAKF
FT                   SGPPKLRKNRQAFSCISWEVVEATCACLLAQGEEAEQEHCSPSLAEQMILEEFGRCLSQ
FT                   ILHIEFKSKGLKIE"
FT   gene            complement(279399..284008)
FT                   /gene="Gal"
FT                   /locus_tag="mCG_3888"
FT                   /note="gene_id=mCG3888.2"
FT   mRNA            complement(join(279399..279647,280590..280667,
FT                   281019..281108,282756..282810,283493..283573,
FT                   283775..284008))
FT                   /gene="Gal"
FT                   /locus_tag="mCG_3888"
FT                   /product="galanin, transcript variant mCT179799"
FT                   /note="gene_id=mCG3888.2 transcript_id=mCT179799.0 created
FT                   on 07-FEB-2003"
FT   mRNA            complement(join(279399..279649,280590..280667,
FT                   281019..281108,282756..282810,283493..283573,
FT                   283775..284008))
FT                   /gene="Gal"
FT                   /locus_tag="mCG_3888"
FT                   /product="galanin, transcript variant mCT2597"
FT                   /note="gene_id=mCG3888.2 transcript_id=mCT2597.2 created on
FT                   07-FEB-2003"
FT   CDS             complement(join(279526..279647,280590..280667,
FT                   281019..281108,282756..282810,283493..283573))
FT                   /codon_start=1
FT                   /gene="Gal"
FT                   /locus_tag="mCG_3888"
FT                   /product="galanin, isoform CRA_a"
FT                   /note="gene_id=mCG3888.2 transcript_id=mCT179799.0
FT                   protein_id=mCP102721.0 isoform=CRA_a"
FT                   /protein_id="EDL32939.1"
FT                   /translation="MARGSVILLGWLLLVVTLSATLGLGMPAKEKRGWTLNSAGYLLGP
FT                   HAIDNHRSFSDKHGLTGKRELQLEVEERRPGSVDVPLPESNIVRTIMEFLSFLHLKGRG
FT                   PRQPAWHPLGHLLRRPREVLRPCPLCTCVLCCNLKSF"
FT   CDS             complement(join(279579..279649,280590..280667,
FT                   281019..281108,282756..282810,283493..283573))
FT                   /codon_start=1
FT                   /gene="Gal"
FT                   /locus_tag="mCG_3888"
FT                   /product="galanin, isoform CRA_b"
FT                   /note="gene_id=mCG3888.2 transcript_id=mCT2597.2
FT                   protein_id=mCP11966.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V002"
FT                   /db_xref="InterPro:IPR008174"
FT                   /db_xref="InterPro:IPR008175"
FT                   /db_xref="InterPro:IPR013068"
FT                   /db_xref="MGI:MGI:95637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V002"
FT                   /protein_id="EDL32940.1"
FT                   /translation="MARGSVILLGWLLLVVTLSATLGLGMPAKEKRGWTLNSAGYLLGP
FT                   HAIDNHRSFSDKHGLTGKRELQLEVEERRPGSVDVPLPESNIVRTIMEFLSFLHLKEAG
FT                   ALDSLPGIPLATSSEDLEKS"
FT   assembly_gap    296321..296340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    310998..311017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    322138..322157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(324818..>445573)
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /note="gene_id=mCG3896.2"
FT   mRNA            complement(join(324818..326938,329248..329367,
FT                   334431..334581,336379..336485,337027..337180,
FT                   339527..339648,340856..340986,341864..341918,
FT                   343654..343751,354704..354789,356849..356964,
FT                   360637..360701,362229..362378,363749..363901,
FT                   366385..366514,377104..377217,381764..381876,
FT                   384485..384550,388082..388219,391571..391757,
FT                   396539..396771,413930..414077,445476..445573))
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, transcript variant
FT                   mCT169447"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT169447.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(324818..326938,329248..329367,
FT                   334431..334581,336379..336485,337027..337180,
FT                   339527..339648,340856..340986,341864..341918,
FT                   343654..343751,348149..348235,354704..354789,
FT                   356849..356964,360637..360701,362229..362378,
FT                   363749..363901,366385..366514,377104..377217,
FT                   381764..381876,384485..384550,388082..388219,
FT                   391571..391757,396539..396771,413930..414077,
FT                   445476..445573))
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, transcript variant
FT                   mCT2587"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT2587.2 created on
FT                   12-JUN-2003"
FT   mRNA            complement(join(324818..326938,329248..329367,
FT                   334431..334581,336379..336485,337027..337180,
FT                   339527..339648,340856..340986,341864..341918,
FT                   343654..343751,348149..348235,354704..354789,
FT                   356849..356964,360637..360701,362229..362378,
FT                   363749..363901,366385..366514,377104..377217,
FT                   381764..381876,384485..384550,388082..388219,
FT                   391571..391757,396539..396771,445476..445560))
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, transcript variant
FT                   mCT185568"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT185568.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(324820..326938,329248..329367,
FT                   334431..334581,336379..336485,337027..337180,
FT                   339527..339648,340856..340986,341864..341918,
FT                   343654..343700,354704..354789,356849..356964,
FT                   360637..360701,362229..362378,363749..363901,
FT                   366385..366514,377104..377217,381764..381876,
FT                   384485..384550,388082..388219,391571..391757,
FT                   396539..396771,445476..445552))
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, transcript variant
FT                   mCT169446"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT169446.1 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(326887..326938,329248..329367,
FT                   334431..334581,336379..336485,337027..337180,
FT                   339527..339648,340856..340986,341864..341918,
FT                   343654..343700,354704..354789,356849..356964,
FT                   360637..360701,362229..362378,363749..363901,
FT                   366385..366514,377104..377217,381764..381876,
FT                   384485..384550,388082..388219,391571..391757,
FT                   396539..396765))
FT                   /codon_start=1
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, isoform CRA_a"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT169446.1
FT                   protein_id=mCP92441.1 isoform=CRA_a"
FT                   /protein_id="EDL32941.1"
FT                   /translation="MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLI
FT                   EFLLKAECLEDLVSFIIEEPPQDMDEKIRYKYPNISCELLTSDVSQMNDRLGEDESLLM
FT                   KLYSFLLNESPLNPLLASFFSKVLSILISRKPEQIVDFLKKKRDFVDLIIKHIGTSAIM
FT                   DLLLRLLTCIEPPQPRQDVLNWLNEERIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLS
FT                   RDQMLQVQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLETRRP
FT                   TFEGHIEICPPGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGILDPPV
FT                   GNTRLNVIRLISSLLQTNTSSINGDLMELNSIGVILDMFFKYTWNNFLHTQVEICIALI
FT                   LASPFENAENGTITDQDSTGDNLLLKHLFQKCQLIERILEAWDTNEKKQAEGGRRHGYM
FT                   GHLTRIANCIVHSTDKGPNSALVQQLIKDLPDEVRERWETFCTNSLGETNKRNTVDLFG
FT                   FNDEKFADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDI
FT                   WEEKHIAFTPESQRRSSSGSTDSEESTDSEEEDGAKQDLFESSSANTEDKMEVDLNEPP
FT                   TWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKESLRSNS
FT                   PVEMETSTESVDPLTPGAAALATQPEAPGSMAMEASSDGEEDAESTDKVTETVMNGGMK
FT                   ETLSLTVDAKTETAVFKSEEEKLSTSQDAACKDAEETPEPAEAKCTAPLTPSSSPEQRT
FT                   DQPSMPSDPSVNGPV"
FT   CDS             complement(join(326887..326938,329248..329367,
FT                   334431..334581,336379..336485,337027..337180,
FT                   339527..339648,340856..340986,341864..341918,
FT                   343654..343751,354704..354789,356849..356964,
FT                   360637..360701,362229..362378,363749..363901,
FT                   366385..366514,377104..377217,381764..381876,
FT                   384485..384550,388082..388219,391571..391757,
FT                   396539..396765))
FT                   /codon_start=1
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, isoform CRA_b"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT169447.0
FT                   protein_id=mCP92426.0 isoform=CRA_b"
FT                   /protein_id="EDL32942.1"
FT                   /translation="MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLI
FT                   EFLLKAECLEDLVSFIIEEPPQDMDEKIRYKYPNISCELLTSDVSQMNDRLGEDESLLM
FT                   KLYSFLLNESPLNPLLASFFSKVLSILISRKPEQIVDFLKKKRDFVDLIIKHIGTSAIM
FT                   DLLLRLLTCIEPPQPRQDVLNWLNEERIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLS
FT                   RDQMLQVQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLETRRP
FT                   TFEGHIEICPPGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGILDPPV
FT                   GNTRLNVIRLISSLLQTNTSSINGDLMELNSIGVILDMFFKYTWNNFLHTQVEICIALI
FT                   LASPFENAENGTITDQDSTGDNLLLKHLFQKCQLIERILEAWDTNEKKQAEGGRRHGYM
FT                   GHLTRIANCIVHSTDKGPNSALVQQLIKDLPDEVRERWETFCTNSLGETNKRNTVDLAF
FT                   SDYQMQQMTSNFIDQFGFNDEKFADQDDIGNVSFDRVSDINFTLNTNESGNIALFEACC
FT                   KERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSSGSTDSEESTDSEEEDGAKQDLFES
FT                   SSANTEDKMEVDLNEPPTWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASF
FT                   SEFTSSLSTKESLRSNSPVEMETSTESVDPLTPGAAALATQPEAPGSMAMEASSDGEED
FT                   AESTDKVTETVMNGGMKETLSLTVDAKTETAVFKSEEEKLSTSQDAACKDAEETPEPAE
FT                   AKCTAPLTPSSSPEQRTDQPSMPSDPSVNGPV"
FT   CDS             complement(join(326887..326938,329248..329367,
FT                   334431..334581,336379..336485,337027..337180,
FT                   339527..339648,340856..340986,341864..341918,
FT                   343654..343751,348149..348235,354704..354789,
FT                   356849..356964,360637..360701,362229..362378,
FT                   363749..363901,366385..366514,377104..377217,
FT                   381764..381876,384485..384550,388082..388219,
FT                   391571..391757,396539..396765))
FT                   /codon_start=1
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, isoform CRA_c"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT185568.0
FT                   protein_id=mCP106826.0 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8R4"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1921807"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8R4"
FT                   /protein_id="EDL32943.1"
FT                   /translation="MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLI
FT                   EFLLKAECLEDLVSFIIEEPPQDMDEKIRYKYPNISCELLTSDVSQMNDRLGEDESLLM
FT                   KLYSFLLNESPLNPLLASFFSKVLSILISRKPEQIVDFLKKKRDFVDLIIKHIGTSAIM
FT                   DLLLRLLTCIEPPQPRQDVLNWLNEERIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLS
FT                   RDQMLQVQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLETRRP
FT                   TFEGHIEICPPGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGILDPPV
FT                   GNTRLNVIRLISSLLQTNTSSINGDLMELNSIGVILDMFFKYTWNNFLHTQVEICIALI
FT                   LASPFENAENGTITDQDSTGDNLLLKHLFQKCQLIERILEAWDTNEKKQAEGGRRHGYM
FT                   GHLTRIANCIVHSTDKGPNSALVQQLIKDLPDEVRERWETFCTNSLGETNKRNTVDLVT
FT                   TCHIHSSSDDEIDFKDTGFSQDSSLQQAFSDYQMQQMTSNFIDQFGFNDEKFADQDDIG
FT                   NVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQ
FT                   RRSSSGSTDSEESTDSEEEDGAKQDLFESSSANTEDKMEVDLNEPPTWSANFDVPMETT
FT                   HGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKESLRSNSPVEMETSTESVDP
FT                   LTPGAAALATQPEAPGSMAMEASSDGEEDAESTDKVTETVMNGGMKETLSLTVDAKTET
FT                   AVFKSEEEKLSTSQDAACKDAEETPEPAEAKCTAPLTPSSSPEQRTDQPSMPSDPSVNG
FT                   PV"
FT   CDS             complement(join(326887..326938,329248..329367,
FT                   334431..334581,336379..336485,337027..337180,
FT                   339527..339648,340856..340986,341864..341918,
FT                   343654..343751,348149..348235,354704..354789,
FT                   356849..356964,360637..360701,362229..362378,
FT                   363749..363901,366385..366514,377104..377217,
FT                   381764..381876,384485..384550,388082..388219,
FT                   391571..391757,396539..396765))
FT                   /codon_start=1
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, isoform CRA_c"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT2587.2
FT                   protein_id=mCP12002.2 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8R4"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1921807"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8R4"
FT                   /protein_id="EDL32945.1"
FT                   /translation="MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLI
FT                   EFLLKAECLEDLVSFIIEEPPQDMDEKIRYKYPNISCELLTSDVSQMNDRLGEDESLLM
FT                   KLYSFLLNESPLNPLLASFFSKVLSILISRKPEQIVDFLKKKRDFVDLIIKHIGTSAIM
FT                   DLLLRLLTCIEPPQPRQDVLNWLNEERIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLS
FT                   RDQMLQVQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQILLTLLETRRP
FT                   TFEGHIEICPPGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKSVMKTTWGILDPPV
FT                   GNTRLNVIRLISSLLQTNTSSINGDLMELNSIGVILDMFFKYTWNNFLHTQVEICIALI
FT                   LASPFENAENGTITDQDSTGDNLLLKHLFQKCQLIERILEAWDTNEKKQAEGGRRHGYM
FT                   GHLTRIANCIVHSTDKGPNSALVQQLIKDLPDEVRERWETFCTNSLGETNKRNTVDLVT
FT                   TCHIHSSSDDEIDFKDTGFSQDSSLQQAFSDYQMQQMTSNFIDQFGFNDEKFADQDDIG
FT                   NVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQ
FT                   RRSSSGSTDSEESTDSEEEDGAKQDLFESSSANTEDKMEVDLNEPPTWSANFDVPMETT
FT                   HGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKESLRSNSPVEMETSTESVDP
FT                   LTPGAAALATQPEAPGSMAMEASSDGEEDAESTDKVTETVMNGGMKETLSLTVDAKTET
FT                   AVFKSEEEKLSTSQDAACKDAEETPEPAEAKCTAPLTPSSSPEQRTDQPSMPSDPSVNG
FT                   PV"
FT   mRNA            complement(join(347647..348235,354704..354789,
FT                   356849..356964,360637..360701,362229..362378,
FT                   363749..363901,366385..366514,377104..377217,
FT                   381764..381876,384485..384550,388082..388219,
FT                   391571..391757,396539..396771,445476..>445573))
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, transcript variant
FT                   mCT193097"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT193097.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(348134..348235,354704..354789,
FT                   356849..356964,360637..360701,362229..362378,
FT                   363749..363901,366385..366514,377104..377217,
FT                   381764..381876,384485..384550,388082..388219,
FT                   391571..391757,396539..396771,445476..>445508))
FT                   /codon_start=1
FT                   /gene="Saps3"
FT                   /locus_tag="mCG_3896"
FT                   /product="SAPS domain family, member 3, isoform CRA_d"
FT                   /note="gene_id=mCG3896.2 transcript_id=mCT193097.0
FT                   protein_id=mCP114062.0 isoform=CRA_d"
FT                   /protein_id="EDL32944.1"
FT                   /translation="ARLTAGLGRLQNSMFWKFDLHSSSHIDTLLEREDVTLKELMDEED
FT                   VLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKYPNISCELLTSDVSQ
FT                   MNDRLGEDESLLMKLYSFLLNESPLNPLLASFFSKVLSILISRKPEQIVDFLKKKRDFV
FT                   DLIIKHIGTSAIMDLLLRLLTCIEPPQPRQDVLNWLNEERIIQRLVEIVHPSQEEDRHS
FT                   NASQSLCEIVRLSRDQMLQVQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSA
FT                   IQILLTLLETRRPTFEGHIEICPPGMSHSACSVNKSVLEAIRGRLGSFHELLLEPPKKS
FT                   VMKTTWGILDPPVGNTRLNVIRLISSLLQTNTSSINGDLMELNSIGVILDMFFKYTWNN
FT                   FLHTQVEICIALILASPFENAENGTITDQDSTGDNLLLKHLFQKCQLIERILEAWDTNE
FT                   KKQAEGGRRHGYMGHLTRIANCIVHSTDKGPNSALVQQLIKDLPDEVRERWETFCTNSL
FT                   GETNKRNTVDLVTTCHIHSSSDDEIDFKDTGFSQDSSLQQVSHT"
FT   assembly_gap    380156..380348
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   gene            <396971..398455
FT                   /locus_tag="mCG_128136"
FT                   /note="gene_id=mCG128136.1"
FT   mRNA            join(<396971..397082,397900..398455)
FT                   /locus_tag="mCG_128136"
FT                   /product="mCG128136"
FT                   /note="gene_id=mCG128136.1 transcript_id=mCT129430.1
FT                   created on 23-MAY-2002"
FT   CDS             join(<396971..397082,397900..398012)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128136"
FT                   /product="mCG128136"
FT                   /note="gene_id=mCG128136.1 transcript_id=mCT129430.1
FT                   protein_id=mCP68289.1"
FT                   /protein_id="EDL32946.1"
FT                   /translation="RDRVSHPGCPGTHSVDQAGLELRNPPASASRVLGLKAYVREFLCD
FT                   HQDSIQRPSLKKQNKLKKNVAQQEKGLAD"
FT   assembly_gap    446526..446545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    448365..448384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(456995..>565560)
FT                   /gene="Lrp5"
FT                   /locus_tag="mCG_128109"
FT                   /note="gene_id=mCG128109.1"
FT   mRNA            complement(join(456995..457451,458523..458620,
FT                   463108..463247,463750..463986,465650..465760,
FT                   469548..469784,473315..473440,474866..475075,
FT                   476666..476856,477950..478158,491541..491864,
FT                   493549..493733,494978..495204,499340..499629,
FT                   501824..502040,507626..507797,509427..509823,
FT                   526835..526966,528674..528871,531452..531649,
FT                   538376..538772,565496..>565560))
FT                   /gene="Lrp5"
FT                   /locus_tag="mCG_128109"
FT                   /product="low density lipoprotein receptor-related protein
FT                   5, transcript variant mCT179786"
FT                   /note="gene_id=mCG128109.1 transcript_id=mCT179786.0
FT                   created on 07-FEB-2003"
FT   mRNA            complement(join(456995..457451,458523..458620,
FT                   463108..463247,463750..463986,465650..465760,
FT                   469548..469784,473315..473440,474866..475075,
FT                   476666..476856,477950..478158,484912..485111,
FT                   491541..491864,493549..493733,494978..495204,
FT                   499340..499629,501824..502040,507626..507797,
FT                   509427..509823,526835..526966,528674..528871,
FT                   531452..531649,538376..538772,565496..>565560))
FT                   /gene="Lrp5"
FT                   /locus_tag="mCG_128109"
FT                   /product="low density lipoprotein receptor-related protein
FT                   5, transcript variant mCT129407"
FT                   /note="gene_id=mCG128109.1 transcript_id=mCT129407.2
FT                   created on 07-FEB-2003"
FT   CDS             complement(join(457190..457451,458523..458620,
FT                   463108..463247,463750..463986,465650..465760,
FT                   469548..469784,473315..473440,474866..475075,
FT                   476666..476856,477950..478158,484912..485111,
FT                   491541..491864,493549..493733,494978..495204,
FT                   499340..499629,501824..502040,507626..507797,
FT                   509427..509823,526835..526966,528674..>528686))
FT                   /codon_start=1
FT                   /gene="Lrp5"
FT                   /locus_tag="mCG_128109"
FT                   /product="low density lipoprotein receptor-related protein
FT                   5, isoform CRA_a"
FT                   /note="gene_id=mCG128109.1 transcript_id=mCT129407.2
FT                   protein_id=mCP68225.1 isoform=CRA_a"
FT                   /protein_id="EDL32947.1"
FT                   /translation="RQPPFHTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKT
FT                   CKTGAEEVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEV
FT                   RAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKIL
FT                   VSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDL
FT                   QEGKLYWGDAKTDKIEVINIDGTKRKTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERV
FT                   HKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCFFTPRATKCGCPIG
FT                   LELLSDMKTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHI
FT                   YWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLD
FT                   GQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRAN
FT                   DLTIDYADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLH
FT                   SIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPGGHR
FT                   CGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGLRNVKAINY
FT                   DPLDKFIYWVDGRQNIKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLFWTCE
FT                   ATNTINVHRLDGDAMGVVLRGDRDKPRAIAVNAERGYMYFTNMQDHAAKIERASLDGTE
FT                   REVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLT
FT                   VLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEFSAHPCARD
FT                   NGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACTTGEIDCIPGAWR
FT                   CDGFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQDRSDEANCDAVCLP
FT                   NQFRCTSGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIPAHSSAIGPVIGIILSL
FT                   FVMGGVYFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFIAPGGSQHGPFPGIPCSKS
FT                   VMSSMSLVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDV
FT                   FYSSGIPATARPYRPYVIRGMAPPTTPCSTDVCDSDYSISRWKSSKYYLDLNSDSDPYP
FT                   PPPTPHSQYLSAEDSCPPSPGTERSYCHLFPPPPSPCTDSS"
FT   assembly_gap    467825..468103
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    475281..475507
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   CDS             complement(join(478091..478158,491541..491864,
FT                   493549..493733,494978..495204,499340..499629,
FT                   501824..502040,507626..507797,509427..509823,
FT                   526835..526966,528674..>528686))
FT                   /codon_start=1
FT                   /gene="Lrp5"
FT                   /locus_tag="mCG_128109"
FT                   /product="low density lipoprotein receptor-related protein
FT                   5, isoform CRA_b"
FT                   /note="gene_id=mCG128109.1 transcript_id=mCT179786.0
FT                   protein_id=mCP102708.0 isoform=CRA_b"
FT                   /protein_id="EDL32948.1"
FT                   /translation="RQPPFHTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKT
FT                   CKTGAEEVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEV
FT                   RAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKIL
FT                   VSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDL
FT                   QEGKLYWGDAKTDKIEVINIDGTKRKTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERV
FT                   HKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCFFTPRATKCGCPIG
FT                   LELLSDMKTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHI
FT                   YWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLD
FT                   GQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRAN
FT                   DLTIDYADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLH
FT                   SIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPGGHR
FT                   CGCASHYTLDPSSRNCSPLHADLSQPKPEPRQTATRPQH"
FT   assembly_gap    479752..479771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    481655..481674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    483080..483099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    484121..484140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    487545..487564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    488987..491508
FT                   /estimated_length=2522
FT                   /gap_type="unknown"
FT   assembly_gap    512533..512552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    528372..528651
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    530567..530586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    532084..532103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    565561..565754
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   gene            complement(<568566..587340)
FT                   /locus_tag="mCG_1045492"
FT                   /note="gene_id=mCG1045492.0"
FT   mRNA            complement(join(<568566..569146,585805..585944,
FT                   587220..587340))
FT                   /locus_tag="mCG_1045492"
FT                   /product="mCG1045492"
FT                   /note="gene_id=mCG1045492.0 transcript_id=mCT163196.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(568566..568769)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045492"
FT                   /product="mCG1045492"
FT                   /note="gene_id=mCG1045492.0 transcript_id=mCT163196.0
FT                   protein_id=mCP68426.1"
FT                   /protein_id="EDL32949.1"
FT                   /translation="MCVVSLQEIFCPTTVCADAVVSIWQSEDNLCGSVFFPYYRSSIRP
FT                   GGKYPPSEPSHWYAIFKFGTQL"
FT   assembly_gap    569761..569780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    584000..584428
FT                   /estimated_length=429
FT                   /gap_type="unknown"
FT   gene            587483..597040
FT                   /gene="1810055G02Rik"
FT                   /locus_tag="mCG_3898"
FT                   /note="gene_id=mCG3898.2"
FT   mRNA            join(587483..587595,593563..593784,594797..594961,
FT                   595650..597040)
FT                   /gene="1810055G02Rik"
FT                   /locus_tag="mCG_3898"
FT                   /product="RIKEN cDNA 1810055G02, transcript variant
FT                   mCT2584"
FT                   /note="gene_id=mCG3898.2 transcript_id=mCT2584.2 created on
FT                   23-MAY-2002"
FT   mRNA            join(<587570..587667,593563..593784,594797..594961,
FT                   595650..597039)
FT                   /gene="1810055G02Rik"
FT                   /locus_tag="mCG_3898"
FT                   /product="RIKEN cDNA 1810055G02, transcript variant
FT                   mCT193100"
FT                   /note="gene_id=mCG3898.2 transcript_id=mCT193100.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<593772..593784,594797..594961,595650..596752)
FT                   /codon_start=1
FT                   /gene="1810055G02Rik"
FT                   /locus_tag="mCG_3898"
FT                   /product="RIKEN cDNA 1810055G02, isoform CRA_a"
FT                   /note="gene_id=mCG3898.2 transcript_id=mCT193100.0
FT                   protein_id=mCP114074.0 isoform=CRA_a"
FT                   /protein_id="EDL32950.1"
FT                   /translation="AAVADPWAEQKAIADSLKGCLAKTLSPASNSPSKMWTALVLVWIS
FT                   SVLLPRSHMMSAEPRNIVTNKWPKAVNQSMLRDTVPRTDNTFTERTAIVPPAPVTLTTE
FT                   TWAATLNSTRVTAEVTTHGTNTSTPTTREGTTDRVTSRTLAVPTSSGPSSAEQTRPTTI
FT                   AGLPSLSTPHAEVPRTNASVSPRTAMAATVAPHTATLAAGTVNTSDPHTRTPSPAKSTP
FT                   TDTSSKNPIPTSGAQIQGTTVQLTTDQPVHSTAGRSALSPSNATLEPTTTQVQTKEPSA
FT                   STVPARATSLSPDVDVISPTTQPSPTLPTQGTGGPGTLLTTEQVGTKTTSGTASAGPTS
FT                   RSSGDIKVPTTDSCQPSTQGQYLVTIDALTPSLVNKMLLLVVLLVGVTLFIAVLVMFAL
FT                   QAYESYKKKDYTQVDYLINGMYADSEM"
FT   CDS             join(594886..594961,595650..596752)
FT                   /codon_start=1
FT                   /gene="1810055G02Rik"
FT                   /locus_tag="mCG_3898"
FT                   /product="RIKEN cDNA 1810055G02, isoform CRA_b"
FT                   /note="gene_id=mCG3898.2 transcript_id=mCT2584.2
FT                   protein_id=mCP12058.2 isoform=CRA_b"
FT                   /protein_id="EDL32951.1"
FT                   /translation="MWTALVLVWISSVLLPRSHMMSAEPRNIVTNKWPKAVNQSMLRDT
FT                   VPRTDNTFTERTAIVPPAPVTLTTETWAATLNSTRVTAEVTTHGTNTSTPTTREGTTDR
FT                   VTSRTLAVPTSSGPSSAEQTRPTTIAGLPSLSTPHAEVPRTNASVSPRTAMAATVAPHT
FT                   ATLAAGTVNTSDPHTRTPSPAKSTPTDTSSKNPIPTSGAQIQGTTVQLTTDQPVHSTAG
FT                   RSALSPSNATLEPTTTQVQTKEPSASTVPARATSLSPDVDVISPTTQPSPTLPTQGTGG
FT                   PGTLLTTEQVGTKTTSGTASAGPTSRSSGDIKVPTTDSCQPSTQGQYLVTIDALTPSLV
FT                   NKMLLLVVLLVGVTLFIAVLVMFALQAYESYKKKDYTQVDYLINGMYADSEM"
FT   assembly_gap    599144..599163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(609637..610176)
FT                   /pseudo
FT                   /locus_tag="mCG_128140"
FT                   /note="gene_id=mCG128140.1"
FT   mRNA            complement(609637..610176)
FT                   /pseudo
FT                   /locus_tag="mCG_128140"
FT                   /note="gene_id=mCG128140.1 transcript_id=mCT129434.1
FT                   created on 24-MAY-2002"
FT   assembly_gap    639494..639513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <646535..697352
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /note="gene_id=mCG3882.3"
FT   mRNA            join(<646535..646845,647137..647455,661335..661394,
FT                   665508..665746,672199..672346,681124..681289,
FT                   681837..681946,683444..683627,683966..684102,
FT                   686274..686470,693164..695440)
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /product="suppressor of variegation 4-20 homolog 1
FT                   (Drosophila), transcript variant mCT193062"
FT                   /note="gene_id=mCG3882.3 transcript_id=mCT193062.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(646541..646855,647137..647455,665508..665746,
FT                   672199..672346,675771..675839,681124..681289,
FT                   681837..681946,683444..683610,683863..683882,
FT                   683966..684102,686274..686470,693164..697351)
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /product="suppressor of variegation 4-20 homolog 1
FT                   (Drosophila), transcript variant mCT2602"
FT                   /note="gene_id=mCG3882.3 transcript_id=mCT2602.2 created on
FT                   24-MAY-2002"
FT   mRNA            join(646576..646845,647137..647455,665508..665746,
FT                   672199..672346,681124..681289,681837..681946,
FT                   683444..683610,683863..683882,683966..684102,
FT                   686274..686470,693164..697352)
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /product="suppressor of variegation 4-20 homolog 1
FT                   (Drosophila), transcript variant mCT169432"
FT                   /note="gene_id=mCG3882.3 transcript_id=mCT169432.0 created
FT                   on 24-MAY-2002"
FT   mRNA            join(<647146..647455,665508..665746,672199..672346,
FT                   675771..675839,681124..681289,681837..681946,
FT                   683444..683627,683966..684102,686274..687878)
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /product="suppressor of variegation 4-20 homolog 1
FT                   (Drosophila), transcript variant mCT193063"
FT                   /note="gene_id=mCG3882.3 transcript_id=mCT193063.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<665521..665746,672199..672346,681124..681289,
FT                   681837..681946,683444..683627,683966..684102,
FT                   686274..686470,693164..694638)
FT                   /codon_start=1
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /product="suppressor of variegation 4-20 homolog 1
FT                   (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG3882.3 transcript_id=mCT193062.0
FT                   protein_id=mCP114057.0 isoform=CRA_b"
FT                   /protein_id="EDL32953.1"
FT                   /translation="NYSLSYLKRVTKCSWVRLSVGMKWLGDSKNMVVNGRRNGGKLSND
FT                   HQQNQSKLQQHSGKDTLKTGRNAVERRSSRCHGNSGFEGQSRYVPSSGMSAKELCENDD
FT                   LATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWAR
FT                   HYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDK
FT                   IELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHGKLPSEFVS
FT                   TGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPA
FT                   PVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKDNATSNRKSSVGV
FT                   KKSSKSRALTRPSMPRVPAASNSTSPKLVHTNNPRVPKKLRKPAKPLLSKIRLRNHCKR
FT                   LDQKSASRKLEMGSLVLKEPKVVLYKNLPIKKEREPEGPAHAAVGSGCLTRHAAREHRQ
FT                   NHGRGAHSQGDSLPCTYTTRRSLRTRTGLKETTDIKLEPSPLDGYKNGILEPCPDSGQQ
FT                   PTPEVLEELAPETAHREEASQECPKNDSCLSRKKFRQVKPVKHLAKTEDCSPEHSFPGK
FT                   DGLPDLPGSHPDQGEPSGTVRVPVSHTDSAPSPVGCSVVAPDSFTKDSFRTAQSKKKRR
FT                   VTRYDAQLILENSSGIPKLTLRRRHDSSSKTNDHESDGVNSSKISIKLSKDHDSDSNLY
FT                   VAKLSNGVSAGPGSSSTKLKIQLKRDEESRGPCAEGLHENGVCCSDPLSLLESQMEVDD
FT                   YSQYEEDSTDESSSSEGEEEEEDCEDDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRR
FT                   EDQSLRLNA"
FT   CDS             join(<665521..665746,672199..672346,675771..675839,
FT                   681124..681289,681837..681946,683444..683627,
FT                   683966..684102,686274..686478)
FT                   /codon_start=1
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /product="suppressor of variegation 4-20 homolog 1
FT                   (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG3882.3 transcript_id=mCT193063.0
FT                   protein_id=mCP114058.0 isoform=CRA_c"
FT                   /protein_id="EDL32954.1"
FT                   /translation="NYSLSYLKRVTKCSWVRLSVGMKWLGDSKNMVVNGRRNGGKLSND
FT                   HQQNQSKLQQHSGKDTLKTGRNAVERRSSRCHGNSGFEGQSRYVPSSGMSAKELCENDD
FT                   LATSLVLDPYLGFQTHKMNTSAFPSRSSRHISKADSFSHNNPVRFRPIKGRQEELKEVI
FT                   ERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPC
FT                   NRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKN
FT                   CAQLWLGPAAFINHGKLPSEFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
FT                   ECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSS
FT                   NTDADTTQEKDNASK"
FT   CDS             join(665584..665746,672199..672346,675771..675839,
FT                   681124..681289,681837..681946,683444..683610,
FT                   683863..683882,683966..684102,686274..686470,
FT                   693164..694638)
FT                   /codon_start=1
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /product="suppressor of variegation 4-20 homolog 1
FT                   (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG3882.3 transcript_id=mCT2602.2
FT                   protein_id=mCP12089.2 isoform=CRA_d"
FT                   /protein_id="EDL32955.1"
FT                   /translation="MKWLGDSKNMVVNGRRNGGKLSNDHQQNQSKLQQHSGKDTLKTGR
FT                   NAVERRSSRCHGNSGFEGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTS
FT                   AFPSRSSRHISKADSFSHNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEW
FT                   ARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRN
FT                   DKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCK
FT                   FVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLP
FT                   APAPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKDNATSNRKSS
FT                   VGVKKSSKSRALTRPSMPRVPAASNSTSPKLVHTNNPRVPKKLRKPAKPLLSKIRLRNH
FT                   CKRLDQKSASRKLEMGSLVLKEPKVVLYKNLPIKKEREPEGPAHAAVGSGCLTRHAARE
FT                   HRQNHGRGAHSQGDSLPCTYTTRRSLRTRTGLKETTDIKLEPSPLDGYKNGILEPCPDS
FT                   GQQPTPEVLEELAPETAHREEASQECPKNDSCLSRKKFRQVKPVKHLAKTEDCSPEHSF
FT                   PGKDGLPDLPGSHPDQGEPSGTVRVPVSHTDSAPSPVGCSVVAPDSFTKDSFRTAQSKK
FT                   KRRVTRYDAQLILENSSGIPKLTLRRRHDSSSKTNDHESDGVNSSKISIKLSKDHDSDS
FT                   NLYVAKLSNGVSAGPGSSSTKLKIQLKRDEESRGPCAEGLHENGVCCSDPLSLLESQME
FT                   VDDYSQYEEDSTDESSSSEGEEEEEDCEDDFDDDFIPLPPAKRLRLIVGKDSIDIDISS
FT                   RRREDQSLRLNA"
FT   CDS             join(665584..665746,672199..672346,681124..681289,
FT                   681837..681946,683444..683610,683863..683882,
FT                   683966..684102,686274..686470,693164..694638)
FT                   /codon_start=1
FT                   /gene="Suv420h1"
FT                   /locus_tag="mCG_3882"
FT                   /product="suppressor of variegation 4-20 homolog 1
FT                   (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG3882.3 transcript_id=mCT169432.0
FT                   protein_id=mCP92428.0 isoform=CRA_a"
FT                   /protein_id="EDL32952.1"
FT                   /translation="MKWLGDSKNMVVNGRRNGGKLSNDHQQNQSKLQQHSGKDTLKTGR
FT                   NAVERRSSRCHGNSGFEGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTR
FT                   FRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIY
FT                   LRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEENMLLR
FT                   HGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEI
FT                   SCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNRLK
FT                   KLGDSSKNSDSQSVSSNTDADTTQEKDNATSNRKSSVGVKKSSKSRALTRPSMPRVPAA
FT                   SNSTSPKLVHTNNPRVPKKLRKPAKPLLSKIRLRNHCKRLDQKSASRKLEMGSLVLKEP
FT                   KVVLYKNLPIKKEREPEGPAHAAVGSGCLTRHAAREHRQNHGRGAHSQGDSLPCTYTTR
FT                   RSLRTRTGLKETTDIKLEPSPLDGYKNGILEPCPDSGQQPTPEVLEELAPETAHREEAS
FT                   QECPKNDSCLSRKKFRQVKPVKHLAKTEDCSPEHSFPGKDGLPDLPGSHPDQGEPSGTV
FT                   RVPVSHTDSAPSPVGCSVVAPDSFTKDSFRTAQSKKKRRVTRYDAQLILENSSGIPKLT
FT                   LRRRHDSSSKTNDHESDGVNSSKISIKLSKDHDSDSNLYVAKLSNGVSAGPGSSSTKLK
FT                   IQLKRDEESRGPCAEGLHENGVCCSDPLSLLESQMEVDDYSQYEEDSTDESSSSEGEEE
FT                   EEDCEDDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA"
FT   assembly_gap    666571..666590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    678969..679839
FT                   /estimated_length=871
FT                   /gap_type="unknown"
FT   assembly_gap    701225..701244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(701405..702027)
FT                   /pseudo
FT                   /locus_tag="mCG_48854"
FT                   /note="gene_id=mCG48854.2"
FT   mRNA            complement(701405..702027)
FT                   /pseudo
FT                   /locus_tag="mCG_48854"
FT                   /note="gene_id=mCG48854.2 transcript_id=mCT49037.2 created
FT                   on 24-MAY-2002"
FT   assembly_gap    704586..704605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    707370..707824
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    722063..722102
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    730992..731166
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    732164..732183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <732184..774742
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /note="gene_id=mCG3892.3"
FT   mRNA            join(<732184..732760,745025..745136,764847..764960,
FT                   766235..766368,766737..766841,767764..767822,
FT                   769398..769485,770255..772588,773085..773166,
FT                   773723..774742)
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, transcript variant
FT                   mCT193093"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT193093.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(732184..732760,745025..745136,764847..764960,
FT                   766235..766368,766737..766841,767764..767822,
FT                   769398..769485,770255..770363,772482..772588,
FT                   773085..773166,773723..774742)
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, transcript variant mCT2589"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT2589.2 created on
FT                   12-JUN-2003"
FT   mRNA            join(732184..732760,745025..745136,751376..751435,
FT                   756108..756161,764847..764960,766235..766368,
FT                   766737..766841,767764..767822,769398..769485,
FT                   770255..770363,772482..772588,773085..773166,
FT                   773723..774740)
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, transcript variant
FT                   mCT169439"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT169439.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(732184..732760,745025..745136,756108..756161,
FT                   764847..764960,766235..766368,766737..766841,
FT                   767764..767822,769398..769485,770255..770363,
FT                   772482..772588,773085..773166,773723..774740)
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, transcript variant
FT                   mCT169437"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT169437.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(732184..732760,745025..745136,762383..762493,
FT                   764847..764960,766235..766368,766737..766841,
FT                   767764..767822,769398..769485,770255..770363,
FT                   772482..772588,773085..773166,773723..774740)
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, transcript variant
FT                   mCT185566"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT185566.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(732184..732760,756110..756161,764847..764960,
FT                   766235..766368,766737..766841,767764..767822,
FT                   769398..769485,770255..770363,772482..772588,
FT                   773085..773166,773723..774740)
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, transcript variant
FT                   mCT169440"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT169440.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(732184..732760,745025..745136,756108..758987)
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, transcript variant
FT                   mCT185567"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT185567.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(732184..732760,745025..745136,751376..752286)
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, transcript variant
FT                   mCT169438"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT169438.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(<732312..732760,745025..745136,764847..764960,
FT                   766235..766368,766737..766841,767764..767822,
FT                   769398..769485,770255..770393)
FT                   /codon_start=1
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, isoform CRA_e"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT193093.0
FT                   protein_id=mCP114061.0 isoform=CRA_e"
FT                   /protein_id="EDL32960.1"
FT                   /translation="SRRAIPRAGPQRRASSRTLSVALSCCGRPRLLGRLSSMKTKFCTG
FT                   GEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESKQLGGRTQPLALPPPPPPPLPLP
FT                   PPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLREDQFHISVIRGGLSNMLFQCSLP
FT                   DSIASVGDEPRKVLLRLYGAILKMGAEAMVLESVMFAILAERSLGPKLFGIFPQGRLEQ
FT                   FIPSRRLDTEELRLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKYLNQVLRLKFS
FT                   REARVQQLHKILSYNLPLELENLRSLLQYTRSPVVFCHNDCQEGNILLLEGQENSERRK
FT                   LMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFRANIQKYPSRKQQVGEAFVFIS
FT                   "
FT   CDS             join(732423..732760,745025..745136,756108..756161,
FT                   764847..764960,766235..766368,766737..766841,
FT                   767764..767822,769398..769485,770255..770363,
FT                   772482..772588,773085..773166,773723..773782)
FT                   /codon_start=1
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, isoform CRA_a"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT169437.1
FT                   protein_id=mCP92440.1 isoform=CRA_a"
FT                   /db_xref="GOA:O54804"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:107760"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54804"
FT                   /protein_id="EDL32956.1"
FT                   /translation="MKTKFCTGGEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESK
FT                   QLGGRTQPLALPPPPPPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLRE
FT                   DQFHISVIRGGLSNMLFQCSLPDSIASVGDEPRKVLLRLYGAILKMRSCNKEGSEQAQN
FT                   ENEFQGAEAMVLESVMFAILAERSLGPKLFGIFPQGRLEQFIPSRRLDTEELRLPDISA
FT                   EIAEKMATFHGMKMPFNKEPKWLFGTMEKYLNQVLRLKFSREARVQQLHKILSYNLPLE
FT                   LENLRSLLQYTRSPVVFCHNDCQEGNILLLEGQENSERRKLMLIDFEYSSYNYRGFDIG
FT                   NHFCEWMYDYTYEKYPFFRANIQKYPSRKQQLHFISSYLTTFQNDFESLSSEEQFATKE
FT                   DMLLEVNRFALASHFLWGLWSIVQAKISSIEFGYMEYAQARFEAYFDQKRKLGV"
FT   CDS             join(732423..732760,745025..745136,762383..762493,
FT                   764847..764960,766235..766368,766737..766841,
FT                   767764..767822,769398..769485,770255..770363,
FT                   772482..772588,773085..773166,773723..773782)
FT                   /codon_start=1
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, isoform CRA_d"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT185566.0
FT                   protein_id=mCP106825.0 isoform=CRA_d"
FT                   /protein_id="EDL32959.1"
FT                   /translation="MKTKFCTGGEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESK
FT                   QLGGRTQPLALPPPPPPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLRE
FT                   DQFHISVIRGGLSNMLFQCSLPDSIASVGDEPRKVLLRLYGAILKMEAPRRLLPAYRGE
FT                   DYSRGHLEGLRLSSPESLCSIGLQGAEAMVLESVMFAILAERSLGPKLFGIFPQGRLEQ
FT                   FIPSRRLDTEELRLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKYLNQVLRLKFS
FT                   REARVQQLHKILSYNLPLELENLRSLLQYTRSPVVFCHNDCQEGNILLLEGQENSERRK
FT                   LMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFRANIQKYPSRKQQLHFISSYLT
FT                   TFQNDFESLSSEEQFATKEDMLLEVNRFALASHFLWGLWSIVQAKISSIEFGYMEYAQA
FT                   RFEAYFDQKRKLGV"
FT   CDS             join(732423..732760,745025..745136,764847..764960,
FT                   766235..766368,766737..766841,767764..767822,
FT                   769398..769485,770255..770363,772482..772588,
FT                   773085..773166,773723..773782)
FT                   /codon_start=1
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, isoform CRA_f"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT2589.2
FT                   protein_id=mCP12034.2 isoform=CRA_f"
FT                   /protein_id="EDL32961.1"
FT                   /translation="MKTKFCTGGEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESK
FT                   QLGGRTQPLALPPPPPPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLRE
FT                   DQFHISVIRGGLSNMLFQCSLPDSIASVGDEPRKVLLRLYGAILKMGAEAMVLESVMFA
FT                   ILAERSLGPKLFGIFPQGRLEQFIPSRRLDTEELRLPDISAEIAEKMATFHGMKMPFNK
FT                   EPKWLFGTMEKYLNQVLRLKFSREARVQQLHKILSYNLPLELENLRSLLQYTRSPVVFC
FT                   HNDCQEGNILLLEGQENSERRKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFF
FT                   RANIQKYPSRKQQLHFISSYLTTFQNDFESLSSEEQFATKEDMLLEVNRFALASHFLWG
FT                   LWSIVQAKISSIEFGYMEYAQARFEAYFDQKRKLGV"
FT   CDS             join(732423..732760,756110..756161,764847..764960,
FT                   766235..766368,766737..766841,767764..767822,
FT                   769398..769485,770255..770363,772482..772588,
FT                   773085..773166,773723..773782)
FT                   /codon_start=1
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, isoform CRA_c"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT169440.1
FT                   protein_id=mCP92444.1 isoform=CRA_c"
FT                   /protein_id="EDL32958.1"
FT                   /translation="MKTKFCTGGEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESK
FT                   QLGGRTQPLALPPPPPPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLRE
FT                   DQFHISVIRSCNKEGSEQAQNENEFQGAEAMVLESVMFAILAERSLGPKLFGIFPQGRL
FT                   EQFIPSRRLDTEELRLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKYLNQVLRLK
FT                   FSREARVQQLHKILSYNLPLELENLRSLLQYTRSPVVFCHNDCQEGNILLLEGQENSER
FT                   RKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFRANIQKYPSRKQQLHFISSY
FT                   LTTFQNDFESLSSEEQFATKEDMLLEVNRFALASHFLWGLWSIVQAKISSIEFGYMEYA
FT                   QARFEAYFDQKRKLGV"
FT   CDS             join(732423..732760,745025..745136,756108..756194)
FT                   /codon_start=1
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, isoform CRA_g"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT185567.0
FT                   protein_id=mCP106824.0 isoform=CRA_g"
FT                   /protein_id="EDL32963.1"
FT                   /translation="MKTKFCTGGEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESK
FT                   QLGGRTQPLALPPPPPPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLRE
FT                   DQFHISVIRGGLSNMLFQCSLPDSIASVGDEPRKVLLRLYGAILKMRSCNKEGSEQAQN
FT                   ENEFQVSNRSPFSFA"
FT   CDS             join(732423..732760,745025..745136,751376..751420)
FT                   /codon_start=1
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, isoform CRA_b"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT169439.1
FT                   protein_id=mCP92436.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5J2U5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:107760"
FT                   /db_xref="UniProtKB/TrEMBL:Q5J2U5"
FT                   /protein_id="EDL32957.1"
FT                   /translation="MKTKFCTGGEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESK
FT                   QLGGRTQPLALPPPPPPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLRE
FT                   DQFHISVIRGGLSNMLFQCSLPDSIASVGDEPRKVLLRLYGAILKMACPCDRAWSTLVS
FT                   R"
FT   CDS             join(732423..732760,745025..745136,751376..751420)
FT                   /codon_start=1
FT                   /gene="Chka"
FT                   /locus_tag="mCG_3892"
FT                   /product="choline kinase alpha, isoform CRA_b"
FT                   /note="gene_id=mCG3892.3 transcript_id=mCT169438.1
FT                   protein_id=mCP92429.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5J2U5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:107760"
FT                   /db_xref="UniProtKB/TrEMBL:Q5J2U5"
FT                   /protein_id="EDL32962.1"
FT                   /translation="MKTKFCTGGEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESK
FT                   QLGGRTQPLALPPPPPPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLRE
FT                   DQFHISVIRGGLSNMLFQCSLPDSIASVGDEPRKVLLRLYGAILKMACPCDRAWSTLVS
FT                   R"
FT   assembly_gap    738187..738616
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   gene            complement(776427..787487)
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /note="gene_id=mCG3894.2"
FT   mRNA            complement(join(776427..776567,776645..776822,
FT                   776979..777096,777170..777277,777413..777544,
FT                   777843..778056,778133..778251,778923..779013,
FT                   779093..779250,779355..779494,782266..782410,
FT                   782719..782931,783006..783099,783257..783339,
FT                   783421..783547,783715..783803,783884..784104,
FT                   784592..784670,784960..785080,787394..787487))
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, transcript variant
FT                   mCT2591"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT2591.1 created on
FT                   24-MAY-2002"
FT   mRNA            complement(join(776427..776567,776645..776822,
FT                   776979..777096,777170..777277,777413..777544,
FT                   777843..778056,778133..778251,778923..779013,
FT                   779093..779250,779355..779494,782266..782410,
FT                   782719..782931,783006..783099,783257..783339,
FT                   783421..783547,783715..783803,783884..784104,
FT                   784592..784670,784960..785080,785450..785605))
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, transcript variant
FT                   mCT169443"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT169443.0 created
FT                   on 24-MAY-2002"
FT   mRNA            complement(join(776427..776567,776645..776822,
FT                   776979..777096,777329..777544,777843..778056,
FT                   778133..778251,778923..779013,779093..779250,
FT                   779355..779494,782266..782410,782719..782931,
FT                   783006..783099,783257..783339,783421..783547,
FT                   783804..784104,784592..784670,784960..>785076))
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, transcript variant
FT                   mCT169444"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT169444.0 created
FT                   on 24-MAY-2002"
FT   mRNA            complement(join(776427..776567,776645..776822,
FT                   776979..777096,777170..777221,777333..777544,
FT                   777843..778056,778133..778251,778923..779013,
FT                   779093..779250,779355..779494,782266..782410,
FT                   782719..782931,783006..783099,783257..783339,
FT                   783421..783559,783804..784104,784592..784670,
FT                   784960..>785076))
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, transcript variant
FT                   mCT169442"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT169442.0 created
FT                   on 24-MAY-2002"
FT   mRNA            complement(join(776427..776567,776645..776822,
FT                   776979..777096,777170..777277,777413..777544,
FT                   777843..778056,778133..778251,778923..779250,
FT                   779355..779494,782266..782931,783006..783099,
FT                   783257..783339,783421..783447))
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, transcript variant
FT                   mCT169441"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT169441.0 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(776489..776567,776645..776822,
FT                   776979..777096,777170..777277,777413..777544,
FT                   777843..778056,778133..778251,778923..779013,
FT                   779093..779250,779355..779494,782266..782410,
FT                   782719..782931,783006..783099,783257..783339,
FT                   783421..783547,783715..783803,783884..784104,
FT                   784592..784670,784960..785076))
FT                   /codon_start=1
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, isoform CRA_b"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT169443.0
FT                   protein_id=mCP92425.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9JHF5"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="MGI:MGI:1350931"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JHF5"
FT                   /protein_id="EDL32965.1"
FT                   /translation="MGSMFRSEEVALVQLLLPTGSAYNCVSQLGELGLVEFRDLNESVS
FT                   AFQRRFVVDVRRCEELEKTFTFLREEVQRAGLTLAPPEGTLPAPPPRDLLRIQEETDRL
FT                   AQELRDVRGNQQALRAQLHQLRLHSAVLGQSHSPPVAADHTEGPFSETTPLLPGTRGPH
FT                   SDLKVNFVAGAVEPYKAAALERLLWRACRGFLIASFRETEGQLEDPVTGEPATWMTFVI
FT                   SYWGEQIGQKIRKITDCFHCHVFPYLEQEEARFRTLQQLQQQSQELQEVLGETDRFLSQ
FT                   VLGRVQQLLPPWQVQIHKMKAVYLTLNQCSVNTTHKCLIAEVWCAARDLPTVQQALQSG
FT                   SSEEGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPF
FT                   LFAVMFGDVGHGLLMFLFALAMVLTENRPAVKAAQNEIWQTFFGGRYLLLLMGLFSVYT
FT                   GFIYNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHSMLTLNPNITGVFLGPYPFGI
FT                   DPIWSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETLPELI
FT                   FLLGLFGYLVFLIVYKWVNVSAASASSAPSILIHFINMFLFSQNPTNHLLFHGQEVVQY
FT                   VLVVLALATVPILLLGTPLYLLRQHRHRRNTQRRPAGQQDEDTDKLLASPDASTLENSW
FT                   SPDEEKAGSPGDEETEFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSE
FT                   VLWAMVMRIGLGMGREIGVAAVVLVPVFAAFAVLTVAILLVMEGLSAFLHALRLHWVEF
FT                   QNKFYSGTGYKLSPFTFTVDSD"
FT   CDS             complement(join(776489..776567,776645..776822,
FT                   776979..777096,777170..777277,777413..777544,
FT                   777843..778056,778133..778251,778923..779013,
FT                   779093..779250,779355..779494,782266..782410,
FT                   782719..782931,783006..783099,783257..783339,
FT                   783421..783547,783715..783803,783884..784104,
FT                   784592..784670,784960..785076))
FT                   /codon_start=1
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, isoform CRA_b"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT2591.1
FT                   protein_id=mCP12072.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9JHF5"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="MGI:MGI:1350931"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JHF5"
FT                   /protein_id="EDL32968.1"
FT                   /translation="MGSMFRSEEVALVQLLLPTGSAYNCVSQLGELGLVEFRDLNESVS
FT                   AFQRRFVVDVRRCEELEKTFTFLREEVQRAGLTLAPPEGTLPAPPPRDLLRIQEETDRL
FT                   AQELRDVRGNQQALRAQLHQLRLHSAVLGQSHSPPVAADHTEGPFSETTPLLPGTRGPH
FT                   SDLKVNFVAGAVEPYKAAALERLLWRACRGFLIASFRETEGQLEDPVTGEPATWMTFVI
FT                   SYWGEQIGQKIRKITDCFHCHVFPYLEQEEARFRTLQQLQQQSQELQEVLGETDRFLSQ
FT                   VLGRVQQLLPPWQVQIHKMKAVYLTLNQCSVNTTHKCLIAEVWCAARDLPTVQQALQSG
FT                   SSEEGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPF
FT                   LFAVMFGDVGHGLLMFLFALAMVLTENRPAVKAAQNEIWQTFFGGRYLLLLMGLFSVYT
FT                   GFIYNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHSMLTLNPNITGVFLGPYPFGI
FT                   DPIWSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETLPELI
FT                   FLLGLFGYLVFLIVYKWVNVSAASASSAPSILIHFINMFLFSQNPTNHLLFHGQEVVQY
FT                   VLVVLALATVPILLLGTPLYLLRQHRHRRNTQRRPAGQQDEDTDKLLASPDASTLENSW
FT                   SPDEEKAGSPGDEETEFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSE
FT                   VLWAMVMRIGLGMGREIGVAAVVLVPVFAAFAVLTVAILLVMEGLSAFLHALRLHWVEF
FT                   QNKFYSGTGYKLSPFTFTVDSD"
FT   CDS             complement(join(776489..776567,776645..776822,
FT                   776979..777096,777329..777544,777843..778056,
FT                   778133..778251,778923..779013,779093..779250,
FT                   779355..779494,782266..782410,782719..782931,
FT                   783006..783099,783257..783339,783421..783547,
FT                   783804..784104,784592..784670,784960..785076))
FT                   /codon_start=1
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, isoform CRA_c"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT169444.0
FT                   protein_id=mCP92422.0 isoform=CRA_c"
FT                   /protein_id="EDL32966.1"
FT                   /translation="MGSMFRSEEVALVQLLLPTGSAYNCVSQLGELGLVEFRDLNESVS
FT                   AFQRRFVVDVRRCEELEKTFTFLREEVQRAGLTLAPPEGTLPAPPPRDLLRIQEETDRL
FT                   AQELRDVRGNQQALRAQLHQLRLHSAVLGQSHSPPVSPSQGRDGAWRYICHGWGSQCLL
FT                   VPSFVAGAVEPYKAAALERLLWRACRGFLIASFRETEGQLEDPVTGEPATWMTFVISYW
FT                   GEQIGQKIRKITDCFHCHVFPYLEQEEARFRTLQQLQQQSQELQEVLGETDRFLSQVLG
FT                   RVQQLLPPWQVQIHKMKAVYLTLNQCSVNTTHKCLIAEVWCAARDLPTVQQALQSGSSE
FT                   EGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPFLFA
FT                   VMFGDVGHGLLMFLFALAMVLTENRPAVKAAQNEIWQTFFGGRYLLLLMGLFSVYTGFI
FT                   YNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHSMLTLNPNITGVFLGPYPFGIDPI
FT                   WSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETLPELIFLL
FT                   GLFGYLVFLIVYKWVNVSAASASSAPSILIHFINMFLFSQNPTNHLLFHGQEVVQYVLV
FT                   VLALATVPILLLGTPLYLLRQHRHRRNTQRRPAGQQVDAAERITGKAGCMRGDLCFPAG
FT                   CAAGWFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGL
FT                   GMGREIGVAAVVLVPVFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYK
FT                   LSPFTFTVDSD"
FT   CDS             complement(join(776489..776567,776645..776822,
FT                   776979..777096,777170..777221,777333..777544,
FT                   777843..778056,778133..778251,778923..779013,
FT                   779093..779250,779355..779494,782266..782410,
FT                   782719..782931,783006..783099,783257..783339,
FT                   783421..783559,783804..784104,784592..784670,
FT                   784960..785076))
FT                   /codon_start=1
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, isoform CRA_d"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT169442.0
FT                   protein_id=mCP92439.0 isoform=CRA_d"
FT                   /protein_id="EDL32967.1"
FT                   /translation="MGSMFRSEEVALVQLLLPTGSAYNCVSQLGELGLVEFRDLNESVS
FT                   AFQRRFVVDVRRCEELEKTFTFLREEVQRAGLTLAPPEGTLPAPPPRDLLRIQEETDRL
FT                   AQELRDVRGNQQALRAQLHQLRLHSAVLGQSHSPPVSPSQGRDGAWRYICHGWGSQCLL
FT                   VPSPVGSFVAGAVEPYKAAALERLLWRACRGFLIASFRETEGQLEDPVTGEPATWMTFV
FT                   ISYWGEQIGQKIRKITDCFHCHVFPYLEQEEARFRTLQQLQQQSQELQEVLGETDRFLS
FT                   QVLGRVQQLLPPWQVQIHKMKAVYLTLNQCSVNTTHKCLIAEVWCAARDLPTVQQALQS
FT                   GSSEEGVSAVAHRIPCQDMPPTLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFP
FT                   FLFAVMFGDVGHGLLMFLFALAMVLTENRPAVKAAQNEIWQTFFGGRYLLLLMGLFSVY
FT                   TGFIYNECFSRATTIFPSGWSVAAMANQSGWSDEYLSQHSMLTLNPNITGVFLGPYPFG
FT                   IDPIWSLATNHLSFLNSFKMKMSVILGVTHMAFGVFLSIFNHVHFGQAHRLLLETLPEL
FT                   IFLLGLFGYLVFLIVYKWVNVSAASASSAPSILIHFINMFLFSQNPTNHLLFHGQEVVQ
FT                   YVLVVLALATVPILLLGTPLYLLRQHRHRRNTQRRPAGQQVDAAERITGKAGCMRGDLC
FT                   FPAGCAAGWSPDEEKAGSPGDEETEFVPSEIFMHQAIHTIEFCLGCISNTASYLRLWAL
FT                   SLAHAQLSEVLWAMVMRIGLGMGREIGVAAVVLVPVFAAFAVLTVAILLVMEGLSAFLH
FT                   ALRLHWVEFQNKFYSGTGYKLSPFTFTVDSD"
FT   CDS             complement(join(776489..776567,776645..776822,
FT                   776979..777096,777170..777277,777413..777544,
FT                   777843..778056,778133..778251,778923..779171))
FT                   /codon_start=1
FT                   /gene="Tcirg1"
FT                   /locus_tag="mCG_3894"
FT                   /product="T-cell, immune regulator 1, ATPase, H+
FT                   transporting, lysosomal V0 protein A3, isoform CRA_a"
FT                   /note="gene_id=mCG3894.2 transcript_id=mCT169441.0
FT                   protein_id=mCP92431.0 isoform=CRA_a"
FT                   /protein_id="EDL32964.1"
FT                   /translation="MSASAEPPLFSPQVGVWLPWPTSQAGGMTYNPPYAARAPGPLCSS
FT                   DIIYFYCSDEYLSQHSMLTLNPNITGVFLGPYPFGIDPIWSLATNHLSFLNSFKMKMSV
FT                   ILGVTHMAFGVFLSIFNHVHFGQAHRLLLETLPELIFLLGLFGYLVFLIVYKWVNVSAA
FT                   SASSAPSILIHFINMFLFSQNPTNHLLFHGQEVVQYVLVVLALATVPILLLGTPLYLLR
FT                   QHRHRRNTQRRPAGQQDEDTDKLLASPDASTLENSWSPDEEKAGSPGDEETEFVPSEIF
FT                   MHQAIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGREIGVAAVV
FT                   LVPVFAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFTVDSD"
FT   gene            complement(789237..793150)
FT                   /gene="Ndufs8"
FT                   /locus_tag="mCG_3885"
FT                   /note="gene_id=mCG3885.2"
FT   mRNA            complement(join(789237..789449,789528..789656,
FT                   791273..791445,791536..791631,791941..791991,
FT                   792064..792121,793085..793150))
FT                   /gene="Ndufs8"
FT                   /locus_tag="mCG_3885"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 8,
FT                   transcript variant mCT2594"
FT                   /note="gene_id=mCG3885.2 transcript_id=mCT2594.2 created on
FT                   24-MAY-2002"
FT   mRNA            complement(join(789237..789449,789528..789656,
FT                   791273..791445,791536..791631,791941..791991,
FT                   792064..792121,792842..793091))
FT                   /gene="Ndufs8"
FT                   /locus_tag="mCG_3885"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 8,
FT                   transcript variant mCT169434"
FT                   /note="gene_id=mCG3885.2 transcript_id=mCT169434.0 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(789318..789449,789528..789656,
FT                   791273..791445,791536..791631,791941..791991,
FT                   792064..792121))
FT                   /codon_start=1
FT                   /gene="Ndufs8"
FT                   /locus_tag="mCG_3885"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 8,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3885.2 transcript_id=mCT169434.0
FT                   protein_id=mCP92420.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5M9P5"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="MGI:MGI:2385079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9P5"
FT                   /protein_id="EDL32969.1"
FT                   /translation="MYRLSSSMLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNKKEQE
FT                   SEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALR
FT                   RYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP
FT                   VDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR"
FT   CDS             complement(join(789318..789449,789528..789656,
FT                   791273..791445,791536..791631,791941..791991,
FT                   792064..792121))
FT                   /codon_start=1
FT                   /gene="Ndufs8"
FT                   /locus_tag="mCG_3885"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 8,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3885.2 transcript_id=mCT2594.2
FT                   protein_id=mCP12086.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5M9P5"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="MGI:MGI:2385079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9P5"
FT                   /protein_id="EDL32970.1"
FT                   /translation="MYRLSSSMLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNKKEQE
FT                   SEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALR
FT                   RYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACP
FT                   VDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR"
FT   gene            complement(793868..804278)
FT                   /locus_tag="mCG_3881"
FT                   /note="gene_id=mCG3881.2"
FT   mRNA            complement(join(793868..794459,795669..795768,
FT                   798415..798581,798976..799362,801170..801251,
FT                   801556..801641,801846..801966,802070..802180,
FT                   804112..804278))
FT                   /locus_tag="mCG_3881"
FT                   /product="mCG3881, transcript variant mCT2601"
FT                   /note="gene_id=mCG3881.2 transcript_id=mCT2601.2 created on
FT                   24-MAY-2002"
FT   mRNA            complement(join(793868..794459,795669..795768,
FT                   798415..798581,798976..799362,801170..801251,
FT                   801556..801641,801846..801966,802070..802176,
FT                   804093..804278))
FT                   /locus_tag="mCG_3881"
FT                   /product="mCG3881, transcript variant mCT169431"
FT                   /note="gene_id=mCG3881.2 transcript_id=mCT169431.0 created
FT                   on 24-MAY-2002"
FT   mRNA            complement(join(793868..794459,795669..795768,
FT                   798415..798581,798976..799362,801170..801251,
FT                   801556..801641,801846..801992,804066..804278))
FT                   /locus_tag="mCG_3881"
FT                   /product="mCG3881, transcript variant mCT169430"
FT                   /note="gene_id=mCG3881.2 transcript_id=mCT169430.0 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(794269..794459,795669..795768,
FT                   798415..798581,798976..799362,801170..801251,
FT                   801556..801641,801846..801966,802070..802180,
FT                   804112..804273))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3881"
FT                   /product="mCG3881, isoform CRA_c"
FT                   /note="gene_id=mCG3881.2 transcript_id=mCT2601.2
FT                   protein_id=mCP12061.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TX25"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="MGI:MGI:1914939"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TX25"
FT                   /protein_id="EDL32973.1"
FT                   /translation="MDSFEDKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQ
FT                   EALAQDLHKSAFEAEVSEIAISQAEVDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEP
FT                   FGLVLIIVPWNYPINLTLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYLDQSCF
FT                   TVVLGGRQETGQLLEHKFDYIFFTGNAYVGKIVMAAAAKHLTPITLELGGKNPCYVDDN
FT                   CDPQIVANRVAWFRYFNAGQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNPQTSPN
FT                   LGRIINQKHFKRLQGLLGCGRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPIL
FT                   PLVTVRSLDEAIEFMNRREKPLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSS
FT                   LPFGGVGTSGMGRYHGKFSFDTFSNQRACLLRSPGMEKINDLRYPPYSSRNLRVLLVAM
FT                   EERCCSCTLL"
FT   CDS             complement(join(794269..794459,795669..795768,
FT                   798415..798581,798976..799362,801170..801251,
FT                   801556..801641,801846..801966,802070..802176,
FT                   804093..804273))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3881"
FT                   /product="mCG3881, isoform CRA_b"
FT                   /note="gene_id=mCG3881.2 transcript_id=mCT169431.0
FT                   protein_id=mCP92435.0 isoform=CRA_b"
FT                   /protein_id="EDL32972.1"
FT                   /translation="MDSFEDKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQ
FT                   EALAQDLHKVAWNRDTFEAEVSEIAISQAEVDLALRNLRSWMKDEKVSKNLATQLDSAF
FT                   IRKEPFGLVLIIVPWNYPINLTLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYL
FT                   DQSCFTVVLGGRQETGQLLEHKFDYIFFTGNAYVGKIVMAAAAKHLTPITLELGGKNPC
FT                   YVDDNCDPQIVANRVAWFRYFNAGQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNP
FT                   QTSPNLGRIINQKHFKRLQGLLGCGRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEI
FT                   FGPILPLVTVRSLDEAIEFMNRREKPLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMH
FT                   MTLSSLPFGGVGTSGMGRYHGKFSFDTFSNQRACLLRSPGMEKINDLRYPPYSSRNLRV
FT                   LLVAMEERCCSCTLL"
FT   CDS             complement(join(794269..794459,795669..795768,
FT                   798415..798581,798976..799362,801170..801251,
FT                   801556..801641,801846..801992,804066..804273))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3881"
FT                   /product="mCG3881, isoform CRA_a"
FT                   /note="gene_id=mCG3881.2 transcript_id=mCT169430.0
FT                   protein_id=mCP92443.0 isoform=CRA_a"
FT                   /protein_id="EDL32971.1"
FT                   /translation="MDSFEDKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQ
FT                   EALAQDLHKVAWNRDSGVGVCVPREPHCSPLTQATQLDSAFIRKEPFGLVLIIVPWNYP
FT                   INLTLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYLDQSCFTVVLGGRQETGQL
FT                   LEHKFDYIFFTGNAYVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQIVANRVAWF
FT                   RYFNAGQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQKHFKRL
FT                   QGLLGCGRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIE
FT                   FMNRREKPLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGR
FT                   YHGKFSFDTFSNQRACLLRSPGMEKINDLRYPPYSSRNLRVLLVAMEERCCSCTLL"
FT   assembly_gap    809141..809192
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    813410..814075
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    815774..815793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <816030..830360
FT                   /gene="Unc93b1"
FT                   /locus_tag="mCG_3874"
FT                   /note="gene_id=mCG3874.2"
FT   mRNA            join(<816030..816188,816599..816740,817106..817244,
FT                   822472..822666,822870..823002,823334..823427,
FT                   823679..823803,824514..824696,825008..825281,
FT                   827992..828110,829650..830360)
FT                   /gene="Unc93b1"
FT                   /locus_tag="mCG_3874"
FT                   /product="unc-93 homolog B1 (C. elegans)"
FT                   /note="gene_id=mCG3874.2 transcript_id=mCT2608.2 created on
FT                   24-MAY-2002"
FT   CDS             join(816030..816188,816599..816740,817106..817244,
FT                   822472..822666,822870..823002,823334..823427,
FT                   823679..823803,824514..824696,825008..825281,
FT                   827992..828110,829650..829964)
FT                   /codon_start=1
FT                   /gene="Unc93b1"
FT                   /locus_tag="mCG_3874"
FT                   /product="unc-93 homolog B1 (C. elegans)"
FT                   /note="gene_id=mCG3874.2 transcript_id=mCT2608.2
FT                   protein_id=mCP12019.2"
FT                   /protein_id="EDL32974.1"
FT                   /translation="MKEVPTSCWCPELQALDLDLVMEVEPPLYPVAGAAGPQGDEDRHG
FT                   VPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVVKNVLAASTGVTLTYGVYLGLLQ
FT                   MQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVVLMSLPLNRFFGTK
FT                   WMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMGNYITRMSQKYYEYSH
FT                   YKEQDEQGPQQRPPRGSHAPYLLVFQAIFYSFFHLSFACAQLPMIYFLNNYLYDLNHTL
FT                   INVQSCGTKSQGILNGFNKTVLRTLPRSKNLIVVESVLMAVAFLAMLMVLGLCGAAYRP
FT                   TEEIDLRSVGWGNIFQLPFKHVRDFRLRHLVPFFIYSGFEVLFACTGFALGYGVCSMGL
FT                   ERLAYLLIAYSLGASASSVLGLLGLWLPRSVPLVAGAGLHLLLTLSLFFWAPAPRVLQH
FT                   SWIFYFVAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFVVYLGSS
FT                   LPMKAKLAVLLVTLVAAAASYLWMEQKLQQGLVPRQPRIPKPQHKVRGYRYLEEDNSDE
FT                   SDMEGEQGQGDCAEDEAPQAGPLGAEPAGPCRKPCPYEQALGGDGPEEQ"
FT   assembly_gap    817247..817518
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    828416..828543
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    835271..835290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    838254..838273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            839990..>845802
FT                   /locus_tag="mCG_128138"
FT                   /note="gene_id=mCG128138.0"
FT   mRNA            join(839990..840096,845063..845225,845692..>845802)
FT                   /locus_tag="mCG_128138"
FT                   /product="mCG128138"
FT                   /note="gene_id=mCG128138.0 transcript_id=mCT129432.0
FT                   created on 24-MAY-2002"
FT   CDS             join(840059..840096,845063..845225,845692..>845802)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128138"
FT                   /product="mCG128138"
FT                   /note="gene_id=mCG128138.0 transcript_id=mCT129432.0
FT                   protein_id=mCP68304.1"
FT                   /protein_id="EDL32975.1"
FT                   /translation="MSTKGKHPRADQGTDPFEEKLQRLKEAFNTGKTKTAKFRAEQLQS
FT                   LGRFLQDNSKQLHDALDGDLGKSGFESDMSEIILCENEVDLALKNLQTWMKDEPVSTNL
FT                   "
FT   assembly_gap    841561..841719
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    845999..846018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <847860..852706
FT                   /locus_tag="mCG_3880"
FT                   /note="gene_id=mCG3880.1"
FT   mRNA            join(<847860..848030,848430..848540,848787..848907,
FT                   849026..849111,849224..849305,849603..849989,
FT                   851059..851225,851745..851844,852061..852706)
FT                   /locus_tag="mCG_3880"
FT                   /product="mCG3880"
FT                   /note="gene_id=mCG3880.1 transcript_id=mCT2607.2 created on
FT                   24-MAY-2002"
FT   CDS             join(<847860..848030,848430..848540,848787..848907,
FT                   849026..849111,849224..849305,849603..849989,
FT                   851059..851225,851745..851844,852061..852245)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3880"
FT                   /product="mCG3880"
FT                   /note="gene_id=mCG3880.1 transcript_id=mCT2607.2
FT                   protein_id=mCP12083.2"
FT                   /protein_id="EDL32976.1"
FT                   /translation="SCRAGPSEATLHSLREAFNAGRTRPTEFRTAQLRSLGRFLQENKE
FT                   LLQDALAKDVGKSGFESDMSEIILCENEVDLALKNLQTWMKDEPVSTNLLTKLSTAFIR
FT                   KEPFGLVLIIAPWNYPVNLMIIPLVGAIAAGNCVVLKPSEISKNTEKVLAELLPQYLDQ
FT                   SCFAVMLGGPEETRQLLEHKFDYIFFTGSPRVGKIVMTAAAKHLTPITLELGGKNPCYV
FT                   DDNCDPQTVANRVAWFRYFNAGQTCVAPDYILCSQEMQERLVPALQNSITRFYGDNPQT
FT                   SPNLGRIINQKHFKRLQGLLGCGRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFG
FT                   PILPLVTVRSLDEAIEFINRREKPLALYAFSNNNQVVNQMLERTSSGGFGGNDGFLYLT
FT                   LPALPLGGVGNSGMGRYHGKFSFDTFSHHRACLLRSPGMEKLNDLRYPPYGPWNQQLIS
FT                   WAIGSRSCTLL"
FT   assembly_gap    850011..850030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            857619..861059
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /note="gene_id=mCG3901.2"
FT   mRNA            join(857619..857664,857876..858004,858104..858358,
FT                   858784..858976,859191..859284,859451..859558,
FT                   859659..859768,860706..861059)
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, transcript
FT                   variant mCT2581"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT2581.2 created on
FT                   24-MAY-2002"
FT   mRNA            join(857619..857664,858104..858358,858784..858976,
FT                   859191..859284,859451..859558,859659..859768,
FT                   860706..861059)
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, transcript
FT                   variant mCT169451"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT169451.0 created
FT                   on 24-MAY-2002"
FT   mRNA            join(857714..858358,858784..858976,859191..859284,
FT                   859451..859558,859659..859768,860706..861059)
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, transcript
FT                   variant mCT169450"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT169450.0 created
FT                   on 24-MAY-2002"
FT   mRNA            join(858104..858358,858784..859025,859409..859558,
FT                   859659..859768,860706..861059)
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, transcript
FT                   variant mCT169449"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT169449.0 created
FT                   on 24-MAY-2002"
FT   mRNA            join(858104..858358,858784..858976,859378..859558,
FT                   859659..859768,860706..861059)
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, transcript
FT                   variant mCT169452"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT169452.0 created
FT                   on 24-MAY-2002"
FT   CDS             join(858123..858358,858784..859025,859409..859558,
FT                   859659..859768,860706..860921)
FT                   /codon_start=1
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, isoform CRA_c"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT169449.0
FT                   protein_id=mCP92434.0 isoform=CRA_c"
FT                   /protein_id="EDL32980.1"
FT                   /translation="MSSLPGSREPLLRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPS
FT                   FSAMPVLANPAATAACCRYLDRDLNRSCTLTFLGSTATPDDPYEVKRARELNQLLGPKG
FT                   TGQAFDFTLDLHNTTANTGVCLISESNISFNLHLCHYLQVVPRGQEGGRGGGRGTSLGR
FT                   LPDISFSGPPGLEMGPQPQGVLRADLFSRMRALVASILDFIELFNQGMDLPAFEMDIYR
FT                   NLGSVDFPRTADGDLAGTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSIVYPVFI
FT                   NEAAYYEKHVAFLKSEKIRVTVPALLRLTPRSTQTP"
FT   CDS             join(858123..858358,858784..858976,859191..859284,
FT                   859451..859558,859659..859768,860706..860921)
FT                   /codon_start=1
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, isoform CRA_a"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT169451.0
FT                   protein_id=mCP92433.0 isoform=CRA_a"
FT                   /protein_id="EDL32977.1"
FT                   /translation="MSSLPGSREPLLRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPS
FT                   FSAMPVLANPAATAACCRYLDRDLNRSCTLTFLGSTATPDDPYEVKRARELNQLLGPKG
FT                   TGQAFDFTLDLHNTTANTGVCLISESNISFNLHLCHYLQRQNPGMPCRLFLYEPAGTET
FT                   FSVESISKNGICLEMGPQPQGVLRADLFSRMRALVASILDFIELFNQGMDLPAFEMDIY
FT                   RNLGSVDFPRTADGDLAGTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSIVYPVF
FT                   INEAAYYEKHVAFLKSEKIRVTVPALLRLTPRSTQTP"
FT   CDS             join(858123..858358,858784..858976,859191..859284,
FT                   859451..859558,859659..859768,860706..860921)
FT                   /codon_start=1
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, isoform CRA_a"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT2581.2
FT                   protein_id=mCP12063.2 isoform=CRA_a"
FT                   /protein_id="EDL32979.1"
FT                   /translation="MSSLPGSREPLLRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPS
FT                   FSAMPVLANPAATAACCRYLDRDLNRSCTLTFLGSTATPDDPYEVKRARELNQLLGPKG
FT                   TGQAFDFTLDLHNTTANTGVCLISESNISFNLHLCHYLQRQNPGMPCRLFLYEPAGTET
FT                   FSVESISKNGICLEMGPQPQGVLRADLFSRMRALVASILDFIELFNQGMDLPAFEMDIY
FT                   RNLGSVDFPRTADGDLAGTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSIVYPVF
FT                   INEAAYYEKHVAFLKSEKIRVTVPALLRLTPRSTQTP"
FT   CDS             join(858123..858358,858784..858976,859191..859284,
FT                   859451..859558,859659..859768,860706..860921)
FT                   /codon_start=1
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, isoform CRA_a"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT169450.0
FT                   protein_id=mCP92421.0 isoform=CRA_a"
FT                   /protein_id="EDL32981.1"
FT                   /translation="MSSLPGSREPLLRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPS
FT                   FSAMPVLANPAATAACCRYLDRDLNRSCTLTFLGSTATPDDPYEVKRARELNQLLGPKG
FT                   TGQAFDFTLDLHNTTANTGVCLISESNISFNLHLCHYLQRQNPGMPCRLFLYEPAGTET
FT                   FSVESISKNGICLEMGPQPQGVLRADLFSRMRALVASILDFIELFNQGMDLPAFEMDIY
FT                   RNLGSVDFPRTADGDLAGTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSIVYPVF
FT                   INEAAYYEKHVAFLKSEKIRVTVPALLRLTPRSTQTP"
FT   CDS             join(858123..858358,858784..858976,859378..859558,
FT                   859659..859768,860706..860921)
FT                   /codon_start=1
FT                   /gene="Acy3"
FT                   /locus_tag="mCG_3901"
FT                   /product="aspartoacylase (aminoacylase) 3, isoform CRA_b"
FT                   /note="gene_id=mCG3901.2 transcript_id=mCT169452.0
FT                   protein_id=mCP92438.0 isoform=CRA_b"
FT                   /protein_id="EDL32978.1"
FT                   /translation="MSSLPGSREPLLRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPS
FT                   FSAMPVLANPAATAACCRYLDRDLNRSCTLTFLGSTATPDDPYEVKRARELNQLLGPKG
FT                   TGQAFDFTLDLHNTTANTGVCLISESNISFNLHLCHYLQNWGGNLLPWLGLGRLPDISF
FT                   SGPPGLEMGPQPQGVLRADLFSRMRALVASILDFIELFNQGMDLPAFEMDIYRNLGSVD
FT                   FPRTADGDLAGTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSIVYPVFINEAAYY
FT                   EKHVAFLKSEKIRVTVPALLRLTPRSTQTP"
FT   assembly_gap    866080..866099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <867671..870520
FT                   /gene="Tbx10"
FT                   /locus_tag="mCG_3872"
FT                   /note="gene_id=mCG3872.2"
FT   mRNA            join(<867671..867891,867972..868070,868370..868541,
FT                   868901..869056,869278..869345,869566..869660,
FT                   870055..870105,870259..870520)
FT                   /gene="Tbx10"
FT                   /locus_tag="mCG_3872"
FT                   /product="T-box 10"
FT                   /note="gene_id=mCG3872.2 transcript_id=mCT2609.2 created on
FT                   24-MAY-2002"
FT   CDS             join(<867671..867891,867972..868070,868370..868541,
FT                   868901..869056,869278..869345,869566..869660,
FT                   870055..870105,870259..870344)
FT                   /codon_start=1
FT                   /gene="Tbx10"
FT                   /locus_tag="mCG_3872"
FT                   /product="T-box 10"
FT                   /note="gene_id=mCG3872.2 transcript_id=mCT2609.2
FT                   protein_id=mCP11989.1"
FT                   /protein_id="EDL32982.1"
FT                   /translation="PHPETSTSWESRLGTRFPSGSCTMSTEAQAMAEPTGQGPKNPRVS
FT                   SVMVQLEMKPLWEEFNQLGTEMIVTKAGRMFPTFQVKILGMDTLADYALLMDFIPLDDK
FT                   RYRYAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLMDDNG
FT                   HIILNSMHRYQPRFHVVFVDPRKDSARYAQENFKSFVFTETQFTAVTAYQNHRITQLKI
FT                   ASNPFAKGFREADPDSWPVTPRPLLSIPARSRSSLSPCLLKGSAEREKDTSKASASSSR
FT                   TPTQPHNQEDPTLAAGLGLLPTSALCLVSNQASQ"
FT   gene            871498..873199
FT                   /gene="Nudt8"
FT                   /locus_tag="mCG_3900"
FT                   /note="gene_id=mCG3900.1"
FT   mRNA            join(871498..871943,872292..872424,872724..872801,
FT                   872892..873199)
FT                   /gene="Nudt8"
FT                   /locus_tag="mCG_3900"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 8, transcript variant mCT2586"
FT                   /note="gene_id=mCG3900.1 transcript_id=mCT2586.1 created on
FT                   24-MAY-2002"
FT   CDS             join(871750..871943,872292..872424,872724..872801,
FT                   872892..873119)
FT                   /codon_start=1
FT                   /gene="Nudt8"
FT                   /locus_tag="mCG_3900"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 8, isoform CRA_b"
FT                   /note="gene_id=mCG3900.1 transcript_id=mCT2586.1
FT                   protein_id=mCP11978.1 isoform=CRA_b"
FT                   /protein_id="EDL32984.1"
FT                   /translation="MLPDGLSAEDEQRCRQLLARTTARLRSRPAAAAVLVPLCLVRGVP
FT                   ALLYTLRSSRLVGRHKGEVSFPGGKCDPDDQDVIHTALRETQEELGLEVPKEHVWGVLQ
FT                   PVYDREKATIVPVLANVGPLDLQSLRPNLEEVDEVFEMSLAHLLQTQNQGYTHFCQGGH
FT                   FSYTLPVFLHGPHRVWGLTAVITELTLKLLAPGFYQPSLAVPELPRG"
FT   mRNA            join(871903..872424,872724..872801,872892..873199)
FT                   /gene="Nudt8"
FT                   /locus_tag="mCG_3900"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 8, transcript variant mCT169448"
FT                   /note="gene_id=mCG3900.1 transcript_id=mCT169448.0 created
FT                   on 24-MAY-2002"
FT   CDS             join(872227..872424,872724..872801,872892..873119)
FT                   /codon_start=1
FT                   /gene="Nudt8"
FT                   /locus_tag="mCG_3900"
FT                   /product="nudix (nucleoside diphosphate linked moiety
FT                   X)-type motif 8, isoform CRA_a"
FT                   /note="gene_id=mCG3900.1 transcript_id=mCT169448.0
FT                   protein_id=mCP92427.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z5H8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="MGI:MGI:1913637"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z5H8"
FT                   /protein_id="EDL32983.1"
FT                   /translation="MAQRAKLPPDDLWSQDSLCPFSFPGGKCDPDDQDVIHTALRETQE
FT                   ELGLEVPKEHVWGVLQPVYDREKATIVPVLANVGPLDLQSLRPNLEEVDEVFEMSLAHL
FT                   LQTQNQGYTHFCQGGHFSYTLPVFLHGPHRVWGLTAVITELTLKLLAPGFYQPSLAVPE
FT                   LPRG"
FT   gene            874138..878101
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /note="gene_id=mCG3867.3"
FT   mRNA            join(874138..874498,874608..874911,875042..875121,
FT                   875193..875264,875420..875529,875610..875759,
FT                   877158..877364,877455..877536,877649..877745,
FT                   877816..878098)
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /product="double C2, gamma, transcript variant mCT169428"
FT                   /note="gene_id=mCG3867.3 transcript_id=mCT169428.0 created
FT                   on 24-MAY-2002"
FT   mRNA            join(874138..874498,874608..874911,875042..875121,
FT                   875193..875264,875420..875529,875610..875745,
FT                   875860..875913,877207..877364,877455..877536,
FT                   877649..877745,877816..878098)
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /product="double C2, gamma, transcript variant mCT2612"
FT                   /note="gene_id=mCG3867.3 transcript_id=mCT2612.2 created on
FT                   24-MAY-2002"
FT   mRNA            join(874138..874498,874608..874911,875042..875121,
FT                   875193..875264,875420..875529,875610..875745,
FT                   876561..876591,877181..877364,877455..877536,
FT                   877649..877745,877816..878098)
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /product="double C2, gamma, transcript variant mCT169429"
FT                   /note="gene_id=mCG3867.3 transcript_id=mCT169429.0 created
FT                   on 24-MAY-2002"
FT   mRNA            join(<874417..874498,874608..874911,875042..875121,
FT                   875193..875264,875420..875745,875860..875913,
FT                   877158..877364,877455..877536,877649..877745,
FT                   877816..878101)
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /product="double C2, gamma, transcript variant mCT193065"
FT                   /note="gene_id=mCG3867.3 transcript_id=mCT193065.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(874668..874911,875042..875121,875193..875264,
FT                   875420..875529,875610..875759,877158..877364,
FT                   877455..877536,877649..877745,877816..877946)
FT                   /codon_start=1
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /product="double C2, gamma, isoform CRA_d"
FT                   /note="gene_id=mCG3867.3 transcript_id=mCT169428.0
FT                   protein_id=mCP92430.0 isoform=CRA_d"
FT                   /protein_id="EDL32988.1"
FT                   /translation="MACAGPASGRQRVSMQEHMAIDVSPGPIRPIRLISNYFPHFYPFL
FT                   EPVLRAPDRQAMLAPAIPSAPQLQPNPEPEGDSDDSTALGTLEFTLLFDEDNSALHCTA
FT                   HRAKGLKPPAAGSVDTYVKANLLPGASKASQLRTRTVRGTREPVWEETLTYHGFTCQDA
FT                   GRKTLRLCVCEDSRLRRRRRGPPLGELRVPLRKLVPNRARSFDICLEKRKLVSGLKWGA
FT                   SDWTGSEHSLHLQEEMEAEVFGEERGRILLSLCYSSERGGLLVGVLRCVHLAPMDANGY
FT                   SDPFVRLFLHPSSGKKSKYKTSVRRKTLNPEFNEEFFYAGHREELAQKALLVSVWDYDL
FT                   GTADDFIGGVQLSGRASGERLRHWRECLGHCDHRLELWHLLDSVPPQLGD"
FT   CDS             join(874668..874911,875042..875121,875193..875264,
FT                   875420..875529,875610..875745,875860..875913,
FT                   877207..877364,877455..877536,877649..877745,
FT                   877816..877946)
FT                   /codon_start=1
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /product="double C2, gamma, isoform CRA_c"
FT                   /note="gene_id=mCG3867.3 transcript_id=mCT2612.2
FT                   protein_id=mCP12021.2 isoform=CRA_c"
FT                   /db_xref="GOA:A0A0R4J053"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001565"
FT                   /db_xref="InterPro:IPR014638"
FT                   /db_xref="InterPro:IPR030536"
FT                   /db_xref="MGI:MGI:1926250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J053"
FT                   /protein_id="EDL32987.1"
FT                   /translation="MACAGPASGRQRVSMQEHMAIDVSPGPIRPIRLISNYFPHFYPFL
FT                   EPVLRAPDRQAMLAPAIPSAPQLQPNPEPEGDSDDSTALGTLEFTLLFDEDNSALHCTA
FT                   HRAKGLKPPAAGSVDTYVKANLLPGASKASQLRTRTVRGTREPVWEETLTYHGFTCQDA
FT                   GRKTLRLCVCEDSRLRRRRRGPPLGELRVPLRKLVPNRARSFDICLEKRKLTKRPKSLD
FT                   TARGMSLYEEEEMEAEVFGEERGRILLSLCYSSERGGLLVGVLRCVHLAPMDANGYSDP
FT                   FVRLFLHPSSGKKSKYKTSVRRKTLNPEFNEEFFYAGHREELAQKALLVSVWDYDLGTA
FT                   DDFIGGVQLSGRASGERLRHWRECLGHCDHRLELWHLLDSVPPQLGD"
FT   CDS             join(874668..874911,875042..875121,875193..875264,
FT                   875420..875529,875610..875745,876561..876591,
FT                   877181..877364,877455..877536,877649..877745,
FT                   877816..877946)
FT                   /codon_start=1
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /product="double C2, gamma, isoform CRA_a"
FT                   /note="gene_id=mCG3867.3 transcript_id=mCT169429.0
FT                   protein_id=mCP92442.0 isoform=CRA_a"
FT                   /protein_id="EDL32985.1"
FT                   /translation="MACAGPASGRQRVSMQEHMAIDVSPGPIRPIRLISNYFPHFYPFL
FT                   EPVLRAPDRQAMLAPAIPSAPQLQPNPEPEGDSDDSTALGTLEFTLLFDEDNSALHCTA
FT                   HRAKGLKPPAAGSVDTYVKANLLPGASKASQLRTRTVRGTREPVWEETLTYHGFTCQDA
FT                   GRKTLRLCVCEDSRLRRRRRGPPLGELRVPLRKLVPNRARSFDICLEKRKLSAPVIAST
FT                   ANGSEHSLHLQEEMEAEVFGEERGRILLSLCYSSERGGLLVGVLRCVHLAPMDANGYSD
FT                   PFVRLFLHPSSGKKSKYKTSVRRKTLNPEFNEEFFYAGHREELAQKALLVSVWDYDLGT
FT                   ADDFIGGVQLSGRASGERLRHWRECLGHCDHRLELWHLLDSVPPQLGD"
FT   CDS             join(<875861..875913,877158..877364,877455..877536,
FT                   877649..877745,877816..877946)
FT                   /codon_start=1
FT                   /gene="Doc2g"
FT                   /locus_tag="mCG_3867"
FT                   /product="double C2, gamma, isoform CRA_b"
FT                   /note="gene_id=mCG3867.3 transcript_id=mCT193065.0
FT                   protein_id=mCP114054.0 isoform=CRA_b"
FT                   /protein_id="EDL32986.1"
FT                   /translation="PRGPRAWTQLVACLYMRRWGASDWTGSEHSLHLQEEMEAEVFGEE
FT                   RGRILLSLCYSSERGGLLVGVLRCVHLAPMDANGYSDPFVRLFLHPSSGKKSKYKTSVR
FT                   RKTLNPEFNEEFFYAGHREELAQKALLVSVWDYDLGTADDFIGGVQLSGRASGERLRHW
FT                   RECLGHCDHRLELWHLLDSVPPQLGD"
FT   gene            complement(878596..883822)
FT                   /gene="Ndufv1"
FT                   /locus_tag="mCG_3878"
FT                   /note="gene_id=mCG3878.2"
FT   mRNA            complement(join(878596..878762,878867..879012,
FT                   879145..879226,879440..879606,879691..879903,
FT                   880441..880630,880923..881106,882199..882369,
FT                   882443..882525,883648..883822))
FT                   /gene="Ndufv1"
FT                   /locus_tag="mCG_3878"
FT                   /product="NADH dehydrogenase (ubiquinone) flavoprotein 1,
FT                   transcript variant mCT2606"
FT                   /note="gene_id=mCG3878.2 transcript_id=mCT2606.2 created on
FT                   28-MAY-2002"
FT   mRNA            complement(join(878596..878762,878867..879012,
FT                   879145..879226,879440..879606,879691..879903,
FT                   880441..880630,880923..881428))
FT                   /gene="Ndufv1"
FT                   /locus_tag="mCG_3878"
FT                   /product="NADH dehydrogenase (ubiquinone) flavoprotein 1,
FT                   transcript variant mCT169707"
FT                   /note="gene_id=mCG3878.2 transcript_id=mCT169707.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(878676..878762,878867..879012,
FT                   879145..879226,879440..879606,879691..879903,
FT                   880441..880630,880923..881106,882199..882369,
FT                   882443..882525,883648..883719))
FT                   /codon_start=1
FT                   /gene="Ndufv1"
FT                   /locus_tag="mCG_3878"
FT                   /product="NADH dehydrogenase (ubiquinone) flavoprotein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3878.2 transcript_id=mCT2606.2
FT                   protein_id=mCP12048.1 isoform=CRA_b"
FT                   /protein_id="EDL32990.1"
FT                   /translation="MLAARHFLGGLVPVRVSVRFSSGTTAPKKTSFGSLKDEDRIFTNL
FT                   YGRHDWRLKGALRRGDWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNK
FT                   PSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFY
FT                   NEASNLQVAIREAYEAGLIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGK
FT                   PRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGH
FT                   VNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFD
FT                   ALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARF
FT                   VKGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHR
FT                   AWQAAS"
FT   CDS             complement(join(878676..878762,878867..879012,
FT                   879145..879226,879440..879606,879691..879903,
FT                   880441..880630,880923..881042))
FT                   /codon_start=1
FT                   /gene="Ndufv1"
FT                   /locus_tag="mCG_3878"
FT                   /product="NADH dehydrogenase (ubiquinone) flavoprotein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3878.2 transcript_id=mCT169707.0
FT                   protein_id=mCP92939.0 isoform=CRA_a"
FT                   /protein_id="EDL32989.1"
FT                   /translation="MRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIRE
FT                   AYEAGLIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVG
FT                   VFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMS
FT                   VPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTA
FT                   AVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDS
FT                   LWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHRAWQAAS"
FT   assembly_gap    902107..902126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(906325..908902)
FT                   /locus_tag="mCG_3869"
FT                   /note="gene_id=mCG3869.2"
FT   mRNA            complement(join(906325..906577,906740..906847,
FT                   907604..907707,908020..908107,908206..908312,
FT                   908501..908536,908779..908902))
FT                   /locus_tag="mCG_3869"
FT                   /product="mCG3869, transcript variant mCT2614"
FT                   /note="gene_id=mCG3869.2 transcript_id=mCT2614.2 created on
FT                   15-JUL-2003"
FT   mRNA            complement(join(906325..906577,906740..906847,
FT                   907604..907707,908020..908107,908206..908312,
FT                   908501..908621))
FT                   /locus_tag="mCG_3869"
FT                   /product="mCG3869, transcript variant mCT180786"
FT                   /note="gene_id=mCG3869.2 transcript_id=mCT180786.0 created
FT                   on 15-JUL-2003"
FT   CDS             complement(join(906389..906577,906740..906847,
FT                   907604..907707,908020..908107,908206..908312,
FT                   908501..908536,908779))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3869"
FT                   /product="mCG3869, isoform CRA_b"
FT                   /note="gene_id=mCG3869.2 transcript_id=mCT2614.2
FT                   protein_id=mCP12077.1 isoform=CRA_b"
FT                   /protein_id="EDL32992.1"
FT                   /translation="MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLK
FT                   PTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKY
FT                   VTLIYTNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIH
FT                   QVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ"
FT   CDS             complement(join(906389..906577,906740..906847,
FT                   907604..907707,908020..908107,908206..908298))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3869"
FT                   /product="mCG3869, isoform CRA_a"
FT                   /note="gene_id=mCG3869.2 transcript_id=mCT180786.0
FT                   protein_id=mCP103708.0 isoform=CRA_a"
FT                   /protein_id="EDL32991.1"
FT                   /translation="MRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGDLT
FT                   LYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYVK
FT                   ALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY
FT                   VARLSARPKIKAFLSSPEHVNRPINGNGKQ"
FT   gene            complement(911196..916933)
FT                   /locus_tag="mCG_140529"
FT                   /note="gene_id=mCG140529.1"
FT   mRNA            complement(join(911196..911455,911624..911731,
FT                   911898..912001,912308..912395,912813..912848,
FT                   916834..916933))
FT                   /locus_tag="mCG_140529"
FT                   /product="mCG140529, transcript variant mCT169938"
FT                   /note="gene_id=mCG140529.1 transcript_id=mCT169938.1
FT                   created on 04-JUN-2003"
FT   mRNA            complement(join(911196..911455,911624..911731,
FT                   911898..912001,912308..912395,912494..912600,
FT                   912813..912848,913477..913581,916834..916933))
FT                   /locus_tag="mCG_140529"
FT                   /product="mCG140529, transcript variant mCT179788"
FT                   /note="gene_id=mCG140529.1 transcript_id=mCT179788.0
FT                   created on 04-JUN-2003"
FT   mRNA            complement(join(911196..911455,911624..911731,
FT                   911898..912001,912308..912395,912494..912600,
FT                   912813..912848,913075..913132))
FT                   /locus_tag="mCG_140529"
FT                   /product="mCG140529, transcript variant mCT169940"
FT                   /note="gene_id=mCG140529.1 transcript_id=mCT169940.1
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(911267..911455,911624..911731,
FT                   911898..912001,912308..912395,912813..912848,
FT                   916834..916893))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140529"
FT                   /product="mCG140529, isoform CRA_b"
FT                   /note="gene_id=mCG140529.1 transcript_id=mCT169938.1
FT                   protein_id=mCP92956.1 isoform=CRA_b"
FT                   /protein_id="EDL32994.1"
FT                   /translation="MKTTLCGTGVHLSLGLDSFQCRRTPLSTSQVQLYGQLPKFEDGDL
FT                   TLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDLRGKYGTMIYRNYENGKNDYV
FT                   KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSA
FT                   YVARLSARPKIKAFLSSPEHVNRPINGNGKQ"
FT   CDS             complement(join(911267..911455,911624..911731,
FT                   911898..912001,912308..912395,912494..912600,
FT                   912813..912848,913075))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140529"
FT                   /product="mCG140529, isoform CRA_a"
FT                   /note="gene_id=mCG140529.1 transcript_id=mCT169940.1
FT                   protein_id=mCP92974.0 isoform=CRA_a"
FT                   /protein_id="EDL32993.1"
FT                   /translation="MPPYTIVYFPSPGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLK
FT                   PTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDLRGKY
FT                   GTMIYRNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIH
FT                   QVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ"
FT   CDS             complement(join(913561..913581,916834..916893))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140529"
FT                   /product="mCG140529, isoform CRA_c"
FT                   /note="gene_id=mCG140529.1 transcript_id=mCT179788.0
FT                   protein_id=mCP102710.0 isoform=CRA_c"
FT                   /protein_id="EDL32995.1"
FT                   /translation="MKTTLCGTGVHLSLGLDSFQLLRSLT"
FT   gene            complement(928376..930481)
FT                   /gene="BC021614"
FT                   /locus_tag="mCG_140530"
FT                   /note="gene_id=mCG140530.0"
FT   mRNA            complement(join(928376..928621,928791..928898,
FT                   928989..929092,929432..929519,929638..929744,
FT                   930327..930481))
FT                   /gene="BC021614"
FT                   /locus_tag="mCG_140530"
FT                   /product="cDNA sequence BC021614, transcript variant
FT                   mCT169937"
FT                   /note="gene_id=mCG140530.0 transcript_id=mCT169937.0
FT                   created on 07-FEB-2003"
FT   mRNA            complement(join(928376..928621,928791..928898,
FT                   928989..929092,929432..929519,929638..929744,
FT                   930162..930197,930327..930481))
FT                   /gene="BC021614"
FT                   /locus_tag="mCG_140530"
FT                   /product="cDNA sequence BC021614, transcript variant
FT                   mCT169939"
FT                   /note="gene_id=mCG140530.0 transcript_id=mCT169939.0
FT                   created on 07-FEB-2003"
FT   mRNA            complement(join(928380..928621,928791..928898,
FT                   928989..929092,929432..929519,929638..929744,
FT                   930240..930347))
FT                   /gene="BC021614"
FT                   /locus_tag="mCG_140530"
FT                   /product="cDNA sequence BC021614, transcript variant
FT                   mCT179789"
FT                   /note="gene_id=mCG140530.0 transcript_id=mCT179789.0
FT                   created on 07-FEB-2003"
FT   CDS             complement(join(928433..928621,928791..928898,
FT                   928989..929092,929432..929519,929638..929744,
FT                   930162..930197,930327))
FT                   /codon_start=1
FT                   /gene="BC021614"
FT                   /locus_tag="mCG_140530"
FT                   /product="cDNA sequence BC021614, isoform CRA_b"
FT                   /note="gene_id=mCG140530.0 transcript_id=mCT169939.0
FT                   protein_id=mCP92958.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8VC73"
FT                   /db_xref="InterPro:IPR003082"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:2385078"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VC73"
FT                   /protein_id="EDL32997.1"
FT                   /translation="MPPYTIVYFPSRGRCEVMRMLLADQGQSWKEEVVTLDVWEQGTFK
FT                   ASCLFGQIPKFQDGELTLYQSNTILRHLGRSFGLYGKDQQEAALVDMVNDGLEDLFRRI
FT                   ARQYRHILKEGKDQYQKELPGHLKPFETLLAQNRGGQSFIVGDQISFADYRLLDVLLNL
FT                   ELLFPGYLNDFPLFSAYVARLKSRPKLKAFLESPEHVNRPLAACIKM"
FT   CDS             complement(join(928433..928621,928791..928898,
FT                   928989..929092,929432..929519,929638..929730))
FT                   /codon_start=1
FT                   /gene="BC021614"
FT                   /locus_tag="mCG_140530"
FT                   /product="cDNA sequence BC021614, isoform CRA_a"
FT                   /note="gene_id=mCG140530.0 transcript_id=mCT169937.0
FT                   protein_id=mCP92966.0 isoform=CRA_a"
FT                   /protein_id="EDL32996.1"
FT                   /translation="MRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGELT
FT                   LYQSNTILRHLGRSFGLYGKDQQEAALVDMVNDGLEDLFRRIARQYRHILKEGKDQYQK
FT                   ELPGHLKPFETLLAQNRGGQSFIVGDQISFADYRLLDVLLNLELLFPGYLNDFPLFSAY
FT                   VARLKSRPKLKAFLESPEHVNRPLAACIKM"
FT   CDS             complement(join(928433..928621,928791..928898,
FT                   928989..929092,929432..929519,929638..929730))
FT                   /codon_start=1
FT                   /gene="BC021614"
FT                   /locus_tag="mCG_140530"
FT                   /product="cDNA sequence BC021614, isoform CRA_a"
FT                   /note="gene_id=mCG140530.0 transcript_id=mCT179789.0
FT                   protein_id=mCP102711.0 isoform=CRA_a"
FT                   /protein_id="EDL32998.1"
FT                   /translation="MRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGELT
FT                   LYQSNTILRHLGRSFGLYGKDQQEAALVDMVNDGLEDLFRRIARQYRHILKEGKDQYQK
FT                   ELPGHLKPFETLLAQNRGGQSFIVGDQISFADYRLLDVLLNLELLFPGYLNDFPLFSAY
FT                   VARLKSRPKLKAFLESPEHVNRPLAACIKM"
FT   assembly_gap    934801..935191
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    949509..949528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    951214..951298
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            953501..958351
FT                   /gene="Cabp2"
FT                   /locus_tag="mCG_3890"
FT                   /note="gene_id=mCG3890.2"
FT   mRNA            join(953501..953881,955892..955922,956573..956707,
FT                   957232..957341,957462..957609,958125..958351)
FT                   /gene="Cabp2"
FT                   /locus_tag="mCG_3890"
FT                   /product="calcium binding protein 2, transcript variant
FT                   mCT169709"
FT                   /note="gene_id=mCG3890.2 transcript_id=mCT169709.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(953720..953881,955892..955922,956573..956707,
FT                   957232..957341,957462..957609,958125..958150)
FT                   /codon_start=1
FT                   /gene="Cabp2"
FT                   /locus_tag="mCG_3890"
FT                   /product="calcium binding protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG3890.2 transcript_id=mCT169709.0
FT                   protein_id=mCP92931.0 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8W3"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015754"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1352749"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8W3"
FT                   /protein_id="EDL33001.1"
FT                   /translation="MALPEGPTDGSLPEGDSSPSSGTAGPSQDLASPTTRRRALLRELE
FT                   AQVQAAYGQDRELRPEEIEELQIAFQEFDRDRDGYIGYRELGACMRTLGYMPTEMELIE
FT                   ISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGCISVGELRAA
FT                   LKALLGERLSQREVDEILQDIDLNGDGLVDFEEFVRMMSR"
FT   mRNA            join(954504..954630,955101..955259,955892..955922,
FT                   956573..956707,957232..957341,957462..957609,
FT                   958125..958351)
FT                   /gene="Cabp2"
FT                   /locus_tag="mCG_3890"
FT                   /product="calcium binding protein 2, transcript variant
FT                   mCT2599"
FT                   /note="gene_id=mCG3890.2 transcript_id=mCT2599.1 created on
FT                   28-MAY-2002"
FT   mRNA            join(954504..954630,955892..955922,956573..956707,
FT                   957232..957341,957462..957609,958125..958351)
FT                   /gene="Cabp2"
FT                   /locus_tag="mCG_3890"
FT                   /product="calcium binding protein 2, transcript variant
FT                   mCT169710"
FT                   /note="gene_id=mCG3890.2 transcript_id=mCT169710.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(954574..954630,955101..955259,955892..955922,
FT                   956573..956707,957232..957341,957462..957609,
FT                   958125..958150)
FT                   /codon_start=1
FT                   /gene="Cabp2"
FT                   /locus_tag="mCG_3890"
FT                   /product="calcium binding protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG3890.2 transcript_id=mCT2599.1
FT                   protein_id=mCP12029.1 isoform=CRA_b"
FT                   /db_xref="GOA:G3XA29"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015754"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1352749"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA29"
FT                   /protein_id="EDL33000.1"
FT                   /translation="MVQRPMGNCAKTPWHRGSKERWQWPGSPLGGSRPSPGPRTEEQEG
FT                   TQGYSVLGSLVGPACIFLRPSIAATQLDRELRPEEIEELQIAFQEFDRDRDGYIGYREL
FT                   GACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFR
FT                   EFDTNGDGCISVGELRAALKALLGERLSQREVDEILQDIDLNGDGLVDFEEFVRMMSR"
FT   CDS             join(954574..954630,955892..955922,956573..956707,
FT                   957232..957341,957462..957609,958125..958150)
FT                   /codon_start=1
FT                   /gene="Cabp2"
FT                   /locus_tag="mCG_3890"
FT                   /product="calcium binding protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG3890.2 transcript_id=mCT169710.0
FT                   protein_id=mCP92925.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA16"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015754"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1352749"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA16"
FT                   /protein_id="EDL32999.1"
FT                   /translation="MVQRPMGNCAKTPWHRGSKDRELRPEEIEELQIAFQEFDRDRDGY
FT                   IGYRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMGPKLLAETADMIGVRE
FT                   LRDAFREFDTNGDGCISVGELRAALKALLGERLSQREVDEILQDIDLNGDGLVDFEEFV
FT                   RMMSR"
FT   assembly_gap    963207..963312
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    966445..966464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            968252..969920
FT                   /gene="Cdk2ap2"
FT                   /locus_tag="mCG_3897"
FT                   /note="gene_id=mCG3897.1"
FT   mRNA            join(968252..968635,968719..968819,968907..969039,
FT                   969400..969920)
FT                   /gene="Cdk2ap2"
FT                   /locus_tag="mCG_3897"
FT                   /product="CDK2-associated protein 2, transcript variant
FT                   mCT169711"
FT                   /note="gene_id=mCG3897.1 transcript_id=mCT169711.0 created
FT                   on 28-MAY-2002"
FT   mRNA            join(968252..968409,968719..968819,968907..969039,
FT                   969400..969920)
FT                   /gene="Cdk2ap2"
FT                   /locus_tag="mCG_3897"
FT                   /product="CDK2-associated protein 2, transcript variant
FT                   mCT2583"
FT                   /note="gene_id=mCG3897.1 transcript_id=mCT2583.1 created on
FT                   28-MAY-2002"
FT   mRNA            join(968252..968409,968719..968819,968907..969195)
FT                   /gene="Cdk2ap2"
FT                   /locus_tag="mCG_3897"
FT                   /product="CDK2-associated protein 2, transcript variant
FT                   mCT169712"
FT                   /note="gene_id=mCG3897.1 transcript_id=mCT169712.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(968328..968409,968719..968819,968907..969039,
FT                   969400..969467)
FT                   /codon_start=1
FT                   /gene="Cdk2ap2"
FT                   /locus_tag="mCG_3897"
FT                   /product="CDK2-associated protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG3897.1 transcript_id=mCT2583.1
FT                   protein_id=mCP11960.1 isoform=CRA_c"
FT                   /protein_id="EDL33004.1"
FT                   /translation="MSYKPIAPAPSSTPGSSTPGPGTPVPTAGSVPSPSGSVPGAAAPF
FT                   RPLFNDFGPPSMGYVQAMKPPGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLK
FT                   RGIIHARALVRECLAETERNART"
FT   CDS             join(968328..968409,968719..968819,968907..969047)
FT                   /codon_start=1
FT                   /gene="Cdk2ap2"
FT                   /locus_tag="mCG_3897"
FT                   /product="CDK2-associated protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG3897.1 transcript_id=mCT169712.0
FT                   protein_id=mCP92981.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR019187"
FT                   /db_xref="MGI:MGI:1098779"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYI1"
FT                   /protein_id="EDL33003.1"
FT                   /translation="MSYKPIAPAPSSTPGSSTPGPGTPVPTAGSVPSPSGSVPGAAAPF
FT                   RPLFNDFGPPSMGYVQAMKPPGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLK
FT                   RGK"
FT   CDS             join(968614..968635,968719..968819,968907..969039,
FT                   969400..969467)
FT                   /codon_start=1
FT                   /gene="Cdk2ap2"
FT                   /locus_tag="mCG_3897"
FT                   /product="CDK2-associated protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG3897.1 transcript_id=mCT169711.0
FT                   protein_id=mCP92962.0 isoform=CRA_a"
FT                   /protein_id="EDL33002.1"
FT                   /translation="MKKHAVGAGSVPSPSGSVPGAAAPFRPLFNDFGPPSMGYVQAMKP
FT                   PGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERN
FT                   ART"
FT   gene            971001..985143
FT                   /gene="Pitpnm1"
FT                   /locus_tag="mCG_3866"
FT                   /note="gene_id=mCG3866.2"
FT   mRNA            join(971001..971115,972046..972164,973575..973789,
FT                   973877..973998,974163..974387,975716..976042,
FT                   976132..976227,976317..976424,977466..977527,
FT                   977614..977864,978688..978877,978988..979095,
FT                   979325..979482,979567..979769,980728..980898,
FT                   981397..981561,981744..981892,981981..982091,
FT                   982484..982600,982768..982916,983003..983152,
FT                   983229..983412,983650..983778,984387..985143)
FT                   /gene="Pitpnm1"
FT                   /locus_tag="mCG_3866"
FT                   /product="phosphatidylinositol membrane-associated 1,
FT                   transcript variant mCT169702"
FT                   /note="gene_id=mCG3866.2 transcript_id=mCT169702.0 created
FT                   on 28-MAY-2002"
FT   mRNA            join(971524..972164,973575..973789,973877..973998,
FT                   974163..974387,975716..976042,976132..976227,
FT                   976317..976424,977466..977527,977614..977864,
FT                   978688..978877,978988..979095,979325..979482,
FT                   979567..979769,980728..980898,981397..981561,
FT                   981744..981892,981981..982091,982484..982600,
FT                   982768..982916,983003..983152,983229..983412,
FT                   983650..983778,984387..985143)
FT                   /gene="Pitpnm1"
FT                   /locus_tag="mCG_3866"
FT                   /product="phosphatidylinositol membrane-associated 1,
FT                   transcript variant mCT2611"
FT                   /note="gene_id=mCG3866.2 transcript_id=mCT2611.2 created on
FT                   28-MAY-2002"
FT   CDS             join(972087..972164,973575..973789,973877..973998,
FT                   974163..974387,975716..976042,976132..976227,
FT                   976317..976424,977466..977527,977614..977864,
FT                   978688..978877,978988..979095,979325..979482,
FT                   979567..979769,980728..980898,981397..981561,
FT                   981744..981892,981981..982091,982484..982600,
FT                   982768..982916,983003..983152,983229..983412,
FT                   983650..983778,984387..984650)
FT                   /codon_start=1
FT                   /gene="Pitpnm1"
FT                   /locus_tag="mCG_3866"
FT                   /product="phosphatidylinositol membrane-associated 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3866.2 transcript_id=mCT169702.0
FT                   protein_id=mCP92917.0 isoform=CRA_a"
FT                   /protein_id="EDL33005.1"
FT                   /translation="MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILAN
FT                   RPYTDGPGGNGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFV
FT                   EKFSIEIETYYLPDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYR
FT                   SAKTGRGPLADDWARTAAQTGPLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRA
FT                   HRQAWCWQDEWIELSMADIRALEEETARMLAQRMAKCNTGSEGPEAQTPGKSSTEARPG
FT                   TSTAGTPDGPEAPPGPDASPDASFGKQWSSSSRSSYSSQHGGGVSPQSLSEWRMQNIAR
FT                   DSENSSEEEFFDAHEGFSDSDEVFPKEMTKWNSNDFIDAFASPTEVEGVPDPTVMATKG
FT                   IEDGARAPRDSEGLDGAGDLVVEACSVHALFLILHSGSILDSGPGDTNSKQADVQTLST
FT                   AFEAVTRVHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRSQDHIPLAA
FT                   LPLLATSSSRYQGAVATVIARTNQAYAAFLRSSEGTGFCGQVVLIGDGVGGILGFDALC
FT                   HSASAGPGSRGSSRRGSMNNEMLSPEVGPVRDPLADGVEVLGRASPEPSALPAQRTFSD
FT                   MANPDPDGSQNSLQVASTATSSGEPRRASTASCPPASSEAPDGPTNAARLDFKVSGFFL
FT                   FGSPLGLVLALRKTVMPALEVAQLRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPL
FT                   AVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMMVPSTPTSASGAFWKGSELGNEPA
FT                   SQTAAPSTTSEVVKILDRWWGNKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVA
FT                   FILRQVIEKERPQLTECEEPSIYSPAFPREKWQRKRTQVKIRNVTSNHRASDTVVCEGR
FT                   PQVLNGRFMYGPLDVVTLTGEKVDVYVMTQPLSGKWIHFGTEVTNSSGRLTFPVPSERA
FT                   LGIGVYPVRMVVRGDHTYAECCLTVVSRGTEAVVFSIDGSFTASVSIMGSDPKVRAGAV
FT                   DVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFL
FT                   QSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHL
FT                   GQLEAGSHSHAPSGPPRAALAKSSYAVAAPVDFLRKQSQLLRSRGPSQVDREGPGTPPT
FT                   TLARGKTRSISLKLDSEE"
FT   CDS             join(972087..972164,973575..973789,973877..973998,
FT                   974163..974387,975716..976042,976132..976227,
FT                   976317..976424,977466..977527,977614..977864,
FT                   978688..978877,978988..979095,979325..979482,
FT                   979567..979769,980728..980898,981397..981561,
FT                   981744..981892,981981..982091,982484..982600,
FT                   982768..982916,983003..983152,983229..983412,
FT                   983650..983778,984387..984650)
FT                   /codon_start=1
FT                   /gene="Pitpnm1"
FT                   /locus_tag="mCG_3866"
FT                   /product="phosphatidylinositol membrane-associated 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3866.2 transcript_id=mCT2611.2
FT                   protein_id=mCP11986.2 isoform=CRA_a"
FT                   /protein_id="EDL33006.1"
FT                   /translation="MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILAN
FT                   RPYTDGPGGNGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFV
FT                   EKFSIEIETYYLPDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYR
FT                   SAKTGRGPLADDWARTAAQTGPLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRA
FT                   HRQAWCWQDEWIELSMADIRALEEETARMLAQRMAKCNTGSEGPEAQTPGKSSTEARPG
FT                   TSTAGTPDGPEAPPGPDASPDASFGKQWSSSSRSSYSSQHGGGVSPQSLSEWRMQNIAR
FT                   DSENSSEEEFFDAHEGFSDSDEVFPKEMTKWNSNDFIDAFASPTEVEGVPDPTVMATKG
FT                   IEDGARAPRDSEGLDGAGDLVVEACSVHALFLILHSGSILDSGPGDTNSKQADVQTLST
FT                   AFEAVTRVHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRSQDHIPLAA
FT                   LPLLATSSSRYQGAVATVIARTNQAYAAFLRSSEGTGFCGQVVLIGDGVGGILGFDALC
FT                   HSASAGPGSRGSSRRGSMNNEMLSPEVGPVRDPLADGVEVLGRASPEPSALPAQRTFSD
FT                   MANPDPDGSQNSLQVASTATSSGEPRRASTASCPPASSEAPDGPTNAARLDFKVSGFFL
FT                   FGSPLGLVLALRKTVMPALEVAQLRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPL
FT                   AVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMMVPSTPTSASGAFWKGSELGNEPA
FT                   SQTAAPSTTSEVVKILDRWWGNKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVA
FT                   FILRQVIEKERPQLTECEEPSIYSPAFPREKWQRKRTQVKIRNVTSNHRASDTVVCEGR
FT                   PQVLNGRFMYGPLDVVTLTGEKVDVYVMTQPLSGKWIHFGTEVTNSSGRLTFPVPSERA
FT                   LGIGVYPVRMVVRGDHTYAECCLTVVSRGTEAVVFSIDGSFTASVSIMGSDPKVRAGAV
FT                   DVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFL
FT                   QSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHL
FT                   GQLEAGSHSHAPSGPPRAALAKSSYAVAAPVDFLRKQSQLLRSRGPSQVDREGPGTPPT
FT                   TLARGKTRSISLKLDSEE"
FT   gene            complement(984420..992458)
FT                   /gene="Aip"
FT                   /locus_tag="mCG_3868"
FT                   /note="gene_id=mCG3868.4"
FT   mRNA            complement(join(984420..985698,985983..986124,
FT                   986222..986398,986884..987072,988989..989069,
FT                   992316..992458))
FT                   /gene="Aip"
FT                   /locus_tag="mCG_3868"
FT                   /product="aryl-hydrocarbon receptor-interacting protein,
FT                   transcript variant mCT185564"
FT                   /note="gene_id=mCG3868.4 transcript_id=mCT185564.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(984422..985687,989129..989168,
FT                   992238..992447))
FT                   /gene="Aip"
FT                   /locus_tag="mCG_3868"
FT                   /product="aryl-hydrocarbon receptor-interacting protein,
FT                   transcript variant mCT179796"
FT                   /note="gene_id=mCG3868.4 transcript_id=mCT179796.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(984422..985698,985983..986124,
FT                   986222..986398,986884..987072,988989..989168,
FT                   992238..992447))
FT                   /gene="Aip"
FT                   /locus_tag="mCG_3868"
FT                   /product="aryl-hydrocarbon receptor-interacting protein,
FT                   transcript variant mCT2613"
FT                   /note="gene_id=mCG3868.4 transcript_id=mCT2613.3 created on
FT                   12-JUN-2003"
FT   CDS             complement(join(985493..985698,985983..986124,
FT                   986222..986398,986884..987072,988989..989069,
FT                   992316..992336))
FT                   /codon_start=1
FT                   /gene="Aip"
FT                   /locus_tag="mCG_3868"
FT                   /product="aryl-hydrocarbon receptor-interacting protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3868.4 transcript_id=mCT185564.0
FT                   protein_id=mCP106822.0 isoform=CRA_b"
FT                   /protein_id="EDL33008.1"
FT                   /translation="MADLIARKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKS
FT                   LRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIFHIEMLKVESPGTY
FT                   QQDPWAMTDEEKAKAVPVIHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPD
FT                   WIQLDLQITPLLLNYCQCKLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNA
FT                   QEAQADFAKVLELDPALAPVVSRELRALETRIRQKDEEDKARFRGIFSH"
FT   CDS             complement(join(985493..985698,985983..986124,
FT                   986222..986398,986884..987072,988989..989168,
FT                   992238..992336))
FT                   /codon_start=1
FT                   /gene="Aip"
FT                   /locus_tag="mCG_3868"
FT                   /product="aryl-hydrocarbon receptor-interacting protein,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG3868.4 transcript_id=mCT2613.3
FT                   protein_id=mCP12070.2 isoform=CRA_c"
FT                   /protein_id="EDL33009.1"
FT                   /translation="MADLIARLREDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDN
FT                   EGSVIDDSRTRGKPMELIVGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKS
FT                   LRNIAEGKDPLEGQRHCCGIAQMHEHSSLGHADLDALQQNPQPLIFHIEMLKVESPGTY
FT                   QQDPWAMTDEEKAKAVPVIHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPD
FT                   WIQLDLQITPLLLNYCQCKLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNA
FT                   QEAQADFAKVLELDPALAPVVSRELRALETRIRQKDEEDKARFRGIFSH"
FT   CDS             complement(join(985493..985687,989129..989168,
FT                   992238..992248))
FT                   /codon_start=1
FT                   /gene="Aip"
FT                   /locus_tag="mCG_3868"
FT                   /product="aryl-hydrocarbon receptor-interacting protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3868.4 transcript_id=mCT179796.0
FT                   protein_id=mCP102718.0 isoform=CRA_a"
FT                   /protein_id="EDL33007.1"
FT                   /translation="MALRPRSTFGRCTVTMKAYFKRGKAHAAVWNAQEAQADFAKVLEL
FT                   DPALAPVVSRELRALETRIRQKDEEDKARFRGIFSH"
FT   assembly_gap    996649..996886
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   gene            <996887..1003150
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /note="gene_id=mCG128139.2"
FT   mRNA            join(<996887..997047,997905..997969,998398..998684,
FT                   1002073..1002126,1002206..1003150)
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, transcript variant
FT                   mCT169695"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT169695.1
FT                   created on 07-FEB-2003"
FT   mRNA            join(<996887..997047,997905..997969,998398..998487,
FT                   998608..998684,1002073..1002126,1002206..1003150)
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, transcript variant
FT                   mCT129433"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT129433.2
FT                   created on 07-FEB-2003"
FT   mRNA            join(<996887..997047,997905..997969,998425..998487,
FT                   998608..998684,1001875..1001919,1002073..1002126,
FT                   1002206..1003150)
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, transcript variant
FT                   mCT179787"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT179787.0
FT                   created on 07-FEB-2003"
FT   mRNA            join(<996887..997047,997905..997969,998398..998487,
FT                   998608..998684,1001875..1001919,1002073..1002126,
FT                   1002206..1002575)
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, transcript variant
FT                   mCT193080"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT193080.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<996887..997047,997905..997980,998398..998487,
FT                   998608..998684,1002073..1002126,1002206..1002572)
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, transcript variant
FT                   mCT193079"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT193079.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<996889..997047,997905..997969,998398..998487,
FT                   998608..998684,1001875..1001919,1002073..1002126,
FT                   1002206..1002288)
FT                   /codon_start=1
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, isoform CRA_d"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT193080.0
FT                   protein_id=mCP114030.0 isoform=CRA_d"
FT                   /protein_id="EDL33013.1"
FT                   /translation="PQFSIDDAFELTLEDAGPEPESSGVARFGPLHFERRARFEVADED
FT                   KQSRLRYQNLENDEDGAQASPEPDGGVSTRDSGHMSVRSSQWSFSTISSSTQRSYNACC
FT                   SWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEVAPSPGVSSAIFFVPGILLLVPG
FT                   VYHVIFIYCAVKGRRGFQFFYLPYFEK"
FT   CDS             join(<996889..997047,997905..997969,998398..998487,
FT                   998608..998684,1002073..1002126,1002206..1002288)
FT                   /codon_start=1
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, isoform CRA_e"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT129433.2
FT                   protein_id=mCP68305.2 isoform=CRA_e"
FT                   /protein_id="EDL33014.1"
FT                   /translation="PQFSIDDAFELTLEDAGPEPESSGVARFGPLHFERRARFEVADED
FT                   KQSRLRYQNLENDEDGAQASPEPDGGVSTRDSGHMSVRSSQWSFSTISSSTQRSYNACC
FT                   SWTQHPLIQKNRRVVLASFLLLLLGLGVSSAIFFVPGILLLVPGVYHVIFIYCAVKGRR
FT                   GFQFFYLPYFEK"
FT   CDS             join(<996889..997047,997905..997969,998425..998487,
FT                   998608..998684,1001875..1001919,1002073..1002126,
FT                   1002206..1002288)
FT                   /codon_start=1
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, isoform CRA_b"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT179787.0
FT                   protein_id=mCP102709.0 isoform=CRA_b"
FT                   /protein_id="EDL33011.1"
FT                   /translation="PQFSIDDAFELTLEDAGPEPESSGVARFGPLHFERRARFEVADED
FT                   KQSRLRYQNLENDEDGAQASPEPDGGVSTSSQWSFSTISSSTQRSYNACCSWTQHPLIQ
FT                   KNRRVVLASFLLLLLGLVLILVGVGLEVAPSPGVSSAIFFVPGILLLVPGVYHVIFIYC
FT                   AVKGRRGFQFFYLPYFEK"
FT   CDS             join(<996889..997047,997905..997969,998398..998491)
FT                   /codon_start=1
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, isoform CRA_a"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT169695.1
FT                   protein_id=mCP92943.1 isoform=CRA_a"
FT                   /protein_id="EDL33010.1"
FT                   /translation="PQFSIDDAFELTLEDAGPEPESSGVARFGPLHFERRARFEVADED
FT                   KQSRLRYQNLENDEDGAQASPEPDGGVSTRDSGHMSVRSSQWSFSTISSSTQRSYNACC
FT                   R"
FT   CDS             join(<996923..997047,997905..997980,998398..998487,
FT                   998608..998684,1002073..1002126,1002206..1002281)
FT                   /codon_start=1
FT                   /gene="Tmem134"
FT                   /locus_tag="mCG_128139"
FT                   /product="transmembrane protein 134, isoform CRA_c"
FT                   /note="gene_id=mCG128139.2 transcript_id=mCT193079.0
FT                   protein_id=mCP114029.0 isoform=CRA_c"
FT                   /protein_id="EDL33012.1"
FT                   /translation="PWRTRGLSPSPAGSPASGRCTSNAGLGSRWLMKTSSPGYATRTWK
FT                   MMRTEPRPLRSRMGESAPGQGQGFWAHVCPQLAVVLQHHQQQHTALLQRLLQLDPTSFD
FT                   PEKPPGSAGLLPASAVGARCLQCHLLCAGHPAVSPRSLPCDLHLLRCQGPPGLPILLPA
FT                   LL"
FT   gene            complement(1006269..1010452)
FT                   /gene="Cabp4"
FT                   /locus_tag="mCG_3902"
FT                   /note="gene_id=mCG3902.1"
FT   mRNA            complement(join(1006269..1006860,1006959..1007106,
FT                   1007952..1008061,1009394..1009537,1009619..1009649,
FT                   1010048..1010452))
FT                   /gene="Cabp4"
FT                   /locus_tag="mCG_3902"
FT                   /product="calcium binding protein 4, transcript variant
FT                   mCT2574"
FT                   /note="gene_id=mCG3902.1 transcript_id=mCT2574.1 created on
FT                   28-MAY-2002"
FT   mRNA            complement(join(1006299..1006860,1006959..1007106,
FT                   1007952..1009537,1009619..1009649,1010048..>1010362))
FT                   /gene="Cabp4"
FT                   /locus_tag="mCG_3902"
FT                   /product="calcium binding protein 4, transcript variant
FT                   mCT193085"
FT                   /note="gene_id=mCG3902.1 transcript_id=mCT193085.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1006832..1006860,1006959..1007106,
FT                   1007952..1008061,1009394..1009537,1009619..1009649,
FT                   1010048..1010401))
FT                   /codon_start=1
FT                   /gene="Cabp4"
FT                   /locus_tag="mCG_3902"
FT                   /product="calcium binding protein 4, isoform CRA_b"
FT                   /note="gene_id=mCG3902.1 transcript_id=mCT2574.1
FT                   protein_id=mCP11968.2 isoform=CRA_b"
FT                   /protein_id="EDL33016.1"
FT                   /translation="MATEHNVQLVPGSQKIPKGVVSPRSAAEGPALTRRRSKKESWHPG
FT                   SQKASSGDQSSSQGSEASGSSKHPPRTKVGQEEPSSAPARPASHRHSHRHRSDPQQDAA
FT                   QRTYGPLLNRMFGKDRELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTE
FT                   MELLEVSQHVKMRMGGFVDFEEFVELISPKLREETAHMLGVRELRIAFREFDKDRDGRI
FT                   TVAELRQAAPALLGEPLEGTELDEMLREMDLNGDGTIDFDEFVMMLSTG"
FT   CDS             complement(join(1009386..1009537,1009619..1009649,
FT                   1010048..>1010362))
FT                   /codon_start=1
FT                   /gene="Cabp4"
FT                   /locus_tag="mCG_3902"
FT                   /product="calcium binding protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG3902.1 transcript_id=mCT193085.0
FT                   protein_id=mCP114063.0 isoform=CRA_a"
FT                   /protein_id="EDL33015.1"
FT                   /translation="QKIPKGVVSPRSAAEGPALTRRRSKKESWHPGSQKASSGDQSSSQ
FT                   GSEASGSSKHPPRTKVGQEEPSSAPARPASHRHSHRHRSDPQQDAAQRTYGPLLNRMFG
FT                   KDRELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELLEVSQHVKMR
FT                   SQ"
FT   gene            1010629..1016012
FT                   /gene="Gpr152"
FT                   /locus_tag="mCG_1045466"
FT                   /note="gene_id=mCG1045466.2"
FT   mRNA            join(1010629..1011249,1013268..1016012)
FT                   /gene="Gpr152"
FT                   /locus_tag="mCG_1045466"
FT                   /product="G protein-coupled receptor 152"
FT                   /note="gene_id=mCG1045466.2 transcript_id=mCT163170.2
FT                   created on 13-JUN-2003"
FT   CDS             1013307..1014842
FT                   /codon_start=1
FT                   /gene="Gpr152"
FT                   /locus_tag="mCG_1045466"
FT                   /product="G protein-coupled receptor 152"
FT                   /note="gene_id=mCG1045466.2 transcript_id=mCT163170.2
FT                   protein_id=mCP68379.0"
FT                   /protein_id="EDL33017.1"
FT                   /translation="MDTAVEANLGAAGHGPRTELSDEDYYPQGSWDTVFLVALLLLGLP
FT                   ANGLMAWLAGSQARHGAGTRLALLLLSLALSDFLFLAAATFQILEIQHGGHWPLGTAAC
FT                   RFYYFLWGVSYSSGLFLLTALSLDRCLLALCPRWYPGHRPARLPLWVCAGVWVLATLFS
FT                   VPWLVFPEAAVWWYDLVICLDFWDTEELPLRMLEILGGFLPFLLLLVCHVLTQATACRT
FT                   CCGHQPRRMACHGFARVAKTILSAYVVLRLPYQLAQLLYLAFLWDVYPGYLLWEALVYS
FT                   DYLILLNSCLSPFLCLAASADLRALLRTVLSSFAAAVCEERPGSFIPAEPQTLPGPTSE
FT                   GQSRLDSVVQPQVNPSVQLQSDSVVQPEVSPSAQPQSDSVAQPTVGSLIQPPLDTVVQL
FT                   EVNPLTQPQLDPMAQPQVNPSAQPQSKSVVQPQVDPLTQPQLDPVAQPQSNTETPIPAF
FT                   GDESASNPGEENSSGPCPDPTPGTPENLDRPAVPQEKSPSNVPPEEAPSAGPT"
FT   gene            1019462..1025173
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /note="gene_id=mCG3873.3"
FT   mRNA            join(1019462..1019572,1020185..1020387,1020706..1020828,
FT                   1020933..1021062,1021283..1021464,1021550..1021669,
FT                   1022238..1022342,1022423..1022568,1023661..1023718,
FT                   1024366..1024629,1024736..1025173)
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /product="coronin, actin binding protein 1B, transcript
FT                   variant mCT185565"
FT                   /note="gene_id=mCG3873.3 transcript_id=mCT185565.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(1019479..1019579,1020185..1020387,1020706..1020828,
FT                   1020933..1021062,1021283..1021464,1021550..1021669,
FT                   1022238..1022342,1022423..1022568,1023661..1023718,
FT                   1024366..1024629,1024736..1025173)
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /product="coronin, actin binding protein 1B, transcript
FT                   variant mCT2610"
FT                   /note="gene_id=mCG3873.3 transcript_id=mCT2610.2 created on
FT                   12-JUN-2003"
FT   mRNA            join(1019479..1019579,1020185..1020387,1020706..1020828,
FT                   1020933..1021062,1021283..1021464,1022238..1022342,
FT                   1022423..1022568,1023661..1023718,1024366..1024629,
FT                   1024736..1025173)
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /product="coronin, actin binding protein 1B, transcript
FT                   variant mCT169704"
FT                   /note="gene_id=mCG3873.3 transcript_id=mCT169704.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(1019479..1019579,1020706..1020828,1020933..1021062,
FT                   1021283..1021464,1021550..1021669,1022238..1022342,
FT                   1022423..1022568,1023661..1023718,1024366..1024629,
FT                   1024736..1025173)
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /product="coronin, actin binding protein 1B, transcript
FT                   variant mCT169703"
FT                   /note="gene_id=mCG3873.3 transcript_id=mCT169703.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(1020187..1020387,1020706..1020828,1020933..1021062,
FT                   1021283..1021464,1021550..1021669,1022238..1022342,
FT                   1022423..1022568,1023661..1023718,1024366..1024629,
FT                   1024736..1024861)
FT                   /codon_start=1
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /product="coronin, actin binding protein 1B, isoform CRA_c"
FT                   /note="gene_id=mCG3873.3 transcript_id=mCT2610.2
FT                   protein_id=mCP11958.1 isoform=CRA_c"
FT                   /db_xref="GOA:A2RS22"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015048"
FT                   /db_xref="InterPro:IPR015505"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1345963"
FT                   /db_xref="UniProtKB/TrEMBL:A2RS22"
FT                   /protein_id="EDL33020.1"
FT                   /translation="MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNP
FT                   KFLAVIVEASGGGAFMVLPLNKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSED
FT                   CTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIITWHPTARNVLLSAGCDNVVLIWNVG
FT                   TAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGAR
FT                   PMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSV
FT                   VYVCGKGDSSIRYFEITDEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKL
FT                   HERKCEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEDWVSGQDANPILISLREAYVPS
FT                   KQRDLKVSRRNVLSDSRPASYSRSGASTATAVTDVPSGNLAGAGEAGKLEEVMQELRAL
FT                   RMLVKEQGERISRLEEQLGRMENGDT"
FT   CDS             join(1020187..1020387,1020706..1020828,1020933..1021062,
FT                   1021283..1021464,1021550..1021669,1022238..1022342,
FT                   1022423..1022568,1023661..1023718,1024366..1024629,
FT                   1024736..1024861)
FT                   /codon_start=1
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /product="coronin, actin binding protein 1B, isoform CRA_c"
FT                   /note="gene_id=mCG3873.3 transcript_id=mCT185565.0
FT                   protein_id=mCP106823.0 isoform=CRA_c"
FT                   /db_xref="GOA:A2RS22"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015048"
FT                   /db_xref="InterPro:IPR015505"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:1345963"
FT                   /db_xref="UniProtKB/TrEMBL:A2RS22"
FT                   /protein_id="EDL33021.1"
FT                   /translation="MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNP
FT                   KFLAVIVEASGGGAFMVLPLNKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSED
FT                   CTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIITWHPTARNVLLSAGCDNVVLIWNVG
FT                   TAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGAR
FT                   PMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSV
FT                   VYVCGKGDSSIRYFEITDEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKL
FT                   HERKCEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEDWVSGQDANPILISLREAYVPS
FT                   KQRDLKVSRRNVLSDSRPASYSRSGASTATAVTDVPSGNLAGAGEAGKLEEVMQELRAL
FT                   RMLVKEQGERISRLEEQLGRMENGDT"
FT   CDS             join(1020187..1020387,1020706..1020828,1020933..1021062,
FT                   1021283..1021464,1022238..1022342,1022423..1022568,
FT                   1023661..1023718,1024366..1024629,1024736..1024861)
FT                   /codon_start=1
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /product="coronin, actin binding protein 1B, isoform CRA_b"
FT                   /note="gene_id=mCG3873.3 transcript_id=mCT169704.0
FT                   protein_id=mCP92964.0 isoform=CRA_b"
FT                   /protein_id="EDL33019.1"
FT                   /translation="MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNP
FT                   KFLAVIVEASGGGAFMVLPLNKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSED
FT                   CTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIITWHPTARNVLLSAGCDNVVLIWNVG
FT                   TAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAENLEEPMALQ
FT                   ELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITDEPPYIHFLNTFTSKEPQRGMGS
FT                   MPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEDWV
FT                   SGQDANPILISLREAYVPSKQRDLKVSRRNVLSDSRPASYSRSGASTATAVTDVPSGNL
FT                   AGAGEAGKLEEVMQELRALRMLVKEQGERISRLEEQLGRMENGDT"
FT   CDS             join(1020826..1020828,1020933..1021062,1021283..1021464,
FT                   1021550..1021669,1022238..1022342,1022423..1022568,
FT                   1023661..1023718,1024366..1024629,1024736..1024861)
FT                   /codon_start=1
FT                   /gene="Coro1b"
FT                   /locus_tag="mCG_3873"
FT                   /product="coronin, actin binding protein 1B, isoform CRA_a"
FT                   /note="gene_id=mCG3873.3 transcript_id=mCT169703.0
FT                   protein_id=mCP92963.0 isoform=CRA_a"
FT                   /protein_id="EDL33018.1"
FT                   /translation="MVWQIPENGLTSPLTEPVVVLEGHTKRVGIITWHPTARNVLLSAG
FT                   CDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLV
FT                   AEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGA
FT                   LLPFYDPDTSVVYVCGKGDSSIRYFEITDEPPYIHFLNTFTSKEPQRGMGSMPKRGLEV
FT                   SKCEIARFYKLHERKCEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEDWVSGQDANPI
FT                   LISLREAYVPSKQRDLKVSRRNVLSDSRPASYSRSGASTATAVTDVPSGNLAGAGEAGK
FT                   LEEVMQELRALRMLVKEQGERISRLEEQLGRMENGDT"
FT   assembly_gap    1022919..1022938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1025253..1027929
FT                   /gene="Ptprcap"
FT                   /locus_tag="mCG_3876"
FT                   /note="gene_id=mCG3876.1"
FT   mRNA            join(1025253..1025426,1027062..1027929)
FT                   /gene="Ptprcap"
FT                   /locus_tag="mCG_3876"
FT                   /product="protein tyrosine phosphatase, receptor type, C
FT                   polypeptide-associated protein, transcript variant
FT                   mCT169705"
FT                   /note="gene_id=mCG3876.1 transcript_id=mCT169705.0 created
FT                   on 29-MAY-2002"
FT   CDS             join(1025421..1025426,1027062..1027652)
FT                   /codon_start=1
FT                   /gene="Ptprcap"
FT                   /locus_tag="mCG_3876"
FT                   /product="protein tyrosine phosphatase, receptor type, C
FT                   polypeptide-associated protein, isoform CRA_b"
FT                   /note="gene_id=mCG3876.1 transcript_id=mCT169705.0
FT                   protein_id=mCP92937.0 isoform=CRA_b"
FT                   /protein_id="EDL33023.1"
FT                   /translation="MQALPGTLRFGVLMALPGALASGADPEDGVGSSVVTIVLLLLLLL
FT                   LLVTALALAWRRLSHASGGYYHPARLGAALWGHTCRLLWASPAGRWLRARTELESPEES
FT                   GPPEDEEDAEDFVIDGGPEEAAAKEEEQRCQAEQTRDPRDTDSDGGLGLSSQGPVGSGS
FT                   SAEALLSDLHAFSGSAAWDDSAGGAGGQGLRVTAL"
FT   mRNA            join(1025788..1025842,1027062..1027929)
FT                   /gene="Ptprcap"
FT                   /locus_tag="mCG_3876"
FT                   /product="protein tyrosine phosphatase, receptor type, C
FT                   polypeptide-associated protein, transcript variant mCT2618"
FT                   /note="gene_id=mCG3876.1 transcript_id=mCT2618.1 created on
FT                   29-MAY-2002"
FT   CDS             join(1025840..1025842,1027062..1027652)
FT                   /codon_start=1
FT                   /gene="Ptprcap"
FT                   /locus_tag="mCG_3876"
FT                   /product="protein tyrosine phosphatase, receptor type, C
FT                   polypeptide-associated protein, isoform CRA_c"
FT                   /note="gene_id=mCG3876.1 transcript_id=mCT2618.1
FT                   protein_id=mCP11979.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q542J3"
FT                   /db_xref="InterPro:IPR016553"
FT                   /db_xref="MGI:MGI:97811"
FT                   /db_xref="UniProtKB/TrEMBL:Q542J3"
FT                   /protein_id="EDL33024.1"
FT                   /translation="MALPGTLRFGVLMALPGALASGADPEDGVGSSVVTIVLLLLLLLL
FT                   LVTALALAWRRLSHASGGYYHPARLGAALWGHTCRLLWASPAGRWLRARTELESPEESG
FT                   PPEDEEDAEDFVIDGGPEEAAAKEEEQRCQAEQTRDPRDTDSDGGLGLSSQGPVGSGSS
FT                   AEALLSDLHAFSGSAAWDDSAGGAGGQGLRVTAL"
FT   mRNA            1026364..1027929
FT                   /gene="Ptprcap"
FT                   /locus_tag="mCG_3876"
FT                   /product="protein tyrosine phosphatase, receptor type, C
FT                   polypeptide-associated protein, transcript variant
FT                   mCT169706"
FT                   /note="gene_id=mCG3876.1 transcript_id=mCT169706.0 created
FT                   on 29-MAY-2002"
FT   CDS             1027095..1027652
FT                   /codon_start=1
FT                   /gene="Ptprcap"
FT                   /locus_tag="mCG_3876"
FT                   /product="protein tyrosine phosphatase, receptor type, C
FT                   polypeptide-associated protein, isoform CRA_a"
FT                   /note="gene_id=mCG3876.1 transcript_id=mCT169706.0
FT                   protein_id=mCP92938.0 isoform=CRA_a"
FT                   /protein_id="EDL33022.1"
FT                   /translation="MALPGALASGADPEDGVGSSVVTIVLLLLLLLLLVTALALAWRRL
FT                   SHASGGYYHPARLGAALWGHTCRLLWASPAGRWLRARTELESPEESGPPEDEEDAEDFV
FT                   IDGGPEEAAAKEEEQRCQAEQTRDPRDTDSDGGLGLSSQGPVGSGSSAEALLSDLHAFS
FT                   GSAAWDDSAGGAGGQGLRVTAL"
FT   gene            complement(1027852..1034462)
FT                   /gene="Rps6kb2"
FT                   /locus_tag="mCG_3877"
FT                   /note="gene_id=mCG3877.1"
FT   mRNA            complement(join(1027852..1028338,1028621..1028733,
FT                   1028821..1028928,1029018..1029095,1029205..1029267,
FT                   1029749..1029856,1029968..1030058,1030142..1030232,
FT                   1030366..1030466,1030542..1030599,1032207..1032354,
FT                   1033399..1033467,1033742..1033862,1033961..1034001,
FT                   1034307..1034462))
FT                   /gene="Rps6kb2"
FT                   /locus_tag="mCG_3877"
FT                   /product="ribosomal protein S6 kinase, polypeptide 2,
FT                   transcript variant mCT2605"
FT                   /note="gene_id=mCG3877.1 transcript_id=mCT2605.1 created on
FT                   29-MAY-2002"
FT   mRNA            complement(join(1027934..1028338,1028621..1028733,
FT                   1028821..1028928,1029018..1029095,1029205..1029267,
FT                   1029749..1030058,1030142..1030232,1030366..1030466,
FT                   1030542..1030599,1030705..1030844,1032207..1032354,
FT                   1033399..1033467,1033742..1033862,1033961..1034001,
FT                   1034307..>1034439))
FT                   /gene="Rps6kb2"
FT                   /locus_tag="mCG_3877"
FT                   /product="ribosomal protein S6 kinase, polypeptide 2,
FT                   transcript variant mCT193094"
FT                   /note="gene_id=mCG3877.1 transcript_id=mCT193094.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1028149..1028338,1028621..1028733,
FT                   1028821..1028928,1029018..1029095,1029205..1029267,
FT                   1029749..1029856,1029968..1030058,1030142..1030232,
FT                   1030366..1030466,1030542..1030599,1032207..1032354,
FT                   1033399..1033467,1033742..1033862,1033961..1034001,
FT                   1034307..1034384))
FT                   /codon_start=1
FT                   /gene="Rps6kb2"
FT                   /locus_tag="mCG_3877"
FT                   /product="ribosomal protein S6 kinase, polypeptide 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3877.1 transcript_id=mCT2605.1
FT                   protein_id=mCP11983.1 isoform=CRA_b"
FT                   /protein_id="EDL33026.1"
FT                   /translation="MAAVFDLDLETEEGSEGEGEPEFSPADVCPLGELRAAGLETVGHY
FT                   EEVELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKA
FT                   KIVCSAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLERE
FT                   GIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHE
FT                   GAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKI
FT                   IKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARR
FT                   VDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIK
FT                   EGFSFQPKLRSPRRLNSSPRTPISPLKFSPFEGFRPSPGPPEPMEPSLPPLLPSPPSPP
FT                   PTSTAPLPIRPPSGTKKSKKGRGRSGR"
FT   CDS             complement(join(1028149..1028338,1028621..1028733,
FT                   1028821..1028928,1029018..1029095,1029205..1029267,
FT                   1029749..>1029883))
FT                   /codon_start=1
FT                   /gene="Rps6kb2"
FT                   /locus_tag="mCG_3877"
FT                   /product="ribosomal protein S6 kinase, polypeptide 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3877.1 transcript_id=mCT193094.0
FT                   protein_id=mCP114056.0 isoform=CRA_a"
FT                   /protein_id="EDL33025.1"
FT                   /translation="AALTFCLLQPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLAKK
FT                   FLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDAR
FT                   FTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
FT                   PISPLKFSPFEGFRPSPGPPEPMEPSLPPLLPSPPSPPPTSTAPLPIRPPSGTKKSKKG
FT                   RGRSGR"
FT   gene            complement(1035468..>1046579)
FT                   /locus_tag="mCG_3875"
FT                   /note="gene_id=mCG3875.1"
FT   mRNA            complement(join(1035468..1037703,1040667..1040947,
FT                   1041038..1041269,1041965..1042050,1042135..1042309,
FT                   1042551..1043038,1043285..1043374,1044098..1044359,
FT                   1046144..1046170,1046533..>1046579))
FT                   /locus_tag="mCG_3875"
FT                   /product="mCG3875"
FT                   /note="gene_id=mCG3875.1 transcript_id=mCT2604.2 created on
FT                   29-MAY-2002"
FT   CDS             complement(join(1036477..1037703,1040667..1040947,
FT                   1041038..1041269,1041965..1042050,1042135..1042309,
FT                   1042551..1043038,1043285..1043374,1044098..1044359,
FT                   1046144..1046170,1046533..>1046577))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3875"
FT                   /product="mCG3875"
FT                   /note="gene_id=mCG3875.1 transcript_id=mCT2604.2
FT                   protein_id=mCP12042.2"
FT                   /protein_id="EDL33027.1"
FT                   /translation="HQPACLAWSSCCQQQSLCLSTSKMLCLDPLGTEWDSKDLDGKEEP
FT                   WKSGAGLPPTGCFPGPWRQDISLDCKGSPEETEARAWTVYYYGLLQSCLQQAGLPETQD
FT                   RSQAPRTGCPGAEVTLCILGSPSTFLSLLLEGGVQSPGNMLLCLSPAWLMKVATPGQEG
FT                   EAVLLVSKAVSFYPGGLTFLDDFVPPRHATYFLAGLGPESGRGKEAAELARNLTCPTGT
FT                   SSELSQLLENRLLMRWLLSQQSGVAVPATLAFTYRPPGLLRGGDASPGLRLVELSGKEG
FT                   QETLVKEEVEAFVHSEALGDASQVAVRLSGCRWRGQQALPLHLRVEPSTVVNTVLGLLE
FT                   KLEEEESVLVEAMCPPVRLPLPGGPAPGPELAVRICAVVCRIQGDRPLLSKVVCGVGRG
FT                   DRPVRHHYTLPRTLRVALAQCGLEEEAQVALLEQGIKEAAEGALAAVLALEAGLSVEQR
FT                   GGRQVHTDFLGVDLVLTVIGRTLTPVVLKLNSGLCLEACGALEGLWAVPRLRRSAEEAA
FT                   AAPLVETMLRRSGRHLMDGKQLLVIGAGGVSKKFVWEAARDYGLTLHLVESDPNHFASQ
FT                   LVQTFIHFDVTEHRRDEENALLLAELVRARNLKLDGCFSFWDDCLVLTALLCRELGLPC
FT                   SPPAAMCLAKQKSRTQLHLLRCQGPPWPSTSLHAVACCPLENEADVERAIYQVPLPGVM
FT                   KLEFGSGAVGVQLVKDGPQCREHFSRILHDLQGEADHPGIGLGWGNAMLLMEFVEGTEH
FT                   DVDLVVFGGRLLAAFVSDNGPTRLPGFTETAACMPTGLAPEQEAQVVQAAFRCCLGCGL
FT                   LDGVFNVELKMTGAGPRLIEINPRMGGFYLRDWILELYGVDLLLASTMVACGLQPALPA
FT                   HPRARGYLVGIMCLVSQHLQLLSSPSSRETLQTLHDQGQLRLNLLEEALIPGQYEEPYC
FT                   NVACAGPSPAEACHRLLGICQGLGIDRPNYPVAHFLSHFK"
FT   gene            complement(1054550..1062189)
FT                   /gene="Tbc1d10c"
FT                   /locus_tag="mCG_3870"
FT                   /note="gene_id=mCG3870.3"
FT   mRNA            complement(join(1054550..1056212,1056491..1056645,
FT                   1059082..1059271,1060084..1060194,1060353..1060459,
FT                   1060546..1060653,1061004..1061103,1061804..>1062069))
FT                   /gene="Tbc1d10c"
FT                   /locus_tag="mCG_3870"
FT                   /product="TBC1 domain family, member 10c, transcript
FT                   variant mCT193090"
FT                   /note="gene_id=mCG3870.3 transcript_id=mCT193090.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1055529..1056212,1056491..1056645,
FT                   1059082..1059271,1059386..1059451,1060084..1060198,
FT                   1060353..1060459,1060546..1060653,1061004..1061103,
FT                   1061804..1061975,1062159..1062189))
FT                   /gene="Tbc1d10c"
FT                   /locus_tag="mCG_3870"
FT                   /product="TBC1 domain family, member 10c, transcript
FT                   variant mCT2615"
FT                   /note="gene_id=mCG3870.3 transcript_id=mCT2615.2 created on
FT                   29-MAY-2002"
FT   CDS             complement(join(1055865..1056212,1056491..1056645,
FT                   1059082..1059271,1059386..1059451,1060084..1060198,
FT                   1060353..1060459,1060546..1060653,1061004..1061103,
FT                   1061804..1061949))
FT                   /codon_start=1
FT                   /gene="Tbc1d10c"
FT                   /locus_tag="mCG_3870"
FT                   /product="TBC1 domain family, member 10c, isoform CRA_b"
FT                   /note="gene_id=mCG3870.3 transcript_id=mCT2615.2
FT                   protein_id=mCP11962.2 isoform=CRA_b"
FT                   /protein_id="EDL33029.1"
FT                   /translation="MAQALGEDLLSELQDDSSSLGSDSELSGPSPYRQADRYGFIGGNS
FT                   GELRLCQPSADLIRQREMKWVEMTLHWEKTMSRRYKKVKIQCRKGIPSALRARCWPLLC
FT                   GARMCQKNNPGTYQELAAAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLK
FT                   AYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPGYYGPHMEAVQLDAE
FT                   VFMALLRRQLPRVYKHLQQVGVGPLLYLPEWFLCLFTRSLPFPTVLRIWDAFLSEGAKV
FT                   LFRVGLTLMRLALGTVEQRTACPGLLETLGALRAIPPTQLQEEVFMSQVHSVTLSERVL
FT                   QQEIRIQLAQLSKSLPGPAPLPQARLPGAQAIFESQQLAGVRESTKPEIPRIVVQPPEE
FT                   PKPPRRKPQTRGKTFHGLLIRARGPPIEGPSRSQRGSASFLDTRF"
FT   CDS             complement(join(1055865..1056212,1056491..1056645,
FT                   1059082..1059271,1060084..1060194,1060353..>1060379))
FT                   /codon_start=1
FT                   /gene="Tbc1d10c"
FT                   /locus_tag="mCG_3870"
FT                   /product="TBC1 domain family, member 10c, isoform CRA_a"
FT                   /note="gene_id=mCG3870.3 transcript_id=mCT193090.0
FT                   protein_id=mCP114055.0 isoform=CRA_a"
FT                   /protein_id="EDL33028.1"
FT                   /translation="DVCVTPGTRQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPP
FT                   EEAVQLDAEVFMALLRRQLPRVYKHLQQVGVGPLLYLPEWFLCLFTRSLPFPTVLRIWD
FT                   AFLSEGAKVLFRVGLTLMRLALGTVEQRTACPGLLETLGALRAIPPTQLQEEVFMSQVH
FT                   SVTLSERVLQQEIRIQLAQLSKSLPGPAPLPQARLPGAQAIFESQQLAGVRESTKPEIP
FT                   RIVVQPPEEPKPPRRKPQTRGKTFHGLLIRARGPPIEGPSRSQRGSASFLDTRF"
FT   gene            1063272..1067104
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /note="gene_id=mCG3904.3"
FT   mRNA            join(1063272..1063411,1063885..1064016,1064162..1064392,
FT                   1064907..1065011,1065608..1065831,1065913..1066047,
FT                   1066123..1066826)
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /product="protein phosphatase 1, catalytic subunit, alpha
FT                   isoform, transcript variant mCT2576"
FT                   /note="gene_id=mCG3904.3 transcript_id=mCT2576.2 created on
FT                   12-JUN-2003"
FT   mRNA            join(1063272..1063411,1063885..1064016,1064162..1064392,
FT                   1064907..1065701)
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /product="protein phosphatase 1, catalytic subunit, alpha
FT                   isoform, transcript variant mCT169713"
FT                   /note="gene_id=mCG3904.3 transcript_id=mCT169713.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(1063274..1063411,1063885..1064016,1064162..1064289,
FT                   1066256..1067104)
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /product="protein phosphatase 1, catalytic subunit, alpha
FT                   isoform, transcript variant mCT185570"
FT                   /note="gene_id=mCG3904.3 transcript_id=mCT185570.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(1063274..1063411,1063885..1064016,1064162..1064390,
FT                   1064990..1065011,1065608..1065831)
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /product="protein phosphatase 1, catalytic subunit, alpha
FT                   isoform, transcript variant mCT185569"
FT                   /note="gene_id=mCG3904.3 transcript_id=mCT185569.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(1063357..1063411,1063885..1064016,1064162..1064289,
FT                   1066256..1066537)
FT                   /codon_start=1
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /product="protein phosphatase 1, catalytic subunit, alpha
FT                   isoform, isoform CRA_b"
FT                   /note="gene_id=mCG3904.3 transcript_id=mCT185570.0
FT                   protein_id=mCP106828.0 isoform=CRA_b"
FT                   /protein_id="EDL33031.1"
FT                   /translation="MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREI
FT                   FLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI
FT                   CPRSFVQKSCCHGSHWPLRPTRHGEHTALSVFPLFFKESIAASNLPGLPPTSTCGGCKW
FT                   NPGAKAAAQGNGRPDCGSPALHGWQPDPGATHLVS"
FT   CDS             join(1063357..1063411,1063885..1064016,1064162..1064392,
FT                   1064907..1065011,1065608..1065831,1065913..1066047,
FT                   1066123..1066233)
FT                   /codon_start=1
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /product="protein phosphatase 1, catalytic subunit, alpha
FT                   isoform, isoform CRA_c"
FT                   /note="gene_id=mCG3904.3 transcript_id=mCT2576.2
FT                   protein_id=mCP11970.2 isoform=CRA_c"
FT                   /protein_id="EDL33032.1"
FT                   /translation="MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREI
FT                   FLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI
FT                   CLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAA
FT                   IVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRG
FT                   VSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGA
FT                   MMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK"
FT   CDS             join(1063357..1063411,1063885..1064016,1064162..1064390,
FT                   1064990..1065011,1065608..1065781)
FT                   /codon_start=1
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /product="protein phosphatase 1, catalytic subunit, alpha
FT                   isoform, isoform CRA_a"
FT                   /note="gene_id=mCG3904.3 transcript_id=mCT185569.0
FT                   protein_id=mCP106827.0 isoform=CRA_a"
FT                   /protein_id="EDL33030.1"
FT                   /translation="MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREI
FT                   FLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI
FT                   CLLLAYKIRYPENFFLLRGNHECASINRIYGFYDERSSAATGACLQTCNPWSRLGVLCG
FT                   PQTCLTRAYCVISCGLTLTRMFKAGARMTVVSPLPLGLRW"
FT   CDS             join(1063357..1063411,1063885..1064016,1064162..1064392,
FT                   1064907..1065115)
FT                   /codon_start=1
FT                   /gene="Ppp1ca"
FT                   /locus_tag="mCG_3904"
FT                   /product="protein phosphatase 1, catalytic subunit, alpha
FT                   isoform, isoform CRA_d"
FT                   /note="gene_id=mCG3904.3 transcript_id=mCT169713.0
FT                   protein_id=mCP92933.0 isoform=CRA_d"
FT                   /protein_id="EDL33033.1"
FT                   /translation="MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREI
FT                   FLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI
FT                   CLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAA
FT                   IVDEKIFCCHGGESGCGSVLGFLGHILRGLVKLTELFSVPWNSAP"
FT   gene            complement(1066339..1072789)
FT                   /gene="Rad9"
FT                   /locus_tag="mCG_3879"
FT                   /note="gene_id=mCG3879.1"
FT   mRNA            complement(join(1066339..1067223,1067322..1067523,
FT                   1068254..1068391,1068480..1068544,1068618..1068727,
FT                   1068812..1068921,1071413..1071512,1071606..1071720,
FT                   1072070..1072198,1072470..1072540,1072624..1072789))
FT                   /gene="Rad9"
FT                   /locus_tag="mCG_3879"
FT                   /product="RAD9 homolog (S. pombe), transcript variant
FT                   mCT2600"
FT                   /note="gene_id=mCG3879.1 transcript_id=mCT2600.1 created on
FT                   29-MAY-2002"
FT   mRNA            complement(join(1066339..1067223,1067322..1067523,
FT                   1068254..1068391,1068480..1068544,1068618..1068727,
FT                   1068812..1068921,1071413..1071512,1071606..1071720,
FT                   1072070..1072198,1072291..1072388,1072470..1072540,
FT                   1072624..1072789))
FT                   /gene="Rad9"
FT                   /locus_tag="mCG_3879"
FT                   /product="RAD9 homolog (S. pombe), transcript variant
FT                   mCT169708"
FT                   /note="gene_id=mCG3879.1 transcript_id=mCT169708.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1067128..1067223,1067322..1067523,
FT                   1068254..1068391,1068480..1068544,1068618..1068727,
FT                   1068812..1068921,1071413..1071512,1071606..1071720,
FT                   1072070..1072198,1072470..1072540,1072624..1072657))
FT                   /codon_start=1
FT                   /gene="Rad9"
FT                   /locus_tag="mCG_3879"
FT                   /product="RAD9 homolog (S. pombe), isoform CRA_b"
FT                   /note="gene_id=mCG3879.1 transcript_id=mCT2600.1
FT                   protein_id=mCP12013.1 isoform=CRA_b"
FT                   /protein_id="EDL33035.1"
FT                   /translation="MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSR
FT                   SAYACFLFAPLFFQQYQAASPGQDLLRCKILMKAFLSVFRSLAIVEKSVEKCCISLSGS
FT                   HSHLVVQLHCKYGVKKTHNLSFQDCESLQAVFDPASCPHLLRTPARVLAEAVLSFPLAL
FT                   TEVTLGIGRGRRVILRSYQEEEADSTSKAMVTETSIGDEDFQQLHAPEGIAVTFCLKEF
FT                   RGLLSFAESANLPLTIHFDVPGRPVIFTIEDSLLDAHFVLATLLEQDSCSQGPCSPKPH
FT                   QPVPQKQAHSTPHLDDFTSDDIDCYMIAMETTGGNEGSGAQPSTSLPPVSLASHDLAPT
FT                   SEEEAEPSTVPGTPPPKKFRSLFFGSILAPVHSPQGPNPVLAEDSDGEG"
FT   CDS             complement(join(1067128..1067223,1067322..1067523,
FT                   1068254..1068391,1068480..1068544,1068618..1068727,
FT                   1068812..1068921,1071413..1071512,1071606..1071720,
FT                   1072070..1072198,1072291..1072305))
FT                   /codon_start=1
FT                   /gene="Rad9"
FT                   /locus_tag="mCG_3879"
FT                   /product="RAD9 homolog (S. pombe), isoform CRA_a"
FT                   /note="gene_id=mCG3879.1 transcript_id=mCT169708.0
FT                   protein_id=mCP92947.0 isoform=CRA_a"
FT                   /protein_id="EDL33034.1"
FT                   /translation="MSIQRLSLRTVNSSRSAYACFLFAPLFFQQYQAASPGQDLLRCKI
FT                   LMKAFLSVFRSLAIVEKSVEKCCISLSGSHSHLVVQLHCKYGVKKTHNLSFQDCESLQA
FT                   VFDPASCPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRSYQEEEADSTSKAM
FT                   VTETSIGDEDFQQLHAPEGIAVTFCLKEFRGLLSFAESANLPLTIHFDVPGRPVIFTIE
FT                   DSLLDAHFVLATLLEQDSCSQGPCSPKPHQPVPQKQAHSTPHLDDFTSDDIDCYMIAME
FT                   TTGGNEGSGAQPSTSLPPVSLASHDLAPTSEEEAEPSTVPGTPPPKKFRSLFFGSILAP
FT                   VHSPQGPNPVLAEDSDGEG"
FT   gene            1072920..1074350
FT                   /locus_tag="mCG_140477"
FT                   /note="gene_id=mCG140477.0"
FT   mRNA            join(1072920..1072939,1073268..1073379,1073679..1074350)
FT                   /locus_tag="mCG_140477"
FT                   /product="mCG140477"
FT                   /note="gene_id=mCG140477.0 transcript_id=mCT169694.0
FT                   created on 29-MAY-2002"
FT   CDS             join(1073336..1073379,1073679..1073793)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140477"
FT                   /product="mCG140477"
FT                   /note="gene_id=mCG140477.0 transcript_id=mCT169694.0
FT                   protein_id=mCP92978.0"
FT                   /protein_id="EDL33036.1"
FT                   /translation="MDLSEGGAEAEAQWGLLSLSKCFFPRASGEEAAFPFHIQGKLHTT
FT                   QRCPVLC"
FT   assembly_gap    1076402..1076428
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    1083806..1084212
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    1085395..1085557
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            1085664..1093967
FT                   /gene="Clcf1"
FT                   /locus_tag="mCG_3899"
FT                   /note="gene_id=mCG3899.2"
FT   mRNA            join(1085664..1085816,1091530..1091696,1093426..1093967)
FT                   /gene="Clcf1"
FT                   /locus_tag="mCG_3899"
FT                   /product="cardiotrophin-like cytokine factor 1"
FT                   /note="gene_id=mCG3899.2 transcript_id=mCT2585.1 created on
FT                   29-MAY-2002"
FT   CDS             join(1085801..1085816,1091530..1091696,1093426..1093920)
FT                   /codon_start=1
FT                   /gene="Clcf1"
FT                   /locus_tag="mCG_3899"
FT                   /product="cardiotrophin-like cytokine factor 1"
FT                   /note="gene_id=mCG3899.2 transcript_id=mCT2585.1
FT                   protein_id=mCP11963.1"
FT                   /db_xref="GOA:Q9QZM3"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR010681"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:1930088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZM3"
FT                   /protein_id="EDL33037.1"
FT                   /translation="MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYD
FT                   LTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVNLEVWRSLNDRLRLT
FT                   QNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMATLGYPLPQPLP
FT                   GTEPAWAPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAASVTLHLEA
FT                   HGF"
FT   assembly_gap    1086672..1086691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1103264..1104985
FT                   /gene="Pold4"
FT                   /locus_tag="mCG_3893"
FT                   /note="gene_id=mCG3893.2"
FT   mRNA            join(1103264..1103539,1103812..1103901,1104097..1104208,
FT                   1104563..1104985)
FT                   /gene="Pold4"
FT                   /locus_tag="mCG_3893"
FT                   /product="polymerase (DNA-directed), delta 4, transcript
FT                   variant mCT170146"
FT                   /note="gene_id=mCG3893.2 transcript_id=mCT170146.0 created
FT                   on 29-MAY-2002"
FT   mRNA            join(1103264..1103539,1103812..1103901,1104097..1104208,
FT                   1104775..1104985)
FT                   /gene="Pold4"
FT                   /locus_tag="mCG_3893"
FT                   /product="polymerase (DNA-directed), delta 4, transcript
FT                   variant mCT2590"
FT                   /note="gene_id=mCG3893.2 transcript_id=mCT2590.2 created on
FT                   29-MAY-2002"
FT   mRNA            join(1103264..1103539,1103812..1103901,1104097..1104464)
FT                   /gene="Pold4"
FT                   /locus_tag="mCG_3893"
FT                   /product="polymerase (DNA-directed), delta 4, transcript
FT                   variant mCT170145"
FT                   /note="gene_id=mCG3893.2 transcript_id=mCT170145.0 created
FT                   on 29-MAY-2002"
FT   CDS             join(1103443..1103539,1103812..1103901,1104097..1104208,
FT                   1104775..1104790)
FT                   /codon_start=1
FT                   /gene="Pold4"
FT                   /locus_tag="mCG_3893"
FT                   /product="polymerase (DNA-directed), delta 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3893.2 transcript_id=mCT2590.2
FT                   protein_id=mCP12099.1 isoform=CRA_c"
FT                   /protein_id="EDL33040.1"
FT                   /translation="MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETE
FT                   LELLRQFDLAWQYGPCTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCSTSTP
FT                   "
FT   CDS             join(1103443..1103539,1103812..1103901,1104097..1104208,
FT                   1104563..1104587)
FT                   /codon_start=1
FT                   /gene="Pold4"
FT                   /locus_tag="mCG_3893"
FT                   /product="polymerase (DNA-directed), delta 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3893.2 transcript_id=mCT170146.0
FT                   protein_id=mCP93129.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q547B4"
FT                   /db_xref="InterPro:IPR007218"
FT                   /db_xref="MGI:MGI:1916995"
FT                   /db_xref="UniProtKB/TrEMBL:Q547B4"
FT                   /protein_id="EDL33039.1"
FT                   /translation="MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETE
FT                   LELLRQFDLAWQYGPCTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHL
FT                   YPL"
FT   CDS             join(1103443..1103539,1103812..1103901,1104097..1104218)
FT                   /codon_start=1
FT                   /gene="Pold4"
FT                   /locus_tag="mCG_3893"
FT                   /product="polymerase (DNA-directed), delta 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3893.2 transcript_id=mCT170145.0
FT                   protein_id=mCP93128.0 isoform=CRA_a"
FT                   /protein_id="EDL33038.1"
FT                   /translation="MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETE
FT                   LELLRQFDLAWQYGPCTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCRSG"
FT   assembly_gap    1115001..1115020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1122034..1122113
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1130515..1130720
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   gene            complement(1133047..1140609)
FT                   /gene="Ssh3"
FT                   /locus_tag="mCG_8383"
FT                   /note="gene_id=mCG8383.2"
FT   mRNA            complement(join(1133047..1133984,1134899..1135169,
FT                   1135260..1135460,1135666..1135812,1136455..1136501,
FT                   1136644..1136772,1136962..1137055,1137162..1137350,
FT                   1137459..1137524,1137727..1137798,1137874..1137989,
FT                   1139099..1139330,1139897..1139937,1140367..1140609))
FT                   /gene="Ssh3"
FT                   /locus_tag="mCG_8383"
FT                   /product="slingshot homolog 3 (Drosophila)"
FT                   /note="gene_id=mCG8383.2 transcript_id=mCT7269.2 created on
FT                   29-MAY-2002"
FT   CDS             complement(join(1133706..1133984,1134899..1135169,
FT                   1135260..1135460,1135666..1135812,1136455..1136501,
FT                   1136644..1136772,1136962..1137055,1137162..1137350,
FT                   1137459..1137524,1137727..1137798,1137874..1137989,
FT                   1139099..1139330,1139897..1139937,1140367..1140432))
FT                   /codon_start=1
FT                   /gene="Ssh3"
FT                   /locus_tag="mCG_8383"
FT                   /product="slingshot homolog 3 (Drosophila)"
FT                   /note="gene_id=mCG8383.2 transcript_id=mCT7269.2
FT                   protein_id=mCP12067.2"
FT                   /protein_id="EDL33041.1"
FT                   /translation="MALVTVSRSPPASGHSTPVGPTQDRVVRRRGRLQRRQSFAVLRGA
FT                   VLGLQDGGDSNVASEADSEPMEEPSGEEQPTEDQTDKGQGLQSPWKQVQKRHLHLMVEL
FT                   LRPQDDIRLAAQLEAARPPRLRYLLVVSTGEELSEEAILLGVDFPDSSSHSCTLGLVLP
FT                   LWSDTQVYLDGDGGFSVTSGGQSRIFKPVSIQTMWATLQVLHQACEVALGSGLVPGGSA
FT                   LAWATYYQEKLNSDQGCLNEWMAMSDLESFRPPNAEPGQASEQEKMEQAILAELWQVLD
FT                   TSDLDSVTSKEIRQALELRLGCPLQQYRDFIDNQMLLLMAQQDRASRIFPHLYLGSEWN
FT                   AANLEELQKNRVSHILNMAREIDNFFPERFTYYNVRVWDEESAQLLPHWKETHRFIEDA
FT                   RAQGTRVLVHCKMGVSRSAATVLAYAMKQYGWDLEQALIHVQELRPIVRPNHGFLRQLR
FT                   TYQGILTASRQSHVWEQKVGVVSPEEPLAPEVSTPLPPLPPEPGGSGEVMVMGLEGSQE
FT                   TPKEELGLRPRINLRGVMRSISLLEPSESESTPEAGGLPEVFSSDEEPLHPFSQLSRAK
FT                   GGQRVRKGPWPALKSRQSVVALHSAALVASRTRAFQEQGQGQEQSEPGMSSTPRLRKVM
FT                   RQASVDDSREEDKA"
FT   assembly_gap    1140675..1140833
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            complement(1141497..>1154284)
FT                   /gene="Ankrd13d"
FT                   /locus_tag="mCG_133301"
FT                   /note="gene_id=mCG133301.2"
FT   mRNA            complement(join(1141497..1141867,1142112..1142203,
FT                   1142284..1142447,1142537..1142653,1142760..1142917,
FT                   1143886..1144016,1144116..1144177,1144337..1144418,
FT                   1144852..1144918,1151683..1151872,1152083..1152226,
FT                   1152309..1152354,1153064..1153188,1153315..1153450,
FT                   1154027..1154260))
FT                   /gene="Ankrd13d"
FT                   /locus_tag="mCG_133301"
FT                   /product="ankyrin repeat domain 13 family, member D,
FT                   transcript variant mCT134666"
FT                   /note="gene_id=mCG133301.2 transcript_id=mCT134666.1
FT                   created on 29-MAY-2002"
FT   mRNA            complement(join(1141500..1141867,1142112..1142203,
FT                   1142284..1142447,1142537..1142653,1142760..1142917,
FT                   1143886..1144016,1144116..1144177,1144337..1144418,
FT                   1144852..1144918,1151683..1151872,1152083..1152226,
FT                   1152309..1152354,1153064..1153180,1153315..1153450,
FT                   1154027..>1154284))
FT                   /gene="Ankrd13d"
FT                   /locus_tag="mCG_133301"
FT                   /product="ankyrin repeat domain 13 family, member D,
FT                   transcript variant mCT193088"
FT                   /note="gene_id=mCG133301.2 transcript_id=mCT193088.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1141654..1141867,1142112..1142203,
FT                   1142284..1142447,1142537..1142653,1142760..1142917,
FT                   1143886..1144016,1144116..1144177,1144337..1144418,
FT                   1144852..1144918,1151683..1151872,1152083..1152226,
FT                   1152309..1152354,1153064..1153188,1153315..1153450,
FT                   1154027..1154116))
FT                   /codon_start=1
FT                   /gene="Ankrd13d"
FT                   /locus_tag="mCG_133301"
FT                   /product="ankyrin repeat domain 13 family, member D,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG133301.2 transcript_id=mCT134666.1
FT                   protein_id=mCP68255.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q6PD24"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR021832"
FT                   /db_xref="MGI:MGI:1915673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PD24"
FT                   /protein_id="EDL33042.1"
FT                   /translation="MAGLGPTFPLHRLVWANRHRELEAALHSRKHDIEQEDPQGRTPLE
FT                   LAVTLGNLESVRVLLRHNANVGKESHQGWAVLQEAVSTGDPEMVQLVLQYRDFQRATQR
FT                   LAGIPELLNKLRQAPDFYVEMKWEFTSWVPLVSKMCPSDVYRVWKRGESLRVDTSLLGF
FT                   EHMTWQRGRRSFIFRGQEAGALVMEVDHDRQVVHTETLAPALHEPEALLAAMRPSEEHV
FT                   ASRLTSPIVSTHLDTRNVAFERNKCGIWGWRSEKMESVSGYEAKVYSATNVELVTRTRT
FT                   EHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAISAEEYFDPSFS
FT                   LESRNIGRPIEMSSKVQRFKATLWLSEEHPLSLGDQVTPIIDLMAISNAHFAKLRDFIT
FT                   LRLPPGFPVKIEIPLFHVLNARITFSNLCGCDEPVSSVCVPNSSSAISASGSPFPCEVD
FT                   PTVFEVPEGYSVLGAERSEPLRDEDDDLLQFAIQQSLLEAGTEAEQVTVWEALTNTRPG
FT                   IHPPPRVTVFEEQLQLEQALQESLQLSTESRGPESPQKTPPSPAPPSFEEQLRLALELS
FT                   SREQEELERRGQQEEDDLQRILQLSLTEH"
FT   CDS             complement(join(1141654..1141867,1142112..1142203,
FT                   1142284..1142447,1142537..1142653,1142760..1142917,
FT                   1143886..1144016,1144116..1144177,1144337..1144418,
FT                   1144852..1144918,1151683..1151872,1152083..1152226,
FT                   1152309..1152354,1153064..1153180,1153315..>1153371))
FT                   /codon_start=1
FT                   /gene="Ankrd13d"
FT                   /locus_tag="mCG_133301"
FT                   /product="ankyrin repeat domain 13 family, member D,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG133301.2 transcript_id=mCT193088.0
FT                   protein_id=mCP114034.0 isoform=CRA_b"
FT                   /protein_id="EDL33043.1"
FT                   /translation="ESSSDIMPTWAKRATRAGQEAVSTGDPEMVQLVLQYRDFQRATQR
FT                   LAGIPELLNKLRQAPDFYVEMKWEFTSWVPLVSKMCPSDVYRVWKRGESLRVDTSLLGF
FT                   EHMTWQRGRRSFIFRGQEAGALVMEVDHDRQVVHTETLAPALHEPEALLAAMRPSEEHV
FT                   ASRLTSPIVSTHLDTRNVAFERNKCGIWGWRSEKMESVSGYEAKVYSATNVELVTRTRT
FT                   EHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAISAEEYFDPSFS
FT                   LESRNIGRPIEMSSKVQRFKATLWLSEEHPLSLGDQVTPIIDLMAISNAHFAKLRDFIT
FT                   LRLPPGFPVKIEIPLFHVLNARITFSNLCGCDEPVSSVCVPNSSSAISASGSPFPCEVD
FT                   PTVFEVPEGYSVLGAERSEPLRDEDDDLLQFAIQQSLLEAGTEAEQVTVWEALTNTRPG
FT                   IHPPPRVTVFEEQLQLEQALQESLQLSTESRGPESPQKTPPSPAPPSFEEQLRLALELS
FT                   SREQEELERRGQQEEDDLQRILQLSLTEH"
FT   assembly_gap    1154669..1154764
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   gene            complement(1157227..1177277)
FT                   /gene="Adrbk1"
FT                   /locus_tag="mCG_8387"
FT                   /note="gene_id=mCG8387.1"
FT   mRNA            complement(join(1157227..1158491,1158580..1158693,
FT                   1158785..1158921,1159050..1159212,1159652..1159747,
FT                   1159832..1159898,1160553..1160653,1160913..1160979,
FT                   1161138..1161245,1161314..1161408,1161635..1161765,
FT                   1161844..1161922,1162012..1162111,1162479..1162570,
FT                   1162830..1162881,1163410..1163471,1163602..1163676,
FT                   1163784..1163885,1164007..1164079,1177144..1177277))
FT                   /gene="Adrbk1"
FT                   /locus_tag="mCG_8387"
FT                   /product="adrenergic receptor kinase, beta 1"
FT                   /note="gene_id=mCG8387.1 transcript_id=mCT7264.2 created on
FT                   29-MAY-2002"
FT   CDS             complement(join(1158327..1158491,1158580..1158693,
FT                   1158785..1158921,1159050..1159212,1159652..1159747,
FT                   1159832..1159898,1160553..1160653,1160913..1160979,
FT                   1161138..1161245,1161314..1161408,1161635..1161765,
FT                   1161844..1161922,1162012..1162111,1162479..1162570,
FT                   1162830..1162881,1163410..1163471,1163602..1163676,
FT                   1163784..1163885,1164007..1164079,1177144..1177256))
FT                   /codon_start=1
FT                   /gene="Adrbk1"
FT                   /locus_tag="mCG_8387"
FT                   /product="adrenergic receptor kinase, beta 1"
FT                   /note="gene_id=mCG8387.1 transcript_id=mCT7264.2
FT                   protein_id=mCP11997.2"
FT                   /protein_id="EDL33044.1"
FT                   /translation="MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPRYLLFRDF
FT                   CLNHLEEAKPLVEFYEEIKKYEKLETEEERVVRSREIFDSYIMKELLACSHPFSKNATE
FT                   HVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMN
FT                   DFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVST
FT                   GDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAEIILGLEH
FT                   MHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKRPHASVGTHGYMAPEVLQKGV
FT                   AYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLL
FT                   EGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFD
FT                   IGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAK
FT                   NKQLGHEEDYALGKDCIVHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLT
FT                   MEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQRV
FT                   PKMKNKPRSPVVELSKVPLIQRGSANGL"
FT   assembly_gap    1164713..1164814
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1165731..1166291
FT                   /estimated_length=561
FT                   /gap_type="unknown"
FT   assembly_gap    1168379..1168398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1177340..1177376
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(1187042..1267348)
FT                   /gene="Fbxl11"
FT                   /locus_tag="mCG_8391"
FT                   /note="gene_id=mCG8391.1"
FT   mRNA            complement(join(1187042..1190177,1191047..1191262,
FT                   1191793..1191951,1193282..1193445,1195232..1195941,
FT                   1197703..1197792,1199022..1199153,1199848..1200117,
FT                   1202082..1202165,1213756..1214150,1216415..1216541,
FT                   1219260..1219375,1220791..1220944,1222346..1222439,
FT                   1222877..1222983,1227446..1227624,1232230..1232276,
FT                   1232669..1232747,1233468..1233606,1265495..1265595,
FT                   1267014..1267348))
FT                   /gene="Fbxl11"
FT                   /locus_tag="mCG_8391"
FT                   /product="F-box and leucine-rich repeat protein 11"
FT                   /note="gene_id=mCG8391.1 transcript_id=mCT7262.2 created on
FT                   30-MAY-2002"
FT   CDS             complement(join(1189996..1190177,1191047..1191262,
FT                   1191793..1191951,1193282..1193445,1195232..1195941,
FT                   1197703..1197792,1199022..1199153,1199848..1200117,
FT                   1202082..1202165,1213756..1214150,1216415..1216541,
FT                   1219260..1219375,1220791..1220944,1222346..1222439,
FT                   1222877..1222983,1227446..1227624,1232230..1232276,
FT                   1232669..1232747,1233468..1233606,1265495..1265536))
FT                   /codon_start=1
FT                   /gene="Fbxl11"
FT                   /locus_tag="mCG_8391"
FT                   /product="F-box and leucine-rich repeat protein 11"
FT                   /note="gene_id=mCG8391.1 transcript_id=mCT7262.2
FT                   protein_id=mCP12097.2"
FT                   /db_xref="GOA:F6YRW4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002857"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1354736"
FT                   /db_xref="UniProtKB/TrEMBL:F6YRW4"
FT                   /protein_id="EDL33045.1"
FT                   /translation="MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLQ
FT                   TNKYNANFVTFMEGKDFNVEYIQRGGLRDPLIFKNSDGLGIKMPDPDFTVNDVKMCVGS
FT                   RRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPSTV
FT                   DFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWY
FT                   HIHQGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSG
FT                   WIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTRVPNKFRYPFYYEMCWYVLERY
FT                   VYCITNRSHLTKDFQKESLSMDMELNELESGNGDEEGVDREARRMNNKRSVLTSPVANG
FT                   VNLDYDGLGKACRSLPSLKKTLSGDSSSDSTRGSHNGQVWDPQCSPKKDRQVHLTHFEL
FT                   EGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
FT                   KRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKA
FT                   CVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDF
FT                   EKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKCYQEDSSDKAQKRKIEESDE
FT                   EAVQAKVLRPLRSCEEPLTPPPHSPTSMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASR
FT                   DERFKRRQLLRLQATERTMVREKENNPSGKKELSEVEKAKIRGSYLTVTLQRPTKELHG
FT                   TSIVPKLQAITASSANLRPNPRVLMQHCPARNPQHGDEEGLGGEEEEEEEEEEDDSAEE
FT                   GGAARLNGRGSWAQDGDESWMQREVWMSVFRYLSRKELCECMRVCKTWYKWCCDKRLWT
FT                   KIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPGLKDLLLAGCSWS
FT                   AVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPTDKPGQDNRSKLRNMTDFRLAGL
FT                   DITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLT
FT                   DQTLFFLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS"
FT   assembly_gap    1217280..1217767
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    1223981..1224293
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    1267791..1267810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1275220..1275239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1295584..1295638
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   gene            complement(1296064..1309792)
FT                   /gene="Rhod"
FT                   /locus_tag="mCG_8405"
FT                   /note="gene_id=mCG8405.3"
FT   mRNA            complement(join(1296064..1296818,1303178..1303202,
FT                   1309568..1309792))
FT                   /gene="Rhod"
FT                   /locus_tag="mCG_8405"
FT                   /product="ras homolog gene family, member D, transcript
FT                   variant mCT169726"
FT                   /note="gene_id=mCG8405.3 transcript_id=mCT169726.1 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(1296064..1296863,1297234..1297368,
FT                   1302402..1302511,1303115..1303202,1309568..1309792))
FT                   /gene="Rhod"
FT                   /locus_tag="mCG_8405"
FT                   /product="ras homolog gene family, member D, transcript
FT                   variant mCT7252"
FT                   /note="gene_id=mCG8405.3 transcript_id=mCT7252.3 created on
FT                   10-FEB-2003"
FT   mRNA            complement(join(1296064..1297368,1302402..1302511,
FT                   1303115..1303202,1309568..1309792))
FT                   /gene="Rhod"
FT                   /locus_tag="mCG_8405"
FT                   /product="ras homolog gene family, member D, transcript
FT                   variant mCT180453"
FT                   /note="gene_id=mCG8405.3 transcript_id=mCT180453.0 created
FT                   on 10-FEB-2003"
FT   CDS             complement(join(1296696..1296863,1297234..1297368,
FT                   1302402..1302511,1303115..1303202,1309568..1309699))
FT                   /codon_start=1
FT                   /gene="Rhod"
FT                   /locus_tag="mCG_8405"
FT                   /product="ras homolog gene family, member D, isoform CRA_c"
FT                   /note="gene_id=mCG8405.3 transcript_id=mCT7252.3
FT                   protein_id=mCP12028.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q545H8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:108446"
FT                   /db_xref="UniProtKB/TrEMBL:Q545H8"
FT                   /protein_id="EDL33048.1"
FT                   /translation="MNASQVAGEEAPQSGHSVKVVLVGDGGCGKTSLMMVFAKGAFPES
FT                   YSPTVFERYNATLQMKGKPVHLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSF
FT                   DNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNLRKKRLEPVTYHRGHDMARSV
FT                   GAVAYLECSARLHDNVEAVFQEAAEVALSSRRHNFWRRITQNCCLAT"
FT   CDS             complement(join(1296799..1296818,1303178..1303202,
FT                   1309568..1309699))
FT                   /codon_start=1
FT                   /gene="Rhod"
FT                   /locus_tag="mCG_8405"
FT                   /product="ras homolog gene family, member D, isoform CRA_a"
FT                   /note="gene_id=mCG8405.3 transcript_id=mCT169726.1
FT                   protein_id=mCP92982.0 isoform=CRA_a"
FT                   /protein_id="EDL33046.1"
FT                   /translation="MNASQVAGEEAPQSGHSVKVVLVGDGGCGKTSLMMVFAKGAFPES
FT                   YSPTVFELFSSAP"
FT   CDS             complement(join(1297096..1297368,1302402..1302511,
FT                   1303115..1303202,1309568..1309699))
FT                   /codon_start=1
FT                   /gene="Rhod"
FT                   /locus_tag="mCG_8405"
FT                   /product="ras homolog gene family, member D, isoform CRA_b"
FT                   /note="gene_id=mCG8405.3 transcript_id=mCT180453.0
FT                   protein_id=mCP103375.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9Y4"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:108446"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9Y4"
FT                   /protein_id="EDL33047.1"
FT                   /translation="MNASQVAGEEAPQSGHSVKVVLVGDGGCGKTSLMMVFAKGAFPES
FT                   YSPTVFERYNATLQMKGKPVHLQIWDTAGQDDYDRLRPLFYPDANVLLLCFDVTNPNSF
FT                   DNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNNLRKKRLEPVTYHRVGRKLGNL
FT                   WILPHCARCVAHGGLGGCQQSGRGSTWKQNPECSRRL"
FT   gene            <1309351..1318667
FT                   /locus_tag="mCG_146300"
FT                   /note="gene_id=mCG146300.0"
FT   mRNA            join(<1309351..1309737,1314082..1314128,1314343..1314378,
FT                   1317638..1317767,1317866..1318667)
FT                   /locus_tag="mCG_146300"
FT                   /product="mCG146300, transcript variant mCT186403"
FT                   /note="gene_id=mCG146300.0 transcript_id=mCT186403.0
FT                   created on 14-JUL-2003"
FT   mRNA            join(<1309907..1310018,1314082..1314128,1314343..1314378,
FT                   1317638..1317767,1317866..1318520)
FT                   /locus_tag="mCG_146300"
FT                   /product="mCG146300, transcript variant mCT193098"
FT                   /note="gene_id=mCG146300.0 transcript_id=mCT193098.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1314095..1314128,1314343..1314378,1317638..1317767,
FT                   1317866..1318031)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146300"
FT                   /product="mCG146300, isoform CRA_a"
FT                   /note="gene_id=mCG146300.0 transcript_id=mCT186403.0
FT                   protein_id=mCP107560.0 isoform=CRA_a"
FT                   /protein_id="EDL33049.1"
FT                   /translation="GPESTVTSHTAGREVAQAGDGGEGTIPSRFINSCPLGEWQKGSWQ
FT                   VLKPTSFCRPRDILPKALQYSSLDRGSKMADEKSPRRWGSPGVHSSSWLWRGHRWIELR
FT                   WCQAPEALMPNLACSGC"
FT   CDS             join(<1314095..1314128,1314343..1314378,1317638..1317767,
FT                   1317866..1318031)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146300"
FT                   /product="mCG146300, isoform CRA_a"
FT                   /note="gene_id=mCG146300.0 transcript_id=mCT193098.0
FT                   protein_id=mCP114038.0 isoform=CRA_a"
FT                   /protein_id="EDL33050.1"
FT                   /translation="GPESTVTSHTAGREVAQAGDGGEGTIPSRFINSCPLGEWQKGSWQ
FT                   VLKPTSFCRPRDILPKALQYSSLDRGSKMADEKSPRRWGSPGVHSSSWLWRGHRWIELR
FT                   WCQAPEALMPNLACSGC"
FT   gene            complement(1317638..1347463)
FT                   /gene="Syt12"
FT                   /locus_tag="mCG_8400"
FT                   /note="gene_id=mCG8400.1"
FT   mRNA            complement(join(1317638..1318201,1321268..1321401,
FT                   1322619..1322739,1324107..1324322,1326837..1327229,
FT                   1330955..1331148,1338276..1338332,1347253..1347463))
FT                   /gene="Syt12"
FT                   /locus_tag="mCG_8400"
FT                   /product="synaptotagmin XII"
FT                   /note="gene_id=mCG8400.1 transcript_id=mCT7251.1 created on
FT                   30-MAY-2002"
FT   CDS             complement(join(1318028..1318201,1321268..1321401,
FT                   1322619..1322739,1324107..1324322,1326837..1327229,
FT                   1330955..1331148,1338276..1338309))
FT                   /codon_start=1
FT                   /gene="Syt12"
FT                   /locus_tag="mCG_8400"
FT                   /product="synaptotagmin XII"
FT                   /note="gene_id=mCG8400.1 transcript_id=mCT7251.1
FT                   protein_id=mCP12078.2"
FT                   /db_xref="GOA:Q14AG7"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001565"
FT                   /db_xref="InterPro:IPR030537"
FT                   /db_xref="MGI:MGI:2159601"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AG7"
FT                   /protein_id="EDL33051.1"
FT                   /translation="MAVDVTEYHLSVIKSPPGWEVGVYAAGALALLGIAAVSLWKLWTS
FT                   GSFPSPSPFPNYDYRYLQQKYGEAYVEAKLKRVPPWNDQRTTTRGPPSRKGSLSIEDTF
FT                   ESISELGPLELMGRELDLAPYGTLRKSQSADSLNSISSVSNTFGQDFTLGQVEVSMDYD
FT                   GASHTLHVAVLQGKDLLEREEATFESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFS
FT                   VPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAA
FT                   DAVGEILLSLSYLPTAERLTVVVVKAKNLIWTNEKSTADPFVKVYLLQDGRKMSKKKTA
FT                   VKRDDPNPVFNEAMIFSVPAIVLQDLSLRVTVAESSSDGRGDNVGHVIIGPGVSGMGTT
FT                   HWNQMLATLRRPVSMWHPVRRN"
FT   assembly_gap    1322141..1322227
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1333141..1333160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1338636..1338683
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    1348108..1348127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1364658..1364787
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    1366858..1367000
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            complement(1367182..1368978)
FT                   /gene="2010003K11Rik"
FT                   /locus_tag="mCG_133283"
FT                   /note="gene_id=mCG133283.0"
FT   mRNA            complement(join(1367182..1368010,1368640..1368978))
FT                   /gene="2010003K11Rik"
FT                   /locus_tag="mCG_133283"
FT                   /product="RIKEN cDNA 2010003K11"
FT                   /note="gene_id=mCG133283.0 transcript_id=mCT134648.1
FT                   created on 30-MAY-2002"
FT   CDS             complement(join(1367912..1368010,1368640..1368915))
FT                   /codon_start=1
FT                   /gene="2010003K11Rik"
FT                   /locus_tag="mCG_133283"
FT                   /product="RIKEN cDNA 2010003K11"
FT                   /note="gene_id=mCG133283.0 transcript_id=mCT134648.1
FT                   protein_id=mCP68199.1"
FT                   /protein_id="EDL33052.1"
FT                   /translation="MGTSLRSQSFREPRPSYGRLHESQGRSLDGRLHRALSLRLGREKS
FT                   RSQVPDGTEGLEVSVQERLPGTLGDKEQLIQGQRGGGSRRWLRQYQQHVKRRWRSFVAS
FT                   FPSVTLSQPASPETLLDTNN"
FT   assembly_gap    1374589..1374608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1393252..1393313
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    1394202..1394258
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   gene            1465374..1492879
FT                   /gene="Pcx"
FT                   /locus_tag="mCG_8397"
FT                   /note="gene_id=mCG8397.1"
FT   mRNA            join(1465374..1465464,1472619..1472754,1472884..1473068,
FT                   1473229..1473394,1473493..1473638,1473777..1473894,
FT                   1474079..1474230,1475484..1475602,1478551..1478713,
FT                   1480883..1481065,1488762..1488906,1489147..1489236,
FT                   1489324..1489702,1490140..1490380,1490502..1490751,
FT                   1490962..1491206,1491296..1491475,1491549..1491797,
FT                   1492002..1492142,1492222..1492879)
FT                   /gene="Pcx"
FT                   /locus_tag="mCG_8397"
FT                   /product="pyruvate carboxylase"
FT                   /note="gene_id=mCG8397.1 transcript_id=mCT7254.1 created on
FT                   30-MAY-2002"
FT   CDS             join(1472619..1472754,1472884..1473068,1473229..1473394,
FT                   1473493..1473638,1473777..1473894,1474079..1474230,
FT                   1475484..1475602,1478551..1478713,1480883..1481065,
FT                   1488762..1488906,1489147..1489236,1489324..1489702,
FT                   1490140..1490380,1490502..1490751,1490962..1491206,
FT                   1491296..1491475,1491549..1491797,1492002..1492142,
FT                   1492222..1492470)
FT                   /codon_start=1
FT                   /gene="Pcx"
FT                   /locus_tag="mCG_8397"
FT                   /product="pyruvate carboxylase"
FT                   /note="gene_id=mCG8397.1 transcript_id=mCT7254.1
FT                   protein_id=mCP12066.2"
FT                   /db_xref="GOA:G5E8R3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="MGI:MGI:97520"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8R3"
FT                   /protein_id="EDL33053.1"
FT                   /translation="MLKFQTVRGGLRLLGVRRSSSAPVASPNVRRLEYKPIKKVMVANR
FT                   GEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIK
FT                   VAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAG
FT                   VPVVPGTDSPISSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYS
FT                   EALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAT
FT                   HLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEIT
FT                   DVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRS
FT                   GEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTN
FT                   IPFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIP
FT                   VNVSPSPVDPAVPVVPIGPPPAGFRDILLREGPEGFARAVRNHQGLLLMDTTFRDAHQS
FT                   LLATRVRTHDLKKIAPYVAHNFNKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIP
FT                   NIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAG
FT                   SAGGVVEAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPAACT
FT                   MLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAVDSMSGMTSQPSMGA
FT                   LVACTKGTPLDTEVPLERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQY
FT                   TNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAE
FT                   AEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPFRSKVLKDLPRIEGRPGASLPPLNLKE
FT                   LEKDLIDRHGEEVTPEDVLSAAMYPDVFAQFKDFTATFGPLDSLNTRLFLQGPKIAEEF
FT                   EVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKD
FT                   VKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDM
FT                   TLEGDDLILEIE"
FT   gene            complement(1482805..>1485523)
FT                   /gene="Lrfn4"
FT                   /locus_tag="mCG_8381"
FT                   /note="gene_id=mCG8381.1"
FT   mRNA            complement(join(1482805..1483657,1484175..>1485523))
FT                   /gene="Lrfn4"
FT                   /locus_tag="mCG_8381"
FT                   /product="leucine rich repeat and fibronectin type III
FT                   domain containing 4"
FT                   /note="gene_id=mCG8381.1 transcript_id=mCT7277.1 created on
FT                   30-MAY-2002"
FT   CDS             complement(join(1483096..1483657,1484175..1485523))
FT                   /codon_start=1
FT                   /gene="Lrfn4"
FT                   /locus_tag="mCG_8381"
FT                   /product="leucine rich repeat and fibronectin type III
FT                   domain containing 4"
FT                   /note="gene_id=mCG8381.1 transcript_id=mCT7277.1
FT                   protein_id=mCP11985.0"
FT                   /protein_id="EDL33054.1"
FT                   /translation="MAPPLLLLLLASGAAACPLPCVCQNLSESLSTLCAHRGLLFVPPN
FT                   VDRRTVELRLADNFIQALGPPDFRNMTGLVDLTLSRNAITRIGARSFGDLESLRSLHLD
FT                   GNRLVELGSSSLRGPVNLQHLILSGNQLGRIAPGAFDDFLDSLEDLDVSYNNLRQVPWA
FT                   GIGSMPALHTLNLDHNLIDALPPGVFAQLSQLSRLDLTSNRLATLAPDPLFSRGRDAEA
FT                   SPSPLVLSFSGNPLHCNCELLWLRRLARPDDLETCASPPTLAGRYFWAVPEGEFSCEPP
FT                   LIARHTQRLWVLEGQRATLRCRALGDPVPTMHWVGPDDRLVGNSSRAWAFPNGTLEIGV
FT                   TGAGDAGAYTCIATNPAGEATARVELRVLALPHGGNTSAEGGRPGPSDIAASARTAAEG
FT                   EGTLESEPAVQVTEVTATSGLVSWGLGRPADPVWMFQIQYNSSEDETLIYRIVPASSHH
FT                   FLLKHLVPGADYDLCLLALSPAAGPSDLTATRLLGCAHFSTLPATPLCHALQAHVLGGT
FT                   LTVAVGGVLVAALLVFTVALLVRGRGAGNGRLPLKLSHVQSQTNGGTSPMPKSHPPRSP
FT                   PPRPQRSCSLDLGDTGGCYGYARRLGGAWARRSHSVHGGLLGAGCRGVGGSAERLEESV
FT                   V"
FT   assembly_gap    1485989..1486556
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   gene            complement(1493295..>1496825)
FT                   /gene="Rce1"
FT                   /locus_tag="mCG_8398"
FT                   /note="gene_id=mCG8398.3"
FT   mRNA            complement(join(1493295..1494424,1494685..1494747,
FT                   1495010..1495081,1495198..1495365,1495869..1495947,
FT                   1496197..1496280,1496377..1496479,1496617..1496817))
FT                   /gene="Rce1"
FT                   /locus_tag="mCG_8398"
FT                   /product="RCE1 homolog, prenyl protein peptidase (S.
FT                   cerevisiae), transcript variant mCT7255"
FT                   /note="gene_id=mCG8398.3 transcript_id=mCT7255.2 created on
FT                   30-MAY-2002"
FT   mRNA            complement(join(1493295..1494424,1494685..1494747,
FT                   1495010..1495081,1495198..1495365,1495869..1495947,
FT                   1496197..1496276,1496377..1496517))
FT                   /gene="Rce1"
FT                   /locus_tag="mCG_8398"
FT                   /product="RCE1 homolog, prenyl protein peptidase (S.
FT                   cerevisiae), transcript variant mCT169723"
FT                   /note="gene_id=mCG8398.3 transcript_id=mCT169723.0 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(1493777..1494424,1494685..1494747,
FT                   1495010..1495081,1495198..1495365,1495844..1495947,
FT                   1496197..1496280,1496377..1496479,1496617..>1496825))
FT                   /gene="Rce1"
FT                   /locus_tag="mCG_8398"
FT                   /product="RCE1 homolog, prenyl protein peptidase (S.
FT                   cerevisiae), transcript variant mCT193081"
FT                   /note="gene_id=mCG8398.3 transcript_id=mCT193081.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1494189..1494424,1494685..1494747,
FT                   1495010..1495081,1495198..1495365,1495869..1495947,
FT                   1496197..1496280,1496377..1496479,1496617..1496801))
FT                   /codon_start=1
FT                   /gene="Rce1"
FT                   /locus_tag="mCG_8398"
FT                   /product="RCE1 homolog, prenyl protein peptidase (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG8398.3 transcript_id=mCT7255.2
FT                   protein_id=mCP12052.2 isoform=CRA_b"
FT                   /protein_id="EDL33056.1"
FT                   /translation="MAALGGDGLRLLSVSRPERQPESAALSGPGSGLCCWVSVFSCFSL
FT                   ACSYVGSLYVWKSELPRDHPAVIKRRSTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTL
FT                   MGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLTDGLKVVLAPRSWARCLTDMR
FT                   WLRNQVIAPLTEELVFRACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSS
FT                   VGSIFVSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQK
FT                   WPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCMLLERTGASETLLCS"
FT   CDS             complement(join(1494189..1494424,1494685..1494747,
FT                   1495010..1495081,1495198..1495365,1495869..1495947,
FT                   1496197..1496256))
FT                   /codon_start=1
FT                   /gene="Rce1"
FT                   /locus_tag="mCG_8398"
FT                   /product="RCE1 homolog, prenyl protein peptidase (S.
FT                   cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG8398.3 transcript_id=mCT169723.0
FT                   protein_id=mCP92948.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q99KQ3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="MGI:MGI:1336895"
FT                   /db_xref="UniProtKB/TrEMBL:Q99KQ3"
FT                   /protein_id="EDL33057.1"
FT                   /translation="MGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLTDGLKVV
FT                   LAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCTGLGPAVFTCPLFFGVAH
FT                   FHHIIEQLRFRQSSVGSIFVSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYM
FT                   GFPAVCAALEHPQKWPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCMLLERTGASETL
FT                   LCS"
FT   CDS             complement(join(1495060..1495081,1495198..1495365,
FT                   1495844..1495947,1496197..1496280,1496377..1496479,
FT                   1496617..>1496825))
FT                   /codon_start=1
FT                   /gene="Rce1"
FT                   /locus_tag="mCG_8398"
FT                   /product="RCE1 homolog, prenyl protein peptidase (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG8398.3 transcript_id=mCT193081.0
FT                   protein_id=mCP114069.0 isoform=CRA_a"
FT                   /protein_id="EDL33055.1"
FT                   /translation="PRATGPGVMAALGGDGLRLLSVSRPERQPESAALSGPGSGLCCWV
FT                   SVFSCFSLACSYVGSLYVWKSELPRDHPAVIKRRSTSVLVVSSLSPLCVLLWRELTGIQ
FT                   PGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLTDGLKVVLGESSR
FT                   LRKSPSFLGPLPHRHALATKPSYCTADRGAGVPGLHAAHASAVHGSGPCCVHLPTLFWS
FT                   RPFSPHY"
FT   gene            complement(1496919..>1543289)
FT                   /locus_tag="mCG_140480"
FT                   /note="gene_id=mCG140480.0"
FT   mRNA            complement(join(1496919..1497067,1497148..1497374,
FT                   1498353..1498434,1508222..1508320,1513079..1513189,
FT                   1516567..1516688,1520592..1520738,1523044..1523200,
FT                   1529184..1529373,1530345..1530411,1543179..>1543289))
FT                   /locus_tag="mCG_140480"
FT                   /product="mCG140480"
FT                   /note="gene_id=mCG140480.0 transcript_id=mCT169724.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(join(1497005..1497067,1497148..1497374,
FT                   1498353..1498434,1508222..1508320,1513079..1513189,
FT                   1516567..1516688,1520592..1520738,1523044..1523200,
FT                   1529184..1529373,1530345..>1530409))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140480"
FT                   /product="mCG140480"
FT                   /note="gene_id=mCG140480.0 transcript_id=mCT169724.0
FT                   protein_id=mCP92913.0"
FT                   /protein_id="EDL33058.1"
FT                   /translation="NEPTLRLDNGVTLVVGFQRYVSKPKLNWSEAHCSRIHPVLGHPAP
FT                   LFIPDAKADTGLLGELTLTPAAALCPSPKGFSSQLCRISSPYIFLYGPLGLPLLSSDQD
FT                   QPSTAVFRDTSYFIDWKKYNLFMVPNLDLNLDTQSVLPDVNYKAESPEGNQSQNMNAQG
FT                   PALLLFLFVDFQSDVPVQQAKIWGLHTLLTAHLSAILSESRSTVQQSIQSAVDQVWQLY
FT                   HHDAKTQQRLQASLSVAVNSIMSVLTGSTRSSFRKTCLQALEAADTQEFGVKLHRIFYD
FT                   ITQHQFLKHCSCDTEQKHLTPEKNISAQNTKDQHKNIAQEFPEESIGQAENKRPKRGSP
FT                   NHGREESRVLGSARDRSPPKSATRDRELTEVSLTARGSQTQAAHGRAQAAEAASPAGGL
FT                   EDLWLQEVSNLSEWLNPGHRS"
FT   assembly_gap    1568238..1568257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1587081..1587732
FT                   /estimated_length=652
FT                   /gap_type="unknown"
FT   gene            <1589792..1623297
FT                   /gene="Spnb3"
FT                   /locus_tag="mCG_8401"
FT                   /note="gene_id=mCG8401.1"
FT   mRNA            join(<1589792..1589948,1595031..1595182,1595581..1595754,
FT                   1596849..1596940,1597088..1597168,1597530..1597645,
FT                   1600010..1600122,1600250..1600437,1602221..1602338,
FT                   1602873..1603031,1603335..1603637,1604601..1604754,
FT                   1604986..1605856,1608289..1608426,1608758..1609514,
FT                   1610054..1610256,1610538..1610628,1610800..1610946,
FT                   1613280..1613543,1614995..1615219,1615413..1615502,
FT                   1616056..1616316,1616405..1616535,1616727..1616931,
FT                   1617513..1617887,1618659..1618903,1619006..1619144,
FT                   1619541..1619625,1619885..1620081,1620349..1620491,
FT                   1620581..1620656,1620730..1620780,1620968..1621188,
FT                   1621428..1621601,1622096..1622138,1622448..1623297)
FT                   /gene="Spnb3"
FT                   /locus_tag="mCG_8401"
FT                   /product="spectrin beta 3"
FT                   /note="gene_id=mCG8401.1 transcript_id=mCT7247.2 created on
FT                   30-MAY-2002"
FT   CDS             join(1589792..1589948,1595031..1595182,1595581..1595754,
FT                   1596849..1596940,1597088..1597168,1597530..1597645,
FT                   1600010..1600122,1600250..1600437,1602221..1602338,
FT                   1602873..1603031,1603335..1603637,1604601..1604754,
FT                   1604986..1605856,1608289..1608426,1608758..1609514,
FT                   1610054..1610256,1610538..1610628,1610800..1610946,
FT                   1613280..1613543,1614995..1615219,1615413..1615502,
FT                   1616056..1616316,1616405..1616535,1616727..1616931,
FT                   1617513..1617887,1618659..1618903,1619006..1619144,
FT                   1619541..1619625,1619885..1620081,1620349..1620491,
FT                   1620581..1620656,1620730..1620780,1620968..1621188,
FT                   1621428..1621601,1622096..1622138,1622448..1622675)
FT                   /codon_start=1
FT                   /gene="Spnb3"
FT                   /locus_tag="mCG_8401"
FT                   /product="spectrin beta 3"
FT                   /note="gene_id=mCG8401.1 transcript_id=mCT7247.2
FT                   protein_id=mCP11973.2"
FT                   /db_xref="GOA:Q68FG2"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="MGI:MGI:1313261"
FT                   /db_xref="UniProtKB/TrEMBL:Q68FG2"
FT                   /protein_id="EDL33059.1"
FT                   /translation="MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFER
FT                   SRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLP
FT                   KPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQ
FT                   DISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDL
FT                   LDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFS
FT                   KMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGV
FT                   QNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAW
FT                   ERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELA
FT                   AVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLR
FT                   QMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELV
FT                   EADIAVQAERVRAVSASALRFCDPGKEYRPCDPQLVSERVATLEQSYEALCELAATRRA
FT                   RLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGVLRLLNKHAALRGEMSGRL
FT                   GPLKLTLEQGQQLVAEGHPGANQASTRAAELQAQWERLEALAEERAQQLAQAASLYQFQ
FT                   ADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQAAA
FT                   LPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEK
FT                   EQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVNDIAEQLLKASPPGKDRII
FT                   GTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGN
FT                   DLAGVLALQRKLAGTERDLEAISARVGELTQEANALAAGHPAQAPAINTRLGEVQAGWE
FT                   DLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQH
FT                   AALRGEVERAQSEYSRLRTLGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQG
FT                   RLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANG
FT                   ERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFL
FT                   QDCQELRLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGREL
FT                   TLEKPELKVVVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWLESL
FT                   QAQLHSDDYGKDLTSVNILLKKQQMLEREMAVREKEVEAIQAQAQALAQEDQSAGEVER
FT                   TSRAVEEKFRALCQPMKERCRRLHASREQHQFHRDVEDEILWVTERLPMASSLEHGKDL
FT                   PSVQLLMKKNQTLQKEIQGHEPRIADLKERQRTLGTAAAGPELAELQEMWKRLSHELEL
FT                   RGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALA
FT                   DYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYASLKELAGERRERLQEHLRLC
FT                   QLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSKDTSTIGQERVDSANA
FT                   LANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALA
FT                   RVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGQRLQKAYAGDK
FT                   AEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQ
FT                   ERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGQELLARSHYAAEEISEKLSQLQ
FT                   SRRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESL
FT                   IKRHEAFQKSAVAWEERFSALEKLTALEERENERKRKREEEERRKQPPTSEPMASQPEG
FT                   SLVDGQRVPDTAWDGTQSKLPPSTQAPSVNGVCTDTDSSQPLLEQQRLEQSNVPEGPGS
FT                   GTGDESSGPRGERQTLPRGPAPSPMPQSRSSEAAHGATLPTRGPELSAQEQMEGMLCRK
FT                   QEMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGVPYHGEVPVSLARAQGSVAF
FT                   DYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSAPGESEEPVVPSAS
FT                   RGLTRAMTMPPVSQPEGSIVLRSKDGREREREKRFSFFKKNK"
FT   gene            complement(1613861..1682830)
FT                   /locus_tag="mCG_8382"
FT                   /note="gene_id=mCG8382.2"
FT   mRNA            complement(join(1613861..1615814,1665026..1665219,
FT                   1682389..1682830))
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, transcript variant mCT185645"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT185645.0 created
FT                   on 11-JUN-2003"
FT   gene            1627488..1636992
FT                   /locus_tag="mCG_8380"
FT                   /note="gene_id=mCG8380.2"
FT   mRNA            join(1627488..1627608,1628193..1628616,1632921..1633591,
FT                   1636288..1636992)
FT                   /locus_tag="mCG_8380"
FT                   /product="mCG8380, transcript variant mCT7275"
FT                   /note="gene_id=mCG8380.2 transcript_id=mCT7275.2 created on
FT                   30-MAY-2002"
FT   mRNA            join(1627488..1627608,1628193..1628616,1632921..1633820)
FT                   /locus_tag="mCG_8380"
FT                   /product="mCG8380, transcript variant mCT169716"
FT                   /note="gene_id=mCG8380.2 transcript_id=mCT169716.0 created
FT                   on 30-MAY-2002"
FT   CDS             join(1628205..1628616,1632921..1633582)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8380"
FT                   /product="mCG8380, isoform CRA_a"
FT                   /note="gene_id=mCG8380.2 transcript_id=mCT169716.0
FT                   protein_id=mCP92983.0 isoform=CRA_a"
FT                   /protein_id="EDL33066.1"
FT                   /translation="MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDK
FT                   TAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPV
FT                   IECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCY
FT                   RCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYK
FT                   RYRVRSYEAVAAAAAASAYNYAEQTMSHLPQVQSSAVPSHLNSTSVDPYDRHLLQNSGS
FT                   AATSAAMAAAASSSYYGRDRSPLRRNAAVLPAVGEGYGYGPESEMSQASAATRNSLYDM
FT                   ARYEREQYVDRTRYSAF"
FT   CDS             join(1628205..1628616,1632921..1633582)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8380"
FT                   /product="mCG8380, isoform CRA_a"
FT                   /note="gene_id=mCG8380.2 transcript_id=mCT7275.2
FT                   protein_id=mCP11980.2 isoform=CRA_a"
FT                   /protein_id="EDL33067.1"
FT                   /translation="MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDK
FT                   TAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPV
FT                   IECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCY
FT                   RCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYK
FT                   RYRVRSYEAVAAAAAASAYNYAEQTMSHLPQVQSSAVPSHLNSTSVDPYDRHLLQNSGS
FT                   AATSAAMAAAASSSYYGRDRSPLRRNAAVLPAVGEGYGYGPESEMSQASAATRNSLYDM
FT                   ARYEREQYVDRTRYSAF"
FT   assembly_gap    1647870..1647889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1655533..1656777,1663609..1664031,
FT                   1665026..1665183))
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, transcript variant mCT169696"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT169696.0 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(1655533..1656777,1658571..1659252,
FT                   1663609..1664031,1665026..1665183))
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, transcript variant mCT134642"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT134642.1 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(1656758..1656777,1663609..1664020))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, isoform CRA_b"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT169696.0
FT                   protein_id=mCP92934.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5CZX8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1100865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5CZX8"
FT                   /protein_id="EDL33061.1"
FT                   /translation="MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDK
FT                   TAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPV
FT                   IECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGGMCVG"
FT   CDS             complement(join(1658579..1659252,1663609..1664020))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, isoform CRA_a"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT134642.1
FT                   protein_id=mCP68354.1 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZN14"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1100865"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN14"
FT                   /protein_id="EDL33060.1"
FT                   /translation="MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDK
FT                   TAAEDAIRNLHHYKLHGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPV
FT                   IECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCY
FT                   RCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNTYGALDAYY
FT                   KRCRAARSYEAVAAAAASAYSNYAEQTLSQLPQVQNTAMASHLTSTSLDPYNRHLLPPS
FT                   GAAAAAAAAAACTAASTSYYGRDRSPLRRATGPVLTVGEGYGYGHDSELSQASAAARNS
FT                   LYDMARYEREQYADRARYSAF"
FT   mRNA            complement(join(1662368..1664031,1664882..1665219,
FT                   1682389..1682821))
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, transcript variant mCT185646"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT185646.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(1665200..1665219,1682389..1682725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, isoform CRA_d"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT185645.0
FT                   protein_id=mCP106903.0 isoform=CRA_d"
FT                   /db_xref="GOA:J3QN51"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:5439461"
FT                   /db_xref="UniProtKB/TrEMBL:J3QN51"
FT                   /protein_id="EDL33063.1"
FT                   /translation="MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMREN
FT                   AGAVRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGR
FT                   VIECDVVKGNWRSG"
FT   CDS             complement(join(1665200..1665219,1682389..1682725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, isoform CRA_d"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT185646.0
FT                   protein_id=mCP106904.0 isoform=CRA_d"
FT                   /db_xref="GOA:J3QN51"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:5439461"
FT                   /db_xref="UniProtKB/TrEMBL:J3QN51"
FT                   /protein_id="EDL33064.1"
FT                   /translation="MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMREN
FT                   AGAVRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGR
FT                   VIECDVVKGNWRSG"
FT   mRNA            complement(join(1672136..1673016,1673762..1675226,
FT                   1682389..1682821))
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, transcript variant mCT7271"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT7271.1 created on
FT                   11-JUN-2003"
FT   mRNA            complement(join(1672136..1675226,1682389..1682821))
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, transcript variant mCT169717"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT169717.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(1672809..1673016,1673762..1675226,
FT                   1682389..1682725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, isoform CRA_e"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT7271.1
FT                   protein_id=mCP12039.2 isoform=CRA_e"
FT                   /protein_id="EDL33065.1"
FT                   /translation="MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMREN
FT                   AGAVRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGR
FT                   VIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPALAIQSGD
FT                   KTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPP
FT                   RASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMAAQAASYRAQPSVSL
FT                   GAPYRGQLASPSSQSAAASSLGPYGGVQPSASALSTYGGQAAAASSLNSYGAQGSSLAS
FT                   YGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQA
FT                   ASYSAQPSASYSAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMA
FT                   GSYGAQPVVQTQLNSYGAQASIGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYR
FT                   TQSSASLAASYAAQQHPQAAASYRGQPGSAYDGTGQPSAAYLSMSQGAVANANSTPPPY
FT                   ERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDY
FT                   RRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM"
FT   CDS             complement(join(1673719..1675226,1682389..1682725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8382"
FT                   /product="mCG8382, isoform CRA_c"
FT                   /note="gene_id=mCG8382.2 transcript_id=mCT169717.0
FT                   protein_id=mCP92967.0 isoform=CRA_c"
FT                   /db_xref="GOA:E9QL13"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1929092"
FT                   /db_xref="UniProtKB/TrEMBL:E9QL13"
FT                   /protein_id="EDL33062.1"
FT                   /translation="MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMREN
FT                   AGAVRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGR
FT                   VIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPALAIQSGD
FT                   KTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPP
FT                   RASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMAAQAASYRAQPSVSL
FT                   GAPYRGQLASPSSQSAAASSLGPYGGVQPSASALSTYGGQAAAASSLNSYGAQGSSLAS
FT                   YGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQA
FT                   ASYSAQPSASYSAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMA
FT                   GSYGAQPVVQTQLNSYGAQASIGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYR
FT                   TQSSASLAASYAAQQHPQAAASYRGQPGSAYDGTGQPSAAYLSMSQGAVANANSTPPPY
FT                   ERTRLSPPRASYDDPYKKAVAMSKRYCMPPPPQPLAGA"
FT   assembly_gap    1688116..1690458
FT                   /estimated_length=2343
FT                   /gap_type="unknown"
FT   assembly_gap    1694948..1694967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1696420..1710361)
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /note="gene_id=mCG8389.2"
FT   mRNA            complement(join(1696420..1696718,1696824..1696927,
FT                   1696998..1697075,1703887..1703947,1704395..1704501,
FT                   1705294..1705364,1709886..1709958,1710252..1710361))
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /product="copper chaperone for superoxide dismutase,
FT                   transcript variant mCT169718"
FT                   /note="gene_id=mCG8389.2 transcript_id=mCT169718.0 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(1696420..1696718,1696824..1696927,
FT                   1696998..1697075,1703887..1703947,1704395..1704572,
FT                   1705294..1705364,1709886..1709958,1710252..1710361))
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /product="copper chaperone for superoxide dismutase,
FT                   transcript variant mCT169720"
FT                   /note="gene_id=mCG8389.2 transcript_id=mCT169720.0 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(1696420..1696675,1696998..1697075,
FT                   1703887..1703947,1704395..1704572,1705248..1705364,
FT                   1709886..1709958,1710252..1710361))
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /product="copper chaperone for superoxide dismutase,
FT                   transcript variant mCT169719"
FT                   /note="gene_id=mCG8389.2 transcript_id=mCT169719.0 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(1696420..1696718,1696824..1696927,
FT                   1696998..1697075,1703887..1703947,1704395..1704572,
FT                   1705227..1705364,1709886..1709958,1710252..1710361))
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /product="copper chaperone for superoxide dismutase,
FT                   transcript variant mCT7266"
FT                   /note="gene_id=mCG8389.2 transcript_id=mCT7266.2 created on
FT                   30-MAY-2002"
FT   CDS             complement(join(1696565..1696718,1696824..1696927,
FT                   1696998..1697075,1703887..1703947,1704395..1704501,
FT                   1705294..1705364,1709886..1709958,1710252..1710290))
FT                   /codon_start=1
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /product="copper chaperone for superoxide dismutase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8389.2 transcript_id=mCT169718.0
FT                   protein_id=mCP92916.0 isoform=CRA_a"
FT                   /protein_id="EDL33068.1"
FT                   /translation="MASKSGDGGTVCALEFAVQMSCQSCVDAVHKTLKGVAGVQNVDVQ
FT                   LENQMVLVQTTLPSQELSSELCLIEGTIDGLEPGLHGLHVHQYGDLTRDCNSCGDHFNP
FT                   DGASHGGPQDTDRHRGDLGNVRAEAGGRATFRIEDKQLKVWDVIGRSLVIDEGEDDLGR
FT                   GGHPLSKITGNSGKRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGQGRKDSA
FT                   QPPAHL"
FT   CDS             complement(join(1696565..1696675,1696998..1697075,
FT                   1703887..1703947,1704395..1704572,1705248..1705364,
FT                   1709886..1709958,1710252..1710290))
FT                   /codon_start=1
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /product="copper chaperone for superoxide dismutase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8389.2 transcript_id=mCT169719.0
FT                   protein_id=mCP92936.0 isoform=CRA_b"
FT                   /protein_id="EDL33069.1"
FT                   /translation="MASKSGDGGTVCALEFAVQMSCQSCVDAVHKTLKGVAGVQNVDVQ
FT                   LENQMVLVQTTLPSQEVQALLESTGRQAVLKENLGAAVAILEGCGSIQGVVRFLQLSSE
FT                   LCLIEGTIDGLEPGLHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDRHRGDLGN
FT                   VRAEAGGRATFRIEDKQLKNPKQICSCDGLTIWEERGRPIAGQGRKDSAQPPAHL"
FT   CDS             complement(join(1696565..1696718,1696824..1696927,
FT                   1696998..1697075,1703887..1703947,1704395..1704572,
FT                   1705227..1705364,1709886..1709958,1710252..1710290))
FT                   /codon_start=1
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /product="copper chaperone for superoxide dismutase,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG8389.2 transcript_id=mCT7266.2
FT                   protein_id=mCP12051.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q543K2"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR024142"
FT                   /db_xref="MGI:MGI:1333783"
FT                   /db_xref="UniProtKB/TrEMBL:Q543K2"
FT                   /protein_id="EDL33071.1"
FT                   /translation="MASKSGDGGTVCALEFAVQMSCQSCVDAVHKTLKGVAGVQNVDVQ
FT                   LENQMVLVQTTLPSQEVQALLESTGRQAVLKGMGSSQLQNLGAAVAILEGCGSIQGVVR
FT                   FLQLSSELCLIEGTIDGLEPGLHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDR
FT                   HRGDLGNVRAEAGGRATFRIEDKQLKVWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSG
FT                   KRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGQGRKDSAQPPAHL"
FT   CDS             complement(join(1704480..1704572,1705294..1705364,
FT                   1709886..1709958,1710252..1710290))
FT                   /codon_start=1
FT                   /gene="Ccs"
FT                   /locus_tag="mCG_8389"
FT                   /product="copper chaperone for superoxide dismutase,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG8389.2 transcript_id=mCT169720.0
FT                   protein_id=mCP92949.0 isoform=CRA_c"
FT                   /protein_id="EDL33070.1"
FT                   /translation="MASKSGDGGTVCALEFAVQMSCQSCVDAVHKTLKGVAGVQNVDVQ
FT                   LENQMVLVQTTLPSQERIWEQQWPFWRAVAPYRGWSASYSYPLNSA"
FT   gene            1710468..1713578
FT                   /gene="Ccdc87"
FT                   /locus_tag="mCG_62950"
FT                   /note="gene_id=mCG62950.1"
FT   mRNA            1710468..1713578
FT                   /gene="Ccdc87"
FT                   /locus_tag="mCG_62950"
FT                   /product="coiled-coil domain containing 87"
FT                   /note="gene_id=mCG62950.1 transcript_id=mCT63133.2 created
FT                   on 30-MAY-2002"
FT   CDS             1710537..1713104
FT                   /codon_start=1
FT                   /gene="Ccdc87"
FT                   /locus_tag="mCG_62950"
FT                   /product="coiled-coil domain containing 87"
FT                   /note="gene_id=mCG62950.1 transcript_id=mCT63133.2
FT                   protein_id=mCP33743.1"
FT                   /db_xref="GOA:Q8CDL9"
FT                   /db_xref="MGI:MGI:3026882"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CDL9"
FT                   /protein_id="EDL33072.1"
FT                   /translation="MEPHSQEPDLKPIYHRLLSPLSLFPSKAKPPPEPPKRPSQDATPL
FT                   QSIPLAKLKVGPLCRQVSKRLASSGRAARVTAKDRLRLTEVILEELKCNWREPPIEPIL
FT                   DYENNQKLRQRLESYVLISSEQLFVRYLHLLVTLPTSRRVFTESATLSRLAVNLARDCT
FT                   VFLTSPDVYRCLLADFQTLLNLKHAQGGIVKLRPPPCPPGTFKLCPIPWPHSTGLDHMP
FT                   CSSLNLNYLVQLSRPYDFPSEPEPDPVEELKSIPQLKSRQQLLWVPSMIKDKEIESRPS
FT                   PMVPLPSHSPSSESHQFPTSPVHSWLQRGQSMPCLHEGWSLADELCLLPPSPHPLTPLI
FT                   LASESKPLPFRDIVAEDLKQKMKIMRMEWSRYSLLDSGLPPLLGVLTRRLTAQHHLEKL
FT                   QQMIKSLQEEEASGKWDLQPPRIIPLHPQPVTVALKVHDQVIVQVATVQLSERYFNDSF
FT                   HVEGAGVLYNHLTGELDGKAIEEMDADRLVGNTTGEVYKELMSRVSVSHLSFEEGDQIE
FT                   PSADKDWSSYLASSFLHQDKHMPIINRNLVGFYSRRTSTPKPVPEKVPSLTLLPRHKSW
FT                   DKRPNRHGVWMNWLKPSVSSEDYFKYLSFQESDFLHVIFQMYEKEAPVEVPVPVQEYLD
FT                   IQQPPPLLQDEELEFMQGKWDWSSVIEDGSGPGRAYIHNLQQRLKRLWVMLEVPEQNRL
FT                   DMVIKYSSNARLQQLPALIKAWEQVLKPIQKRESLLGRLEWFEQQASDPNRFFQKPDLL
FT                   MNRLLEENRFRSYLQRKLNRMESNLVSLLERIESVFGEPVTFKGRSYLKKMKQDKVEML
FT                   YWLQQQRRIRNLTQAQKTFRQSCTFTGSSSQALVAPGNTPTTH"
FT   gene            1726176..1731958
FT                   /gene="Ctsf"
FT                   /locus_tag="mCG_8393"
FT                   /note="gene_id=mCG8393.2"
FT   mRNA            join(1726176..1726533,1726745..1726843,1727117..1727201,
FT                   1727294..1727355,1727559..1727634,1729017..1729130,
FT                   1729234..1729379,1729463..1729559,1729639..1729719,
FT                   1730450..1730569,1730649..1730713,1730805..1730895,
FT                   1731297..1731355,1731438..1731958)
FT                   /gene="Ctsf"
FT                   /locus_tag="mCG_8393"
FT                   /product="cathepsin F, transcript variant mCT7259"
FT                   /note="gene_id=mCG8393.2 transcript_id=mCT7259.2 created on
FT                   30-MAY-2002"
FT   mRNA            join(<1726268..1726843,1727117..1727201,1727294..1727355,
FT                   1727559..1727634,1729017..1729130,1729234..1729379,
FT                   1729463..1729559,1729639..1729719,1730450..1730569,
FT                   1730649..1730713,1730805..1730895,1731297..1731355,
FT                   1731438..1731958)
FT                   /gene="Ctsf"
FT                   /locus_tag="mCG_8393"
FT                   /product="cathepsin F, transcript variant mCT193073"
FT                   /note="gene_id=mCG8393.2 transcript_id=mCT193073.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(1726315..1726533,1726745..1726843,1727117..1727201,
FT                   1727294..1727355,1727559..1727634,1729017..1729130,
FT                   1729234..1729379,1729463..1729559,1729639..1729719,
FT                   1730450..1730569,1730649..1730713,1730805..1730895,
FT                   1731297..1731355,1731438..1731512)
FT                   /codon_start=1
FT                   /gene="Ctsf"
FT                   /locus_tag="mCG_8393"
FT                   /product="cathepsin F, isoform CRA_b"
FT                   /note="gene_id=mCG8393.2 transcript_id=mCT7259.2
FT                   protein_id=mCP11994.2 isoform=CRA_b"
FT                   /protein_id="EDL33074.1"
FT                   /translation="MAPLLQLLWLLTLLSTVALSPVPAKPWADDEQAWNLSSQELLAPA
FT                   RFALDMYNYGRAAGTRAVLGAVRGRVRRAGQGSLFSLEATLEEPPCNDPLVCPLPETKK
FT                   TVLCSFEVLEELKEHLLLRRDCSPVNAKVTEFRNATFSSFLPLLDKDPLPQDFSVKMAP
FT                   LFKDFMTTYNRTYESREEAQWRLTVFARNMIRAQKIQALDRGTAQYGITKFSDLTEEEF
FT                   HTIYLNPLLQKESGRKMSPAKSINDLAPPEWDWRKKGAVTEVKNQGMCGSCWAFSVTGN
FT                   VEGQWFLNRGTLLSLSEQELLDCDKVDKACLGGLPSNAYAAIKNLGGLETEDDYGYQGH
FT                   VQTCNFSAQMAKVYINDSVELSRNENKIAAWLAQKGPISVAINAFGMQFYRHGIAHPFR
FT                   PLCSPWFIDHAVLLVGYGNRSNIPYWAIKNSWGSDWGEEGYYYLYRGSGACGVNTMASS
FT                   AVVN"
FT   CDS             join(<1726661..1726843,1727117..1727201,1727294..1727355,
FT                   1727559..1727634,1729017..1729130,1729234..1729379,
FT                   1729463..1729559,1729639..1729719,1730450..1730569,
FT                   1730649..1730713,1730805..1730895,1731297..1731355,
FT                   1731438..1731512)
FT                   /codon_start=1
FT                   /gene="Ctsf"
FT                   /locus_tag="mCG_8393"
FT                   /product="cathepsin F, isoform CRA_a"
FT                   /note="gene_id=mCG8393.2 transcript_id=mCT193073.0
FT                   protein_id=mCP114068.0 isoform=CRA_a"
FT                   /protein_id="EDL33073.1"
FT                   /translation="GGTDGQWSPKRSKGGGDGWASPNFFSIQAGQGSLFSLEATLEEPP
FT                   CNDPLVCPLPETKKTVLCSFEVLEELKEHLLLRRDCSPVNAKVTEFRNATFSSFLPLLD
FT                   KDPLPQDFSVKMAPLFKDFMTTYNRTYESREEAQWRLTVFARNMIRAQKIQALDRGTAQ
FT                   YGITKFSDLTEEEFHTIYLNPLLQKESGRKMSPAKSINDLAPPEWDWRKKGAVTEVKNQ
FT                   GMCGSCWAFSVTGNVEGQWFLNRGTLLSLSEQELLDCDKVDKACLGGLPSNAYAAIKNL
FT                   GGLETEDDYGYQGHVQTCNFSAQMAKVYINDSVELSRNENKIAAWLAQKGPISVAINAF
FT                   GMQFYRHGIAHPFRPLCSPWFIDHAVLLVGYGNRSNIPYWAIKNSWGSDWGEEGYYYLY
FT                   RGSGACGVNTMASSAVVN"
FT   gene            complement(1732270..1748828)
FT                   /gene="Actn3"
FT                   /locus_tag="mCG_8399"
FT                   /note="gene_id=mCG8399.1"
FT   mRNA            complement(join(1732270..1732550,1732632..1732790,
FT                   1733217..1733282,1733371..1733517,1734181..1734360,
FT                   1734456..1734590,1735017..1735199,1735471..1735611,
FT                   1735699..1735807,1736345..1736495,1738585..1738732,
FT                   1738857..1739089,1740268..1740354,1741823..1741904,
FT                   1741993..1742071,1742508..1742595,1742682..1742768,
FT                   1743150..1743269,1743453..1743567,1748655..1748828))
FT                   /gene="Actn3"
FT                   /locus_tag="mCG_8399"
FT                   /product="actinin alpha 3"
FT                   /note="gene_id=mCG8399.1 transcript_id=mCT7256.1 created on
FT                   30-MAY-2002"
FT   CDS             complement(join(1732392..1732550,1732632..1732790,
FT                   1733217..1733282,1733371..1733517,1734181..1734360,
FT                   1734456..1734590,1735017..1735199,1735471..1735611,
FT                   1735699..1735807,1736345..1736495,1738585..1738732,
FT                   1738857..1739089,1740268..1740354,1741823..1741904,
FT                   1741993..1742071,1742508..1742595,1742682..1742768,
FT                   1743150..1743269,1743453..1743567,1748655..1748798))
FT                   /codon_start=1
FT                   /gene="Actn3"
FT                   /locus_tag="mCG_8399"
FT                   /product="actinin alpha 3"
FT                   /note="gene_id=mCG8399.1 transcript_id=mCT7256.1
FT                   protein_id=mCP12101.2"
FT                   /protein_id="EDL33075.1"
FT                   /translation="MMMVMQPEGLGAGEGPFSGGGGGEYMEQEEDWDRDLLLDPAWEKQ
FT                   QRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIA
FT                   NVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGL
FT                   LLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAF
FT                   EVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQELLEWIRRTVPWLE
FT                   NRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRLSHRPAFMPSE
FT                   GKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLHEAWTRGKEEM
FT                   LNQHDYESASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYHEAASVNSR
FT                   CQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDGAIEDLQD
FT                   VWLVHSVEETQSLLTAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRPKSGNPYI
FT                   TLSSQDINNKWDTVRKLVPSRDQTLQEELARQQVNERLRRQFAAQANAIGPWIQGKVEE
FT                   VGRLAAGLAGSLEEQMAGLRQQEQNIINYKSNIDRLEGDHQLLQESLVFDNKHTVYSME
FT                   HIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMMEPDD
FT                   FRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVASFK
FT                   ILAGDKNYITPEELRRELPAEQAEYCIRRMAPYKGSGAPSGALDYVAFSSALYGESDL"
FT   assembly_gap    1739296..1739764
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    1747423..1747696
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   gene            1749633..1756306
FT                   /gene="Zdhhc24"
FT                   /locus_tag="mCG_8385"
FT                   /note="gene_id=mCG8385.2"
FT   mRNA            join(1749633..1749973,1751066..1751343,1754378..1756305)
FT                   /gene="Zdhhc24"
FT                   /locus_tag="mCG_8385"
FT                   /product="zinc finger, DHHC domain containing 24,
FT                   transcript variant mCT7268"
FT                   /note="gene_id=mCG8385.2 transcript_id=mCT7268.1 created on
FT                   30-MAY-2002"
FT   mRNA            join(<1749666..1749749,1751066..1751343,1754378..1756306)
FT                   /gene="Zdhhc24"
FT                   /locus_tag="mCG_8385"
FT                   /product="zinc finger, DHHC domain containing 24,
FT                   transcript variant mCT193101"
FT                   /note="gene_id=mCG8385.2 transcript_id=mCT193101.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1749667..1749749,1751066..1751343,1754378..1754673)
FT                   /codon_start=1
FT                   /gene="Zdhhc24"
FT                   /locus_tag="mCG_8385"
FT                   /product="zinc finger, DHHC domain containing 24, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG8385.2 transcript_id=mCT193101.0
FT                   protein_id=mCP114075.0 isoform=CRA_a"
FT                   /protein_id="EDL33076.1"
FT                   /translation="RSESRWVRPWGSPGQLGAQKERPRGCHCYCYQCQSQVPPRSGHCS
FT                   ACRVCILRRDHHCRLLGCCVGFHNYRPFLCLLLHSAGVLLHISVLLGPALSALLQAHSA
FT                   LYTVALLLLPWLMLLTGKVSLAQFALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWE
FT                   WARGHHCYDLGTCHNLQAALGPRWALVWFWPFLASPLPGDGISFQTPGDVGLVTS"
FT   CDS             join(1749693..1749973,1751066..1751343,1754378..1754673)
FT                   /codon_start=1
FT                   /gene="Zdhhc24"
FT                   /locus_tag="mCG_8385"
FT                   /product="zinc finger, DHHC domain containing 24, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG8385.2 transcript_id=mCT7268.1
FT                   protein_id=mCP11971.2 isoform=CRA_b"
FT                   /protein_id="EDL33077.1"
FT                   /translation="MGESWAARGAEGAPARMPLVLTALWAAVVVLELAYVMVLGPGPPP
FT                   LGPLARALQLALAAYQLLNLLGNVVLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVP
FT                   PRSGHCSACRVCILRRDHHCRLLGCCVGFHNYRPFLCLLLHSAGVLLHISVLLGPALSA
FT                   LLQAHSALYTVALLLLPWLMLLTGKVSLAQFALAFVVDTCVAGALLCGAGLLFHGMLLL
FT                   RGQTTWEWARGHHCYDLGTCHNLQAALGPRWALVWFWPFLASPLPGDGISFQTPGDVGL
FT                   VTS"
FT   gene            complement(1759660..>1779725)
FT                   /locus_tag="mCG_8379"
FT                   /note="gene_id=mCG8379.1"
FT   mRNA            complement(join(1759660..1761672,1761904..1761990,
FT                   1762565..1762699,1763799..1763932,1765170..1765328,
FT                   1765872..1765941,1770369..1770527,1770663..1770783,
FT                   1772286..1772392,1773578..1773709,1775930..1776002,
FT                   1776101..1776139,1776233..1776279,1776789..1777061,
FT                   1779072..1779106,1779229..1779305,1779643..>1779725))
FT                   /locus_tag="mCG_8379"
FT                   /product="mCG8379"
FT                   /note="gene_id=mCG8379.1 transcript_id=mCT7274.2 created on
FT                   30-MAY-2002"
FT   CDS             complement(join(1761586..1761672,1761904..1761990,
FT                   1762565..1762699,1763799..1763932,1765170..1765328,
FT                   1765872..1765941,1770369..1770527,1770663..1770783,
FT                   1772286..1772392,1773578..1773709,1775930..1776002,
FT                   1776101..1776139,1776233..1776279,1776789..1777061,
FT                   1779072..1779106,1779229..1779305,1779643..1779725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8379"
FT                   /product="mCG8379"
FT                   /note="gene_id=mCG8379.1 transcript_id=mCT7274.2
FT                   protein_id=mCP11961.2"
FT                   /protein_id="EDL33078.1"
FT                   /translation="MAELVAKATPGKMAAASSSDSDSGRAESNEANSKWLDAHYDPMAN
FT                   IHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATF
FT                   LMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLT
FT                   LKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITTMTTLKKNL
FT                   ADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLTAACRN
FT                   GSIYILRRDSKHPKYCIELSAQPVGLVRVHKVLVVGSTQESLHGFTHKGKKLWTVQMPA
FT                   AILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVIHAPDAVTSLCFGRYGREDNT
FT                   LIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGT
FT                   AMHRTFQTDLYLLRLRAARAYVQALESSLSPMSTTAREPLKLHAVVQGLGPTFKLTLHL
FT                   QNTSTARPVLGLHVCFLYNKALYALPQAFFKVPLLVPGLSYPLETFVESLSSKGISDMI
FT                   KVLVLREGQSAPLLSAHINMPVSEGLAAA"
FT   assembly_gap    1767470..1767489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1768524..1768543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1769634..1769653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1780014..>1801107)
FT                   /gene="Dpp3"
FT                   /locus_tag="mCG_8402"
FT                   /note="gene_id=mCG8402.3"
FT   mRNA            complement(join(1780014..1780883,1782931..1783093,
FT                   1786866..1787045,1787673..1787793,1787903..1788027,
FT                   1788112..1788174,1789372..1789464,1789791..1789903,
FT                   1789985..1790179,1790965..1791023,1791112..1791242,
FT                   1791337..1791467,1794219..1794312,1795403..1795477,
FT                   1796148..1796285,1796765..1796854,1799640..1799914,
FT                   1800803..1800819))
FT                   /gene="Dpp3"
FT                   /locus_tag="mCG_8402"
FT                   /product="dipeptidylpeptidase 3, transcript variant
FT                   mCT7248"
FT                   /note="gene_id=mCG8402.3 transcript_id=mCT7248.2 created on
FT                   31-MAY-2002"
FT   gene            1780015..1781246
FT                   /locus_tag="mCG_148131"
FT                   /note="gene_id=mCG148131.0"
FT   mRNA            1780015..1781246
FT                   /locus_tag="mCG_148131"
FT                   /product="mCG148131"
FT                   /note="gene_id=mCG148131.0 transcript_id=mCT188394.0
FT                   created on 13-JAN-2004"
FT   mRNA            complement(join(1780318..1780883,1782931..1783093,
FT                   1786866..1787045,1787673..1787793,1787903..1788027,
FT                   1788112..1788174,1789372..1789464,1789791..1789903,
FT                   1789985..1790179,1790965..1791023,1791112..1791242,
FT                   1791337..1791467,1794219..1794312,1795403..1795477,
FT                   1796148..1796285,1796765..1796854,1799640..1799914,
FT                   1801075..>1801107))
FT                   /gene="Dpp3"
FT                   /locus_tag="mCG_8402"
FT                   /product="dipeptidylpeptidase 3, transcript variant
FT                   mCT193056"
FT                   /note="gene_id=mCG8402.3 transcript_id=mCT193056.0 created
FT                   on 09-MAR-2004"
FT   CDS             1780504..1780851
FT                   /codon_start=1
FT                   /locus_tag="mCG_148131"
FT                   /product="mCG148131"
FT                   /note="gene_id=mCG148131.0 transcript_id=mCT188394.0
FT                   protein_id=mCP108418.0"
FT                   /db_xref="MGI:MGI:3704488"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4Z8"
FT                   /protein_id="EDL33082.1"
FT                   /translation="MAVQIQKLRTYGKLQSADKWKGFASPPSAEVAPKSKLLPLPPLTP
FT                   NHTQLRATDSPGLTKRGETTQIFSSLARWGLLGLVPPESGICCSQLDKNLLQLGPILGK
FT                   PLTEGADETSG"
FT   CDS             complement(join(1780708..1780883,1782931..1783093,
FT                   1786866..1787045,1787673..1787793,1787903..1788027,
FT                   1788112..1788174,1789372..1789464,1789791..1789903,
FT                   1789985..1790179,1790965..1791023,1791112..1791242,
FT                   1791337..1791467,1794219..1794312,1795403..1795477,
FT                   1796148..1796285,1796765..1796854,1799640..1799914,
FT                   1801075..>1801105))
FT                   /codon_start=1
FT                   /gene="Dpp3"
FT                   /locus_tag="mCG_8402"
FT                   /product="dipeptidylpeptidase 3, isoform CRA_a"
FT                   /note="gene_id=mCG8402.3 transcript_id=mCT193056.0
FT                   protein_id=mCP114070.0 isoform=CRA_a"
FT                   /protein_id="EDL33079.1"
FT                   /translation="SEFANGAAAAGLMADTQYILPNDIGVSSLDCREAFRLLSPTERLY
FT                   AHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAF
FT                   LVYAAGVYSNMGNYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEVRDLWQTCGDLM
FT                   FSLEPRLRHLGLGKEGVTTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKVVGQEGKS
FT                   HYEVRLASVLNTDPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYA
FT                   ANSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEF
FT                   EGFVAMVNKAMSAKFERLVASAEQLLKELPWPPAFEKDKFLTPDFTSLDVLTFAGSGIP
FT                   AGINIPNYDDLRQTEGFKNVSLGNVLAVAYAAKREKLTFLEEEDKDLYIRWKGPSFDVQ
FT                   VGLHELLGHGSGKLFVQDEKGAFNFDKETVINPETGEQIQSWYRSGETWDSKFSTIASS
FT                   YEECRAESVGLYLCLNPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPEAANW
FT                   RQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPDARVRLDRSKIRSVGRPALERFLR
FT                   RLQVLKSTGDVVAGRALYEGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGS
FT                   EVQLVEYEASAAGLIRSFCERFPEDGPELEEVLIQLAAADARFWRDQAQEAPPGQA"
FT   CDS             complement(join(1780708..1780883,1782931..1783093,
FT                   1786866..1787045,1787673..1787793,1787903..1788027,
FT                   1788112..1788174,1789372..1789464,1789791..1789903,
FT                   1789985..1790179,1790965..1791023,1791112..1791242,
FT                   1791337..1791467,1794219..1794312,1795403..1795477,
FT                   1796148..1796285,1796765..1796854,1799640..1799909))
FT                   /codon_start=1
FT                   /gene="Dpp3"
FT                   /locus_tag="mCG_8402"
FT                   /product="dipeptidylpeptidase 3, isoform CRA_c"
FT                   /note="gene_id=mCG8402.3 transcript_id=mCT7248.2
FT                   protein_id=mCP12093.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BU29"
FT                   /db_xref="InterPro:IPR005317"
FT                   /db_xref="MGI:MGI:1922471"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BU29"
FT                   /protein_id="EDL33081.1"
FT                   /translation="MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGG
FT                   LAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMG
FT                   NYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEVRDLWQTCGDLMFSLEPRLRHLGL
FT                   GKEGVTTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKVVGQEGKSHYEVRLASVLNT
FT                   DPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQY
FT                   VESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMS
FT                   AKFERLVASAEQLLKELPWPPAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLR
FT                   QTEGFKNVSLGNVLAVAYAAKREKLTFLEEEDKDLYIRWKGPSFDVQVGLHELLGHGSG
FT                   KLFVQDEKGAFNFDKETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLY
FT                   LCLNPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPEAANWRQAHMQARFVIL
FT                   RVLLEAGEGLVTVTPTTGSDGRPDARVRLDRSKIRSVGRPALERFLRRLQVLKSTGDVV
FT                   AGRALYEGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSEVQLVEYEASAA
FT                   GLIRSFCERFPEDGPELEEVLIQLAAADARFWRDQAQEAPPGQA"
FT   mRNA            complement(join(1781968..1783093,1786866..1787045,
FT                   1787673..1789464,1789791..1790179,1790965..1791023,
FT                   1791112..1791242,1791337..1791467,1794219..1794312,
FT                   1795403..1795477,1796148..1796285,1796765..1796854,
FT                   1799640..1799914,1801075..>1801104))
FT                   /gene="Dpp3"
FT                   /locus_tag="mCG_8402"
FT                   /product="dipeptidylpeptidase 3, transcript variant
FT                   mCT193057"
FT                   /note="gene_id=mCG8402.3 transcript_id=mCT193057.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1789333..1789464,1789791..1790179,
FT                   1790965..1791023,1791112..1791242,1791337..1791467,
FT                   1794219..1794312,1795403..1795477,1796148..1796285,
FT                   1796765..1796854,1799640..1799914,1801075..>1801102))
FT                   /codon_start=1
FT                   /gene="Dpp3"
FT                   /locus_tag="mCG_8402"
FT                   /product="dipeptidylpeptidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG8402.3 transcript_id=mCT193057.0
FT                   protein_id=mCP114071.0 isoform=CRA_b"
FT                   /protein_id="EDL33080.1"
FT                   /translation="EFANGAAAAGLMADTQYILPNDIGVSSLDCREAFRLLSPTERLYA
FT                   HHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFL
FT                   VYAAGVYSNMGNYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEVRDLWQTCGDLMF
FT                   SLEPRLRHLGLGKEGVTTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKVVGQEGKSH
FT                   YEVRLASVLNTDPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYAA
FT                   NSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFE
FT                   GFVAMVNKAMSAKFERLVASAEQLLKELPWPPAFEKDKFLTPDFTSLDVLTFAGSGIPA
FT                   GINIPNCESLPSAFSQCLSTSALPSVSSHPCLLDDDLRQTEGFKNVSLGNVLAVAYAAK
FT                   REKLTFLEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLFVQVSRDHLTCPTHR"
FT   gene            complement(1804708..1815627)
FT                   /gene="Peli3"
FT                   /locus_tag="mCG_8396"
FT                   /note="gene_id=mCG8396.2"
FT   mRNA            complement(join(1804708..1805715,1807215..1807403,
FT                   1807756..1807950,1810902..1811031,1814309..1814461,
FT                   1815538..1815627))
FT                   /gene="Peli3"
FT                   /locus_tag="mCG_8396"
FT                   /product="pellino 3, transcript variant mCT169722"
FT                   /note="gene_id=mCG8396.2 transcript_id=mCT169722.0 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(1804708..1805715,1807215..1807403,
FT                   1807756..1807950,1808971..1809072,1810902..1811031,
FT                   1814309..1814461,1815487..1815627))
FT                   /gene="Peli3"
FT                   /locus_tag="mCG_8396"
FT                   /product="pellino 3, transcript variant mCT7261"
FT                   /note="gene_id=mCG8396.2 transcript_id=mCT7261.2 created on
FT                   31-MAY-2002"
FT   CDS             complement(join(1805146..1805715,1807215..1807403,
FT                   1807756..1807950,1810902..1811031,1814309..1814460))
FT                   /codon_start=1
FT                   /gene="Peli3"
FT                   /locus_tag="mCG_8396"
FT                   /product="pellino 3, isoform CRA_a"
FT                   /note="gene_id=mCG8396.2 transcript_id=mCT169722.0
FT                   protein_id=mCP92953.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z6V8"
FT                   /db_xref="InterPro:IPR006800"
FT                   /db_xref="MGI:MGI:1924963"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z6V8"
FT                   /protein_id="EDL33083.1"
FT                   /translation="MVLEGNPDVGSPRTSDLQHPGSQGSCILSCPGEEALAGEEPIKYG
FT                   ELIVLGYNGCLASGDKGRRRSRLALSRRPHANGVKPDVMHHISTPLVSKIGRSTENMID
FT                   FVVTDTSPGGGATEGPSAQSTISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAA
FT                   KWRTPDGLMDGLTTNGVLVMHPAGGFSEDSAPGVWREISVCGNVYTLRDSRSAQQRGKL
FT                   VENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTL
FT                   AFPSPARGRTAPDKQQPWVYVRCGHVHGYHGWGCRREQGPQERECPLCRLVGPYVPLWL
FT                   GQEAGLCLDPGPPSHAFAPCGHVCSEKTARYWAQTPLPHGTHAFHAACPFCGAWLTGEL
FT                   GCVRLIFQGPLD"
FT   CDS             complement(join(1805146..1805715,1807215..1807403,
FT                   1807756..1807950,1808971..1809072,1810902..1811031,
FT                   1814309..1814460))
FT                   /codon_start=1
FT                   /gene="Peli3"
FT                   /locus_tag="mCG_8396"
FT                   /product="pellino 3, isoform CRA_b"
FT                   /note="gene_id=mCG8396.2 transcript_id=mCT7261.2
FT                   protein_id=mCP12049.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0R4J057"
FT                   /db_xref="InterPro:IPR006800"
FT                   /db_xref="MGI:MGI:1924963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J057"
FT                   /protein_id="EDL33084.1"
FT                   /translation="MVLEGNPDVGSPRTSDLQHPGSQGSCILSCPGEEALAGEEPIKYG
FT                   ELIVLGYNGCLASGDKGRRRSRLALSRRPHANGVKPDVMHHISTPLVSKALSNRGQHSI
FT                   SFTLSRSHSVIVEYTHDSDKDMFQIGRSTENMIDFVVTDTSPGGGATEGPSAQSTISRY
FT                   ACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGG
FT                   FSEDSAPGVWREISVCGNVYTLRDSRSAQQRGKLVENESNVLQDGSLIDLCGATLLWRT
FT                   PAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQPWVYVRCGH
FT                   VHGYHGWGCRREQGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGHVCS
FT                   EKTARYWAQTPLPHGTHAFHAACPFCGAWLTGELGCVRLIFQGPLD"
FT   assembly_gap    1807439..1807519
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    1827674..1827705
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    1830179..1830198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1833302..1845307
FT                   /estimated_length=12006
FT                   /gap_type="unknown"
FT   gene            complement(1855364..1859037)
FT                   /gene="Npas4"
FT                   /locus_tag="mCG_133294"
FT                   /note="gene_id=mCG133294.1"
FT   mRNA            complement(join(1855364..1856516,1856844..1856953,
FT                   1857141..1857414,1857525..1857627,1857802..1857953,
FT                   1858708..1859037))
FT                   /gene="Npas4"
FT                   /locus_tag="mCG_133294"
FT                   /product="neuronal PAS domain protein 4"
FT                   /note="gene_id=mCG133294.1 transcript_id=mCT134659.1
FT                   created on 31-MAY-2002"
FT   CDS             complement(join(1856377..1856516,1856844..1856953,
FT                   1857141..1857414,1857525..1857627,1857802..1857953,
FT                   1858708..1858882))
FT                   /codon_start=1
FT                   /gene="Npas4"
FT                   /locus_tag="mCG_133294"
FT                   /product="neuronal PAS domain protein 4"
FT                   /note="gene_id=mCG133294.1 transcript_id=mCT134659.1
FT                   protein_id=mCP68188.1"
FT                   /protein_id="EDL33085.1"
FT                   /translation="MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSL
FT                   ACIYTRKGVFFAGGTPLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEH
FT                   LGHSMVDLVAQGDSIYDIIDPADHLTVRQQLTMPSALDADRLFRCRFNTSKSLRRQSSG
FT                   NKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSR
FT                   HAKDLALLDVSESVLIYLGFERSELLCKSWYGLLHPEDLAQASSQHYRLLAESGDIQAE
FT                   MVVRLQAKHGGWTWIYCMLYSEGPEGPITANNYPIR"
FT   gene            1893121..1901064
FT                   /gene="Slc29a2"
FT                   /locus_tag="mCG_8390"
FT                   /note="gene_id=mCG8390.3"
FT   mRNA            join(1893121..1893330,1893564..1893645,1895081..1895241,
FT                   1895411..1895550,1896078..1896212,1896396..1896493,
FT                   1896777..1896861,1897938..1898068,1898309..1898417,
FT                   1898506..1898591,1899388..1899590,1900102..1901063)
FT                   /gene="Slc29a2"
FT                   /locus_tag="mCG_8390"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 2, transcript variant mCT7267"
FT                   /note="gene_id=mCG8390.3 transcript_id=mCT7267.2 created on
FT                   31-MAY-2002"
FT   mRNA            join(1893121..1893330,1893564..1893645,1895081..1895241,
FT                   1895411..1895550,1896078..1896212,1896396..1896493,
FT                   1896777..1896861,1898235..1898417,1898506..1898591,
FT                   1899388..1899590,1900102..1901063)
FT                   /gene="Slc29a2"
FT                   /locus_tag="mCG_8390"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 2, transcript variant mCT169721"
FT                   /note="gene_id=mCG8390.3 transcript_id=mCT169721.0 created
FT                   on 31-MAY-2002"
FT   mRNA            join(<1893167..1893335,1893564..1893645,1895081..1895241,
FT                   1895411..1895550,1896078..1896212,1896396..1896493,
FT                   1896777..1896861,1897938..1898068,1898309..1898417,
FT                   1898506..1898591,1899388..1899590,1900102..1901064)
FT                   /gene="Slc29a2"
FT                   /locus_tag="mCG_8390"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 2, transcript variant mCT193069"
FT                   /note="gene_id=mCG8390.3 transcript_id=mCT193069.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1893289..1893335,1893564..1893645,1895081..1895241,
FT                   1895411..1895550,1896078..1896212,1896396..1896493,
FT                   1896777..1896861,1897938..1898068,1898309..1898417,
FT                   1898506..1898591,1899388..1899590,1900102..1900213)
FT                   /codon_start=1
FT                   /gene="Slc29a2"
FT                   /locus_tag="mCG_8390"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 2, isoform CRA_b"
FT                   /note="gene_id=mCG8390.3 transcript_id=mCT193069.0
FT                   protein_id=mCP114067.0 isoform=CRA_b"
FT                   /protein_id="EDL33087.1"
FT                   /translation="DCGNHGAGKRPSGQVSYHLVGISFFILGLGTLLPWNFFITAIPYF
FT                   QGRLAGTNSSAETMGTNHTSPTDTFNFNNWVTLLSQLPLLLFTLLNSFLYQCIPESVRI
FT                   LGSLLAILLLFALTAALVKVDLSPGLFFSVTMASVWFINSFCAVLQGSLFGQLGTMPST
FT                   YSTLFLSGQGLAGIFAALAMLMSLASGVDAQTSALGYFITPCVGILLSIVCYLSLPHLK
FT                   FARYYLTEKLSQAPTQELETKAELLQADEKNGVPISPQQASPTLDLDPEKEPEPEEPQK
FT                   PGKPSVFVVFRKIWLTALCLVLVFTVTLSVFPAITAMVTTSSNSPGKWGLFFNPICCFL
FT                   LFNVMDWLGRSLTSYFLWPDEDSQQLLPLLVCLRFLFVPLFMLCHVPQHARLPIIFRQD
FT                   AYFITFMLLFAVSNGYLVSLTMCLAPRQVLPHEREVAGALMTFFLALGLSCGASLSFLF
FT                   KALL"
FT   CDS             join(1893302..1893330,1893564..1893645,1895081..1895241,
FT                   1895411..1895550,1896078..1896212,1896396..1896493,
FT                   1896777..1896861,1897938..1898068,1898309..1898417,
FT                   1898506..1898591,1899388..1899590,1900102..1900213)
FT                   /codon_start=1
FT                   /gene="Slc29a2"
FT                   /locus_tag="mCG_8390"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 2, isoform CRA_c"
FT                   /note="gene_id=mCG8390.3 transcript_id=mCT7267.2
FT                   protein_id=mCP12075.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q61672"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR030197"
FT                   /db_xref="MGI:MGI:1345278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61672"
FT                   /protein_id="EDL33088.1"
FT                   /translation="MARGNAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQGRLAG
FT                   TNSSAETMGTNHTSPTDTFNFNNWVTLLSQLPLLLFTLLNSFLYQCIPESVRILGSLLA
FT                   ILLLFALTAALVKVDLSPGLFFSVTMASVWFINSFCAVLQGSLFGQLGTMPSTYSTLFL
FT                   SGQGLAGIFAALAMLMSLASGVDAQTSALGYFITPCVGILLSIVCYLSLPHLKFARYYL
FT                   TEKLSQAPTQELETKAELLQADEKNGVPISPQQASPTLDLDPEKEPEPEEPQKPGKPSV
FT                   FVVFRKIWLTALCLVLVFTVTLSVFPAITAMVTTSSNSPGKWGLFFNPICCFLLFNVMD
FT                   WLGRSLTSYFLWPDEDSQQLLPLLVCLRFLFVPLFMLCHVPQHARLPIIFRQDAYFITF
FT                   MLLFAVSNGYLVSLTMCLAPRQVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL"
FT   CDS             join(1893302..1893330,1893564..1893645,1895081..1895241,
FT                   1895411..1895550,1896078..1896212,1896396..1896493,
FT                   1896777..1896861,1898235..1898417,1898506..1898591,
FT                   1899388..1899590,1900102..1900213)
FT                   /codon_start=1
FT                   /gene="Slc29a2"
FT                   /locus_tag="mCG_8390"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 2, isoform CRA_a"
FT                   /note="gene_id=mCG8390.3 transcript_id=mCT169721.0
FT                   protein_id=mCP92977.0 isoform=CRA_a"
FT                   /protein_id="EDL33086.1"
FT                   /translation="MARGNAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQGRLAG
FT                   TNSSAETMGTNHTSPTDTFNFNNWVTLLSQLPLLLFTLLNSFLYQCIPESVRILGSLLA
FT                   ILLLFALTAALVKVDLSPGLFFSVTMASVWFINSFCAVLQGSLFGQLGTMPSTYSTLFL
FT                   SGQGLAGIFAALAMLMSLASGVDAQTSALGYFITPCVGILLSIVCYLSLPHLKFARYYL
FT                   TEKLSQAPTQELETKAELLQAVGLGWGLHDEHGASLPTHNPASGSQIWLTALCLVLVFT
FT                   VTLSVFPAITAMVTTSSNSPGKWGLFFNPICCFLLFNVMDWLGRSLTSYFLWPDEDSQQ
FT                   LLPLLVCLRFLFVPLFMLCHVPQHARLPIIFRQDAYFITFMLLFAVSNGYLVSLTMCLA
FT                   PRQVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL"
FT   assembly_gap    1896634..1896653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1907747..1907766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1907989..1910229
FT                   /gene="B3gnt1"
FT                   /locus_tag="mCG_140479"
FT                   /note="gene_id=mCG140479.0"
FT   mRNA            join(1907989..1909152,1909427..1910229)
FT                   /gene="B3gnt1"
FT                   /locus_tag="mCG_140479"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 1, transcript
FT                   variant mCT169697"
FT                   /note="gene_id=mCG140479.0 transcript_id=mCT169697.0
FT                   created on 31-MAY-2002"
FT   mRNA            join(1907989..1909130,1909405..1910229)
FT                   /gene="B3gnt1"
FT                   /locus_tag="mCG_140479"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 1, transcript
FT                   variant mCT169701"
FT                   /note="gene_id=mCG140479.0 transcript_id=mCT169701.0
FT                   created on 31-MAY-2002"
FT   CDS             join(1908075..1909152,1909427..1909596)
FT                   /codon_start=1
FT                   /gene="B3gnt1"
FT                   /locus_tag="mCG_140479"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG140479.0 transcript_id=mCT169697.0
FT                   protein_id=mCP92927.0 isoform=CRA_a"
FT                   /protein_id="EDL33089.1"
FT                   /translation="MQMSYAIRCAFYQLLLAALMLVAMLQLLYLSLLSGLHGQEEQEQY
FT                   FEFFPPSPRSVDQVKSQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVILATHASVD
FT                   NLLHLSGLLERWEGPLSVSVFAATKEEAQLATVLAYALSSHCPEMRARVAMHLVCPSRY
FT                   EAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNLLRNLAREEANY
FT                   ALVIDVDMVPSEGLWRGLREMLDQSNHWDGTALVVPAFEIRRSRRMPMNKNELVQLYQV
FT                   GEVRPFYYGLCTPCHAPTNYSRWVNLPEESLLRPAYVVPWRDPWEPFYVAGGKVPTFDE
FT                   RFRQYGFNRISQVLKRERAWFNFEVLNEGFLVHKGFKEALKFHPQKEAENQRNKILYRQ
FT                   FKQELKARYPNSPHRC"
FT   CDS             join(1908075..1909130,1909405..1909596)
FT                   /codon_start=1
FT                   /gene="B3gnt1"
FT                   /locus_tag="mCG_140479"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 1, isoform CRA_b"
FT                   /note="gene_id=mCG140479.0 transcript_id=mCT169701.0
FT                   protein_id=mCP92921.0 isoform=CRA_b"
FT                   /protein_id="EDL33090.1"
FT                   /translation="MQMSYAIRCAFYQLLLAALMLVAMLQLLYLSLLSGLHGQEEQEQY
FT                   FEFFPPSPRSVDQVKSQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVILATHASVD
FT                   NLLHLSGLLERWEGPLSVSVFAATKEEAQLATVLAYALSSHCPEMRARVAMHLVCPSRY
FT                   EAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNTSYPNNLLRNLAREEANY
FT                   ALVIDVDMVPSEGLWRGLREMLDQSNHWDGTALVVPAFEIRRSRRMPMNKNELVQLYQV
FT                   GEVRPFYYGLCTPCHAPTNYSRWVNLPEESLLRPAYVVPWRDPWEPFYVAGGKVPTFDE
FT                   RFRQYGFNRISQACELHVAGFNFEVLNEGFLVHKGFKEALKFHPQKEAENQRNKILYRQ
FT                   FKQELKARYPNSPHRC"
FT   gene            1910470..1919021
FT                   /gene="Brms1"
FT                   /locus_tag="mCG_140478"
FT                   /note="gene_id=mCG140478.0"
FT   mRNA            join(1910470..1910588,1914992..1915137,1915235..1915325,
FT                   1915493..1915620,1915749..1915828,1915914..1916010,
FT                   1916491..1916583,1917612..1917676,1918096..1918135,
FT                   1918511..1919021)
FT                   /gene="Brms1"
FT                   /locus_tag="mCG_140478"
FT                   /product="breast cancer metastasis-suppressor 1, transcript
FT                   variant mCT169698"
FT                   /note="gene_id=mCG140478.0 transcript_id=mCT169698.0
FT                   created on 31-MAY-2002"
FT   mRNA            join(1910470..1910588,1914992..1915137,1915235..1915325,
FT                   1915493..1915620,1915749..1915810,1916646..1916847,
FT                   1916999..1917447)
FT                   /gene="Brms1"
FT                   /locus_tag="mCG_140478"
FT                   /product="breast cancer metastasis-suppressor 1, transcript
FT                   variant mCT169699"
FT                   /note="gene_id=mCG140478.0 transcript_id=mCT169699.0
FT                   created on 31-MAY-2002"
FT   mRNA            join(1912959..1913132,1914992..1915137,1915235..1915325,
FT                   1915493..1915620,1915749..1915828,1915914..1916010,
FT                   1916491..1916583,1917612..1917676,1918096..1918135,
FT                   1918511..1919017)
FT                   /gene="Brms1"
FT                   /locus_tag="mCG_140478"
FT                   /product="breast cancer metastasis-suppressor 1, transcript
FT                   variant mCT169700"
FT                   /note="gene_id=mCG140478.0 transcript_id=mCT169700.0
FT                   created on 31-MAY-2002"
FT   CDS             join(1914999..1915137,1915235..1915325,1915493..1915620,
FT                   1915749..1915828,1915914..1916010,1916491..1916583,
FT                   1917612..1917676,1918096..1918135,1918511..1918518)
FT                   /codon_start=1
FT                   /gene="Brms1"
FT                   /locus_tag="mCG_140478"
FT                   /product="breast cancer metastasis-suppressor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140478.0 transcript_id=mCT169698.0
FT                   protein_id=mCP92954.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q547N0"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="MGI:MGI:2388804"
FT                   /db_xref="UniProtKB/TrEMBL:Q547N0"
FT                   /protein_id="EDL33091.1"
FT                   /translation="MPIQPSGKETEEMEAEGDSAAEMNGEADESEEERSGSQTESEEES
FT                   SEMDDEDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEP
FT                   LGGLQQSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKMLLYDTLLGELQER
FT                   IQRLEEDRQSLDISSEWWDDKLHSRSSSKAGDAMPPSKRKKAPLVSGPYIVYMLQEIDI
FT                   LEDWTAIKKARAAVSPQKRKADGP"
FT   CDS             join(1914999..1915137,1915235..1915325,1915493..1915620,
FT                   1915749..1915828,1915914..1916010,1916491..1916583,
FT                   1917612..1917676,1918096..1918135,1918511..1918518)
FT                   /codon_start=1
FT                   /gene="Brms1"
FT                   /locus_tag="mCG_140478"
FT                   /product="breast cancer metastasis-suppressor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140478.0 transcript_id=mCT169700.0
FT                   protein_id=mCP92920.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q547N0"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="MGI:MGI:2388804"
FT                   /db_xref="UniProtKB/TrEMBL:Q547N0"
FT                   /protein_id="EDL33093.1"
FT                   /translation="MPIQPSGKETEEMEAEGDSAAEMNGEADESEEERSGSQTESEEES
FT                   SEMDDEDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEP
FT                   LGGLQQSLKIRIQVAGIYKGFCLDVIRNKYECELQGAKQHLESEKMLLYDTLLGELQER
FT                   IQRLEEDRQSLDISSEWWDDKLHSRSSSKAGDAMPPSKRKKAPLVSGPYIVYMLQEIDI
FT                   LEDWTAIKKARAAVSPQKRKADGP"
FT   CDS             join(1914999..1915137,1915235..1915325,1915493..1915620,
FT                   1915749..1915810,1916646..1916780)
FT                   /codon_start=1
FT                   /gene="Brms1"
FT                   /locus_tag="mCG_140478"
FT                   /product="breast cancer metastasis-suppressor 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG140478.0 transcript_id=mCT169699.0
FT                   protein_id=mCP92984.0 isoform=CRA_b"
FT                   /protein_id="EDL33092.1"
FT                   /translation="MPIQPSGKETEEMEAEGDSAAEMNGEADESEEERSGSQTESEEES
FT                   SEMDDEDYERRRSECVSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEP
FT                   LGGLQQSLKIRIQVAGIYKGFCLDVIRNKYECELQGVRRIMWDRVKLQSLMAIWCHKKV
FT                   YICQDFLLSSMVPKQTGSSAH"
FT   gene            <1919891..1926172
FT                   /gene="Rin1"
FT                   /locus_tag="mCG_8377"
FT                   /note="gene_id=mCG8377.2"
FT   mRNA            join(<1919891..1920045,1920178..1920358,1920458..1920572,
FT                   1920662..1920734,1920878..1920936,1921078..1921818,
FT                   1922072..1922377,1922701..1922832,1922958..1923109,
FT                   1923891..1926172)
FT                   /gene="Rin1"
FT                   /locus_tag="mCG_8377"
FT                   /product="Ras and Rab interactor 1, transcript variant
FT                   mCT170149"
FT                   /note="gene_id=mCG8377.2 transcript_id=mCT170149.0 created
FT                   on 31-MAY-2002"
FT   mRNA            join(<1919891..1920045,1920178..1920358,1920458..1920572,
FT                   1920662..1920734,1920845..1920936,1921078..1921818,
FT                   1922072..1922377,1922701..1922832,1922958..1923109,
FT                   1923891..1926171)
FT                   /gene="Rin1"
FT                   /locus_tag="mCG_8377"
FT                   /product="Ras and Rab interactor 1, transcript variant
FT                   mCT7272"
FT                   /note="gene_id=mCG8377.2 transcript_id=mCT7272.2 created on
FT                   31-MAY-2002"
FT   CDS             join(1919891..1920045,1920178..1920358,1920458..1920572,
FT                   1920662..1920734,1920845..1920936,1921078..1921818,
FT                   1922072..1922377,1922701..1922832,1922958..1923109,
FT                   1923891..1924340)
FT                   /codon_start=1
FT                   /gene="Rin1"
FT                   /locus_tag="mCG_8377"
FT                   /product="Ras and Rab interactor 1, isoform CRA_b"
FT                   /note="gene_id=mCG8377.2 transcript_id=mCT7272.2
FT                   protein_id=mCP12090.2 isoform=CRA_b"
FT                   /protein_id="EDL33095.1"
FT                   /translation="MCTPVPWGLDCLPESQEKPKELPAMEDPGETGAHPLGATNLNFVP
FT                   GHQQKEKPSTDPLYDTPDTRGVQAGGSQQPARTVSLRERLLITRPVWLQLRANAAAALH
FT                   VLRTEPPGTFLVRKSNTRQCQALCVRLPEASGPSFVSSHYIEESTGGVSLEGSELMFQD
FT                   LVQLICGYCRTRDILLLPLRLPRAIHQAATHKELEAISHLGMEFWSSSLNTKDQQRPSE
FT                   APPIPRLKARSPQELDQGTGAALCFFNPLFPGDLGPTKREKFKRSFKVRVSTETSSPLS
FT                   PPAVPPPPVPVLPGTSSSQTERLPPRQLLQRESSVGYRVPGSAASPCLPPLPSLQEVDC
FT                   CSPSSSEEEGSSGSPTTSPRLSRPRHRRPLLRSMSSAFCSLLAPERQVGRAATMLMQNR
FT                   YTAVGQLVQDLLTQVRAGPEPRELQGIRQALSRARAMLSAELGPEKLLPPERLELVLEK
FT                   SLHRSVLKPLRPILAARLRRRLSADGSLGRLAEGFRLARTQGPGAFGSHLTLSSPVETE
FT                   QVRQKLLQLLRAYSPSAQVKWLLQACKLLYTALKSQAGENAGADEFLPLLSLVLAQCDL
FT                   PDLLLEAEYMSELLEPTLLTGEGGYYLTSLSASLALLSGLSQARALPLSPAQELQRSLA
FT                   LWEQRRLPATHSFQHLLRVAYQDPSTGCTSKTLAVPPGSSIATLSQLCATKFRVTQPDA
FT                   FGLFLYKDQGYHRLPPEALAHRLPATGYLIYRRAERPETQGAVAEKAKTGSKGPEAGAW
FT                   EEETGGLNREGKPRIAVDQEGKDQARGGHIGPEEQKAEGSQALEE"
FT   CDS             join(1919891..1920045,1920178..1920358,1920458..1920572,
FT                   1920662..1920734,1920878..1920936,1921078..1921818,
FT                   1922072..1922377,1922701..1922832,1922958..1923109,
FT                   1923891..1924340)
FT                   /codon_start=1
FT                   /gene="Rin1"
FT                   /locus_tag="mCG_8377"
FT                   /product="Ras and Rab interactor 1, isoform CRA_a"
FT                   /note="gene_id=mCG8377.2 transcript_id=mCT170149.0
FT                   protein_id=mCP93134.0 isoform=CRA_a"
FT                   /protein_id="EDL33094.1"
FT                   /translation="MCTPVPWGLDCLPESQEKPKELPAMEDPGETGAHPLGATNLNFVP
FT                   GHQQKEKPSTDPLYDTPDTRGVQAGGSQQPARTVSLRERLLITRPVWLQLRANAAAALH
FT                   VLRTEPPGTFLVRKSNTRQCQALCVRLPEASGPSFVSSHYIEESTGGVSLEGSELMFQD
FT                   LVQLICGYCRTRAIHQAATHKELEAISHLGMEFWSSSLNTKDQQRPSEAPPIPRLKARS
FT                   PQELDQGTGAALCFFNPLFPGDLGPTKREKFKRSFKVRVSTETSSPLSPPAVPPPPVPV
FT                   LPGTSSSQTERLPPRQLLQRESSVGYRVPGSAASPCLPPLPSLQEVDCCSPSSSEEEGS
FT                   SGSPTTSPRLSRPRHRRPLLRSMSSAFCSLLAPERQVGRAATMLMQNRYTAVGQLVQDL
FT                   LTQVRAGPEPRELQGIRQALSRARAMLSAELGPEKLLPPERLELVLEKSLHRSVLKPLR
FT                   PILAARLRRRLSADGSLGRLAEGFRLARTQGPGAFGSHLTLSSPVETEQVRQKLLQLLR
FT                   AYSPSAQVKWLLQACKLLYTALKSQAGENAGADEFLPLLSLVLAQCDLPDLLLEAEYMS
FT                   ELLEPTLLTGEGGYYLTSLSASLALLSGLSQARALPLSPAQELQRSLALWEQRRLPATH
FT                   SFQHLLRVAYQDPSTGCTSKTLAVPPGSSIATLSQLCATKFRVTQPDAFGLFLYKDQGY
FT                   HRLPPEALAHRLPATGYLIYRRAERPETQGAVAEKAKTGSKGPEAGAWEEETGGLNREG
FT                   KPRIAVDQEGKDQARGGHIGPEEQKAEGSQALEE"
FT   assembly_gap    1930027..1930310
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   gene            1937155..1939697
FT                   /gene="Cd248"
FT                   /locus_tag="mCG_55124"
FT                   /note="gene_id=mCG55124.1"
FT   mRNA            1937155..1939697
FT                   /gene="Cd248"
FT                   /locus_tag="mCG_55124"
FT                   /product="CD248 antigen, endosialin"
FT                   /note="gene_id=mCG55124.1 transcript_id=mCT55307.2 created
FT                   on 31-MAY-2002"
FT   CDS             1937173..1939470
FT                   /codon_start=1
FT                   /gene="Cd248"
FT                   /locus_tag="mCG_55124"
FT                   /product="CD248 antigen, endosialin"
FT                   /note="gene_id=mCG55124.1 transcript_id=mCT55307.2
FT                   protein_id=mCP33754.1"
FT                   /protein_id="EDL33096.1"
FT                   /translation="MLLRLLLAWVAAVPALGQVPWTPEPRAACGPSSCYALFPRRRTFL
FT                   EAWRACRELGGNLATPRTPEEAQRVDSLVGVGPANGLLWIGLQRQARQCQPQRPLRGFI
FT                   WTTGDQDTAFTNWAQPATEGPCPAQRCAALEASGEHRWLEGSCTLAVDGYLCQFGFEGA
FT                   CPALPLEVGQAGPAVYTTPFNLVSSEFEWLPFGSVAAVQCQAGRGASLLCVKQPSGGVG
FT                   WSQTGPLCPGTGCGPDNGGCEHECVEEVDGAVSCRCSEGFRLAADGHSCEDPCAQAPCE
FT                   QQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEG
FT                   HELEADGISCSPAGAMGAQASQDLRDELLDDGEEGEDEEEPWEDFDGTWTEEQGILWLA
FT                   PTHPPDFGLPYRPNFPQDGEPQRLHLEPTWPPPLSAPRGPYHSSVVSATRPMVISATRP
FT                   TLPSAHKTSVISATRPPLSPVHPPAMAPATPPAVFSEHQIPKIKANYPDLPFGHKPGIT
FT                   SATHPARPPPYQPPIISTNYPQVFPPHQAPMSPDTHTITYLPPVPPHLDPGDTTSKAHQ
FT                   HPLLPDAPGIRTQAPQLSVSALQPPLPTNSRSSVHETPVPAANQPPAFPSSPLPPQRPT
FT                   NQTSSISPTHSYSRAPLVPREGVPSPKSVPQLPSVPSTAAPTALAESGLAGQSQRDDRW
FT                   LLVALLVPTCVFLVVLLALGIVYCTRCGSHAPNKRITDCYRWVTHAGNKSSTEPMPPRG
FT                   SLTGVQTCRTSV"
FT   assembly_gap    1940856..1941768
FT                   /estimated_length=913
FT                   /gap_type="unknown"
FT   assembly_gap    1945366..1945928
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    1946835..1947146
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   gene            complement(1949810..1954531)
FT                   /gene="Tmem151"
FT                   /locus_tag="mCG_54717"
FT                   /note="gene_id=mCG54717.2"
FT   mRNA            complement(join(1949810..1952182,1954387..1954531))
FT                   /gene="Tmem151"
FT                   /locus_tag="mCG_54717"
FT                   /product="transmembrane protein 151, transcript variant
FT                   mCT54900"
FT                   /note="gene_id=mCG54717.2 transcript_id=mCT54900.2 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(1949810..1952182,1953905..1953972))
FT                   /gene="Tmem151"
FT                   /locus_tag="mCG_54717"
FT                   /product="transmembrane protein 151, transcript variant
FT                   mCT169714"
FT                   /note="gene_id=mCG54717.2 transcript_id=mCT169714.0 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(1950851..1952182,1954387..1954461))
FT                   /codon_start=1
FT                   /gene="Tmem151"
FT                   /locus_tag="mCG_54717"
FT                   /product="transmembrane protein 151, isoform CRA_b"
FT                   /note="gene_id=mCG54717.2 transcript_id=mCT54900.2
FT                   protein_id=mCP33751.1 isoform=CRA_b"
FT                   /protein_id="EDL33098.1"
FT                   /translation="MPEGEGGDCGEVPALVPDGEPLREEQRPLKQSLGGSLCRESHWKC
FT                   LLLTLLIHACGAVVAWCRLATVPRLVLGPEAALARGAGGPPPTYPASPCSDGYLYIPLA
FT                   FVSLLYLLYLAECWHCHVRSCQAPRTDANTVLALIHRLQQAPPCVWWKATSYHYVRRTR
FT                   QITRYRNGDAYTTTQVYHERADSRTARGEFDYSAHGVRDVSKELVGLADHAATRLRFTK
FT                   CFSFGSAEAEASYLTQRARFFSANEGLDDYLEAREGMHLKDVDFRESLMVFADPRSPPW
FT                   YARAWVFWLVSAATLSWPLRVVAAYGTAHVHYQVEKLFGASSPPPGAVPSGPPLSRVAT
FT                   VDFTELEWHICSNRQLVPSYSEAVVMGASSGAYLRGCQRCRRSVSSNSLPPARPSGPRL
FT                   PFSRSRLSLGAGGRTTPGVFRSLSGGPLGRRGEDTEPLESPPCYEDALYFPVLIVHGDS
FT                   GCRGDGQGAL"
FT   CDS             complement(1950851..1951483)
FT                   /codon_start=1
FT                   /gene="Tmem151"
FT                   /locus_tag="mCG_54717"
FT                   /product="transmembrane protein 151, isoform CRA_a"
FT                   /note="gene_id=mCG54717.2 transcript_id=mCT169714.0
FT                   protein_id=mCP92968.0 isoform=CRA_a"
FT                   /protein_id="EDL33097.1"
FT                   /translation="MHLKDVDFRESLMVFADPRSPPWYARAWVFWLVSAATLSWPLRVV
FT                   AAYGTAHVHYQVEKLFGASSPPPGAVPSGPPLSRVATVDFTELEWHICSNRQLVPSYSE
FT                   AVVMGASSGAYLRGCQRCRRSVSSNSLPPARPSGPRLPFSRSRLSLGAGGRTTPGVFRS
FT                   LSGGPLGRRGEDTEPLESPPCYEDALYFPVLIVHGDSGCRGDGQGAL"
FT   assembly_gap    1954532..1954789
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   gene            1957204..1962471
FT                   /gene="Yif1a"
FT                   /locus_tag="mCG_8404"
FT                   /note="gene_id=mCG8404.2"
FT   mRNA            join(1957204..1957946,1958617..1958828,1958970..1959074,
FT                   1959202..1959280,1960566..1960623,1960739..1960894,
FT                   1961327..1961420,1961500..1962471)
FT                   /gene="Yif1a"
FT                   /locus_tag="mCG_8404"
FT                   /product="Yip1 interacting factor homolog A (S.
FT                   cerevisiae), transcript variant mCT7250"
FT                   /note="gene_id=mCG8404.2 transcript_id=mCT7250.2 created on
FT                   31-MAY-2002"
FT   mRNA            join(1957204..1957946,1958617..1958828,1958970..1959074,
FT                   1959202..1959280,1960566..1960623,1960739..1960894,
FT                   1961500..1962471)
FT                   /gene="Yif1a"
FT                   /locus_tag="mCG_8404"
FT                   /product="Yip1 interacting factor homolog A (S.
FT                   cerevisiae), transcript variant mCT169725"
FT                   /note="gene_id=mCG8404.2 transcript_id=mCT169725.0 created
FT                   on 31-MAY-2002"
FT   CDS             join(1957916..1957946,1958617..1958828,1958970..1959074,
FT                   1959202..1959280,1960566..1960623,1960739..1960894,
FT                   1961327..1961420,1961500..1961646)
FT                   /codon_start=1
FT                   /gene="Yif1a"
FT                   /locus_tag="mCG_8404"
FT                   /product="Yip1 interacting factor homolog A (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG8404.2 transcript_id=mCT7250.2
FT                   protein_id=mCP12001.2 isoform=CRA_b"
FT                   /protein_id="EDL33100.1"
FT                   /translation="MAYHSAYGVHGSKHRTRAAPDPPPLFDDTSGGYSSQLGGYPAPGA
FT                   DVAFSVNNLLGDPVANMAMAYGTSIASQGKDIVHKELHRFVSVNKLKYFFAVDTAYVAK
FT                   KLGLLVFPYTHQNWKMQYSHDVPLPPRKDLNAPDLYIPTMAFITYVLLAGMALGIQQRF
FT                   SPEVLGLCASTALVWVFMEVLALLLGLYLATVRSELSTFHLLAYSGYKYVGMILSVLTG
FT                   LLFGSDGYYVALAWTSSALMYFIVRSLRTAASGPDSMGGPAPRQRLQLYLTLGAAAFQP
FT                   LIIYWLTFHLVR"
FT   CDS             join(1957916..1957946,1958617..1958828,1958970..1959074,
FT                   1959202..1959280,1960566..1960623,1960739..1960894,
FT                   1961500..1961581)
FT                   /codon_start=1
FT                   /gene="Yif1a"
FT                   /locus_tag="mCG_8404"
FT                   /product="Yip1 interacting factor homolog A (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG8404.2 transcript_id=mCT169725.0
FT                   protein_id=mCP92918.0 isoform=CRA_a"
FT                   /protein_id="EDL33099.1"
FT                   /translation="MAYHSAYGVHGSKHRTRAAPDPPPLFDDTSGGYSSQLGGYPAPGA
FT                   DVAFSVNNLLGDPVANMAMAYGTSIASQGKDIVHKELHRFVSVNKLKYFFAVDTAYVAK
FT                   KLGLLVFPYTHQNWKMQYSHDVPLPPRKDLNAPDLYIPTMAFITYVLLAGMALGIQQRF
FT                   SPEVLGLCASTALVWVFMEVLALLLGLYLATVRSELSTFHLLAYSGYKYVGYDLCGLQL
FT                   QALTAWGAQPLGSVSSST"
FT   gene            complement(1962069..>1967626)
FT                   /gene="Cnih2"
FT                   /locus_tag="mCG_8374"
FT                   /note="gene_id=mCG8374.1"
FT   mRNA            complement(join(1962069..1962695,1962870..1963013,
FT                   1963118..1963230,1963930..1963998,1967531..>1967626))
FT                   /gene="Cnih2"
FT                   /locus_tag="mCG_8374"
FT                   /product="cornichon homolog 2 (Drosophila), transcript
FT                   variant mCT169715"
FT                   /note="gene_id=mCG8374.1 transcript_id=mCT169715.0 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(1962069..1962695,1962870..1963013,
FT                   1963118..1963230,1963482..1963529,1963930..1963998,
FT                   1967531..>1967626))
FT                   /gene="Cnih2"
FT                   /locus_tag="mCG_8374"
FT                   /product="cornichon homolog 2 (Drosophila), transcript
FT                   variant mCT7281"
FT                   /note="gene_id=mCG8374.1 transcript_id=mCT7281.1 created on
FT                   31-MAY-2002"
FT   CDS             complement(join(1962668..1962695,1962870..1963013,
FT                   1963118..1963230,1963930..>1963998))
FT                   /codon_start=1
FT                   /gene="Cnih2"
FT                   /locus_tag="mCG_8374"
FT                   /product="cornichon homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG8374.1 transcript_id=mCT169715.0
FT                   protein_id=mCP92971.0 isoform=CRA_b"
FT                   /protein_id="EDL33102.1"
FT                   /translation="IIAFDELRTDFKNPIDQGNPARALVVPEYSIHGLFCLMFLCAAEW
FT                   VTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFF
FT                   YYLYSMVYTLVSF"
FT   CDS             complement(join(1962668..1962695,1962870..1963013,
FT                   1963118..1963230,1963482..1963529,1963930..>1963998))
FT                   /codon_start=1
FT                   /gene="Cnih2"
FT                   /locus_tag="mCG_8374"
FT                   /product="cornichon homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG8374.1 transcript_id=mCT7281.1
FT                   protein_id=mCP12031.2 isoform=CRA_a"
FT                   /protein_id="EDL33101.1"
FT                   /translation="IIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEY
FT                   SIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYC
FT                   QKESWCKLAFYLLSFFYYLYSMVYTLVSF"
FT   assembly_gap    1967301..1967530
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   gene            complement(1968413..1976242)
FT                   /gene="Rab1b"
FT                   /locus_tag="mCG_8376"
FT                   /note="gene_id=mCG8376.3"
FT   mRNA            complement(join(1968413..1969778,1969873..1970004,
FT                   1973847..1973942,1974039..1974134,1974384..1974456,
FT                   1976131..1976242))
FT                   /gene="Rab1b"
FT                   /locus_tag="mCG_8376"
FT                   /product="RAB1B, member RAS oncogene family, transcript
FT                   variant mCT7276"
FT                   /note="gene_id=mCG8376.3 transcript_id=mCT7276.3 created on
FT                   10-FEB-2003"
FT   mRNA            complement(join(1968413..1970004,1973847..1973942,
FT                   1974039..1974134,1974384..1974456,1976131..1976242))
FT                   /gene="Rab1b"
FT                   /locus_tag="mCG_8376"
FT                   /product="RAB1B, member RAS oncogene family, transcript
FT                   variant mCT180451"
FT                   /note="gene_id=mCG8376.3 transcript_id=mCT180451.0 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(1968413..1969778,1969873..1970004,
FT                   1973847..1973942,1974039..1974134,1974384..1974456,
FT                   1975183..1975451))
FT                   /gene="Rab1b"
FT                   /locus_tag="mCG_8376"
FT                   /product="RAB1B, member RAS oncogene family, transcript
FT                   variant mCT180452"
FT                   /note="gene_id=mCG8376.3 transcript_id=mCT180452.0 created
FT                   on 10-FEB-2003"
FT   CDS             complement(1969069..1969311)
FT                   /codon_start=1
FT                   /gene="Rab1b"
FT                   /locus_tag="mCG_8376"
FT                   /product="RAB1B, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG8376.3 transcript_id=mCT180452.0
FT                   protein_id=mCP103374.0 isoform=CRA_b"
FT                   /protein_id="EDL33104.1"
FT                   /translation="MRAPLSVTHPHVCCTGFLFPFFPIARASLPLLPLGAGSSQGIQGL
FT                   RSRVLHRTSGQVPGLREPHSHLFLISASLHRSHTA"
FT   CDS             complement(join(1969584..1969778,1969873..1970004,
FT                   1973847..1973942,1974039..1974134,1974384..1974456,
FT                   1976131..1976144))
FT                   /codon_start=1
FT                   /gene="Rab1b"
FT                   /locus_tag="mCG_8376"
FT                   /product="RAB1B, member RAS oncogene family, isoform CRA_c"
FT                   /note="gene_id=mCG8376.3 transcript_id=mCT7276.3
FT                   protein_id=mCP12073.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q0PD66"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1923558"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD66"
FT                   /protein_id="EDL33105.1"
FT                   /translation="MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDF
FT                   KIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQ
FT                   EIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFM
FT                   TMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC"
FT   CDS             complement(join(1969714..1970004,1973847..1973942,
FT                   1974039..1974134,1974384..1974456,1976131..1976144))
FT                   /codon_start=1
FT                   /gene="Rab1b"
FT                   /locus_tag="mCG_8376"
FT                   /product="RAB1B, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG8376.3 transcript_id=mCT180451.0
FT                   protein_id=mCP103373.0 isoform=CRA_a"
FT                   /protein_id="EDL33103.1"
FT                   /translation="MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDF
FT                   KIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQ
FT                   EIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKVSRPALAVRGLGPTCLHPFSPCSPLS
FT                   LLPFAGICRLSGCPLPRDKCQECHQC"
FT   assembly_gap    1976246..1976372
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            complement(1977047..1987858)
FT                   /gene="Klc2"
FT                   /locus_tag="mCG_8395"
FT                   /note="gene_id=mCG8395.2"
FT   mRNA            complement(join(1977047..1977987,1978402..1978459,
FT                   1978600..1978724,1978792..1978941,1979032..1979140,
FT                   1979496..1979563,1979666..1979715,1980437..1980536,
FT                   1980664..1980837,1980918..1981019,1981125..1981212,
FT                   1982017..1982239,1983080..1983149,1983240..1983470,
FT                   1986492..1986730,1987420..1987858))
FT                   /gene="Klc2"
FT                   /locus_tag="mCG_8395"
FT                   /product="kinesin light chain 2"
FT                   /note="gene_id=mCG8395.2 transcript_id=mCT7257.3 created on
FT                   19-MAR-2004"
FT   CDS             complement(join(1977904..1977987,1978402..1978459,
FT                   1978600..1978724,1978792..1978941,1979032..1979140,
FT                   1979496..1979563,1979666..1979715,1980437..1980536,
FT                   1980664..1980837,1980918..1981019,1981125..1981212,
FT                   1982017..1982239,1983080..1983149,1983240..1983470,
FT                   1986492..1986719))
FT                   /codon_start=1
FT                   /gene="Klc2"
FT                   /locus_tag="mCG_8395"
FT                   /product="kinesin light chain 2"
FT                   /note="gene_id=mCG8395.2 transcript_id=mCT7257.3
FT                   protein_id=mCP12025.3"
FT                   /db_xref="GOA:Q91YS4"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015792"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:107953"
FT                   /db_xref="PDB:3ZFW"
FT                   /db_xref="PDB:5FJY"
FT                   /db_xref="UniProtKB/TrEMBL:Q91YS4"
FT                   /protein_id="EDL33106.1"
FT                   /translation="MATMVLPREEKLSQDEIVLGTKAVIQGLETLRGEHRALLAPLASH
FT                   EAGEAEPGSQERCLLLRRSLEAIELGLGEAQVILALSSHLGAVESEKQKLRAQVRRLVQ
FT                   ENQWLREELAGTQQKLQRSEQAVAQLEEEKQHLLFMSQIRKLDEDASPNEEKGDVPKDS
FT                   LDDLFPNEDEQSPAPSPGGGDVAAQHGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCK
FT                   QALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAV
FT                   AATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKA
FT                   EEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEK
FT                   EFGSVNGENKPIWMHAEEREESKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSLGAL
FT                   YRRQGKLEAAHTLEDCASRSRKQGLDPASQTKVVELLKDGSGGRGHRRGSRDVAGPQSE
FT                   SDLEESGPAAEWSGDGSGSLRRSGSFGKLRDALRRSSEMLVRKLQGGGPQEPPNSRMKR
FT                   ASSLNFLNKSVEEPVQPGGTGLSDSRTLSSSSMDLSRRSSLVG"
FT   gene            1987335..1988598
FT                   /locus_tag="mCG_148128"
FT                   /note="gene_id=mCG148128.0"
FT   mRNA            1987335..1988598
FT                   /locus_tag="mCG_148128"
FT                   /product="mCG148128"
FT                   /note="gene_id=mCG148128.0 transcript_id=mCT188391.1
FT                   created on 19-MAR-2004"
FT   CDS             1988496..1988570
FT                   /codon_start=1
FT                   /locus_tag="mCG_148128"
FT                   /product="mCG148128"
FT                   /note="gene_id=mCG148128.0 transcript_id=mCT188391.1
FT                   protein_id=mCP108415.1"
FT                   /protein_id="EDL33107.1"
FT                   /translation="MGSASAPFSGFCSLWVPVLTSFTG"
FT   assembly_gap    1993518..1993537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2001112..2002344)
FT                   /pseudo
FT                   /locus_tag="mCG_133792"
FT                   /note="gene_id=mCG133792.1"
FT   mRNA            complement(2001112..2002344)
FT                   /pseudo
FT                   /locus_tag="mCG_133792"
FT                   /note="gene_id=mCG133792.1 transcript_id=mCT135164.1
FT                   created on 31-MAY-2002"
FT   gene            complement(2002532..>2037497)
FT                   /gene="Pacs1"
FT                   /locus_tag="mCG_8403"
FT                   /note="gene_id=mCG8403.1"
FT   mRNA            complement(join(2002532..2004397,2004492..2004611,
FT                   2006065..2006291,2008302..2008437,2008652..2008694,
FT                   2010532..2010574,2010979..2011081,2011616..2011726,
FT                   2011888..2012042,2012685..2012791,2013109..2013213,
FT                   2014134..2014269,2014405..2014520,2016453..2016533,
FT                   2021764..2021857,2022150..2022310,2023154..2023213,
FT                   2025179..2025259,2025346..2025437,2025847..2025991,
FT                   2029457..2029582,2030207..2030296,2037410..>2037497))
FT                   /gene="Pacs1"
FT                   /locus_tag="mCG_8403"
FT                   /product="phosphofurin acidic cluster sorting protein 1"
FT                   /note="gene_id=mCG8403.1 transcript_id=mCT7249.2 created on
FT                   31-MAY-2002"
FT   CDS             complement(join(2004282..2004397,2004492..2004611,
FT                   2006065..2006291,2008302..2008437,2008652..2008694,
FT                   2010532..2010574,2010979..2011081,2011616..2011726,
FT                   2011888..2012042,2012685..2012791,2013109..2013213,
FT                   2014134..2014269,2014405..2014520,2016453..2016533,
FT                   2021764..2021857,2022150..2022310,2023154..2023213,
FT                   2025179..2025259,2025346..2025437,2025847..2025991,
FT                   2029457..2029582,2030207..2030296,2037410..>2037496))
FT                   /codon_start=1
FT                   /gene="Pacs1"
FT                   /locus_tag="mCG_8403"
FT                   /product="phosphofurin acidic cluster sorting protein 1"
FT                   /note="gene_id=mCG8403.1 transcript_id=mCT7249.2
FT                   protein_id=mCP11981.2"
FT                   /protein_id="EDL33108.1"
FT                   /translation="LFSLTLKKLVMLKEMDKDLNSVVIAVKLQGSKRILRSNEIILPAS
FT                   GLVETELQLTFSLQYPHFLKRDANKLQIMLQRRKRYKNRTILGYKTLAVGLINMAEVMQ
FT                   HPNEGALVLGLHSNVKDVSVPVAEIKIYSLSSQPIDHEGIKSKLSDRSPDIDNYSEEEE
FT                   ESFSSEQEGSDDPLHGQDLFYEDEDLRKVKKTRRKLTSTSAITRQPNIKQKFVALLKRF
FT                   KVSDEVGFGLEHVSREQIREVEEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKLK
FT                   PFFEGMSQSSSQTEIGSLNSKGSLGKDTTSPMELAALEKVKSTWIKNQDDSLTETDTLE
FT                   ITDQDMFGDVSTSLVVPEKVKTPMKSSKADLQGSASPSKVEGTHTPRQKRSTPLKERQL
FT                   SKPLSERTNSSDSERSPDLGHSTQIPRKVVYDQLNQILVSDAALPENVILVNTTDWQGQ
FT                   YVAELLQDQRKPVVCTCSTVEVQAVLSALLTRIQRYCNCNSSMPRPVKVAAVGSQSYLS
FT                   SILRFFVKSLASKTPDWLGYMRFLIIPLGSHPVAKYLGSVDSRYSSTFLDSAWRDLFSR
FT                   SEPPVSEPLDVVGRVMQYVNGATTTHQLPVAEAMLTCRHKFPDEDSYQKFIPFIGVVKV
FT                   GLVEDSPSTAGDGDDSPVVSLTVPSTSPPSSSGLSRDATATPPSSPSMSSALAIVGSPN
FT                   SPYGDVIGLQVDYWLGHPGERRREGDKRDASSKNTLKSVFRSVQVSRLPHAGEAQLSGT
FT                   MAMTVVTKEKNKKVPTIFLSKKPREKEVDSKSQVIEGISRLICSAKQQQTMLRVSIDGV
FT                   EWSDIKFFQLAAQWPTHVKHFPVGLFSGSKTT"
FT   assembly_gap    2018336..2018693
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    2052716..2052763
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    2055922..2056093
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    2068839..2069343
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    2072124..2072143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2074477..2074991
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    2077411..2077431
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    2092295..2092328
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    2113539..2114030
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    2125808..2125852
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            2141707..>2142419
FT                   /locus_tag="mCG_1045469"
FT                   /note="gene_id=mCG1045469.1"
FT   mRNA            2141707..>2142419
FT                   /locus_tag="mCG_1045469"
FT                   /product="mCG1045469"
FT                   /note="gene_id=mCG1045469.1 transcript_id=mCT163173.1
FT                   created on 05-JUN-2002"
FT   CDS             2141892..2142419
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045469"
FT                   /product="mCG1045469"
FT                   /note="gene_id=mCG1045469.1 transcript_id=mCT163173.1
FT                   protein_id=mCP68389.0"
FT                   /protein_id="EDL33109.1"
FT                   /translation="MAWPGEEGARGLRRLRARERLSGFPPRRQRLSASPQNARRSASHQ
FT                   RICTHARAFAARGPRARPPPPVAAREAHTLGGRVRKGRGAAAPPRPAPRGGARLALGPA
FT                   APGKGLQPARSRGAALESLAGLGVQAPRPSSLRPPRAAATPPAETRVFRGAVPDRRRLY
FT                   ESALSPWDLQYT"
FT   gene            complement(2142939..2164517)
FT                   /gene="Sf3b2"
FT                   /locus_tag="mCG_19856"
FT                   /note="gene_id=mCG19856.1"
FT   mRNA            complement(join(2142939..2143532,2143797..2143982,
FT                   2144069..2144168,2148266..2148367,2148467..2148609,
FT                   2148839..2148946,2152704..2152811,2152919..2153008,
FT                   2153636..2153785,2155250..2155477,2155638..2155718,
FT                   2155872..2156009,2156130..2156345,2156596..2156687,
FT                   2156971..2157067,2157365..2157474,2160366..2160483,
FT                   2162151..2162390,2163370..2163447,2164133..2164179,
FT                   2164354..2164517))
FT                   /gene="Sf3b2"
FT                   /locus_tag="mCG_19856"
FT                   /product="splicing factor 3b, subunit 2"
FT                   /note="gene_id=mCG19856.1 transcript_id=mCT17496.2 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(2143461..2143532,2143797..2143982,
FT                   2144069..2144168,2148266..2148367,2148467..2148609,
FT                   2148839..2148946,2152704..2152811,2152919..2153008,
FT                   2153636..2153785,2155250..2155477,2155638..2155718,
FT                   2155872..2156009,2156130..2156345,2156596..2156687,
FT                   2156971..2157067,2157365..2157474,2160366..2160483,
FT                   2162151..2162390,2163370..2163447,2164133..2164179,
FT                   2164354..2164486))
FT                   /codon_start=1
FT                   /gene="Sf3b2"
FT                   /locus_tag="mCG_19856"
FT                   /product="splicing factor 3b, subunit 2"
FT                   /note="gene_id=mCG19856.1 transcript_id=mCT17496.2
FT                   protein_id=mCP12079.1"
FT                   /db_xref="GOA:Q3UJB0"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="MGI:MGI:2441856"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJB0"
FT                   /protein_id="EDL33110.1"
FT                   /translation="MAAEHPEPPKGELQLPPPPPPGHYGAWAAQELQARLAEIGAPIQG
FT                   SREELVERLQTYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLSGIPMPPPPMGLPPLQP
FT                   PPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEER
FT                   AKQAAVLMEQERQQEIAKMGTAVPRPPQDMGQLGVRTPLGPRVAAPVGPVVPTPTVLPM
FT                   GAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMET
FT                   DTRSSLGQSASETEEDTVSISKKEKNRKRRNRKKKKKPQRVRAASSESSGDREKDSGRS
FT                   RGSDPPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKMESS
FT                   AVPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVV
FT                   EMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQ
FT                   EMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYE
FT                   GKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPG
FT                   LNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGEL
FT                   EPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKK
FT                   IEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALA
FT                   PEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSK
FT                   KYKEFKF"
FT   assembly_gap    2149378..2149397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2151648..2151667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2171622..>2176969
FT                   /locus_tag="mCG_11786"
FT                   /note="gene_id=mCG11786.2"
FT   mRNA            join(<2171622..2171746,2175799..>2176969)
FT                   /locus_tag="mCG_11786"
FT                   /product="mCG11786"
FT                   /note="gene_id=mCG11786.2 transcript_id=mCT17487.2 created
FT                   on 04-JUN-2002"
FT   CDS             join(2171622..2171746,2175799..2176969)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11786"
FT                   /product="mCG11786"
FT                   /note="gene_id=mCG11786.2 transcript_id=mCT17487.2
FT                   protein_id=mCP11990.2"
FT                   /protein_id="EDL33111.1"
FT                   /translation="MPPILQRLQQSTKMMSHRKILLLVLGCSTVSLLIHQGSQLSWYPK
FT                   LFPLSCPPLRESPPRAKHMAVAFLKTHKTAGTTVQNILFRFAERHNLTVALPHPSCEHQ
FT                   FCYPRNFSAHFVHPATRPPHMLASHLRFDRAELERLMPPDTIYVTILREPAAMFESLFS
FT                   YYNQYCPAFRRVPNASLETFLRAPEAYYRPGEHFAMFAHNTLAYDLGGDNERSPRDDAA
FT                   YLAGLIRQVEEVFSLVMIAEYFDESLVLLRRLLAWDLDDVLYAKLNARAASSRLATIPE
FT                   ALARAARTWNALDAGLYDHFNATFWRRVARAGRACVEREARELREARQRLLRRCFGDEP
FT                   VLRPAAQIRTKQLQPWQPSRKVDIMGYDLPSGGAGPTTEACLKLAMPEVQYSNYLLRKQ
FT                   KRRGGVRSRPESVLDNPPPRPIRALPRIPQGT"
FT   assembly_gap    2174018..2174037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2177532..2177590
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    2178282..2181615
FT                   /estimated_length=3334
FT                   /gap_type="unknown"
FT   assembly_gap    2187482..2187508
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            2195876..2197685
FT                   /pseudo
FT                   /locus_tag="mCG_11788"
FT                   /note="gene_id=mCG11788.2"
FT   mRNA            join(2195876..2197117,2197480..2197685)
FT                   /pseudo
FT                   /locus_tag="mCG_11788"
FT                   /note="gene_id=mCG11788.2 transcript_id=mCT17489.2 created
FT                   on 05-JUN-2002"
FT   assembly_gap    2206279..2206361
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            <2207633..2216172
FT                   /gene="Catsper1"
FT                   /locus_tag="mCG_11756"
FT                   /note="gene_id=mCG11756.2"
FT   mRNA            join(<2207633..2208567,2209522..2209728,2210607..2210720,
FT                   2210885..2211038,2211361..2211452,2211608..2211751,
FT                   2211885..2211948,2212108..2212180,2212270..2212330,
FT                   2213328..2213403,2215773..2215887,2216019..2216172)
FT                   /gene="Catsper1"
FT                   /locus_tag="mCG_11756"
FT                   /product="cation channel of sperm 1"
FT                   /note="gene_id=mCG11756.2 transcript_id=mCT17468.2 created
FT                   on 05-JUN-2002"
FT   CDS             join(<2207733..2208567,2209522..2209728,2210607..2210720,
FT                   2210885..2211038,2211361..2211452,2211608..2211751,
FT                   2211885..2211948,2212108..2212180,2212270..2212330,
FT                   2213328..2213403,2215773..2215887,2216019..2216045)
FT                   /codon_start=1
FT                   /gene="Catsper1"
FT                   /locus_tag="mCG_11756"
FT                   /product="cation channel of sperm 1"
FT                   /note="gene_id=mCG11756.2 transcript_id=mCT17468.2
FT                   protein_id=mCP12064.2"
FT                   /protein_id="EDL33112.1"
FT                   /translation="TLHRPNQGGVYYDSPQHGMFQQPYQQHGGFHQQNELQHLREFSDS
FT                   HDNAFSHHSYQQDRAGVSTLPNNISHAYGGSHPLAESQHSGGPQSGPRIDPNHHPHQDD
FT                   PHRPSEPLSHPSSTGSHQGTTHQQYHERSHHLNPQQNRDHADTISYRSSTRFYRSHAPF
FT                   SRQERPHLHADHHHEGHHAHSHHGEHPHHKEQRHYHGDHMHHHIHHRSPSASQLSHKSH
FT                   STLATSPSHVGSKSTASGARYTFGARSQIFGKAQSRESLRESASLSEGEDHVQKRKKAQ
FT                   RAHKKAHTGNIFQLLWEKISHLLLGLQQMILSLTQSLGFETFIFIVVCLNTVILVAQTF
FT                   TELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDFFIMVMAVLDFVL
FT                   LQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAGTLSGSLPSITA
FT                   ILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSLIYIDNRAQGA
FT                   WYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKGLEKVKLEQAARVHEKLLDDSLT
FT                   DLNKADANAQMTEEALKMQLIEGMFGNMTVKQRVLHFQFLQLVAAVEQHQQKFRSQAYV
FT                   IDELVDMAFEAGDDDYGK"
FT   gene            complement(2219752..2221282)
FT                   /gene="Cst6"
FT                   /locus_tag="mCG_11738"
FT                   /note="gene_id=mCG11738.2"
FT   mRNA            complement(join(2219752..2219945,2220293..2220418,
FT                   2220991..2221282))
FT                   /gene="Cst6"
FT                   /locus_tag="mCG_11738"
FT                   /product="cystatin E/M"
FT                   /note="gene_id=mCG11738.2 transcript_id=mCT17371.2 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(2219862..2219945,2220293..2220418,
FT                   2220991..2221230))
FT                   /codon_start=1
FT                   /gene="Cst6"
FT                   /locus_tag="mCG_11738"
FT                   /product="cystatin E/M"
FT                   /note="gene_id=mCG11738.2 transcript_id=mCT17371.2
FT                   protein_id=mCP12017.1"
FT                   /db_xref="GOA:Q9D1B1"
FT                   /db_xref="InterPro:IPR000010"
FT                   /db_xref="InterPro:IPR020381"
FT                   /db_xref="InterPro:IPR027214"
FT                   /db_xref="MGI:MGI:1920970"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D1B1"
FT                   /protein_id="EDL33113.1"
FT                   /translation="MERPHFPLAMGLGLLAFCLLTLSPDARAELRSRRTGERQNLSPTD
FT                   PRVQKAAQAAVASYNMGSDSLYYFRDTKVIDAKYQLVAGIKYYLTLDIESTECRKTRVS
FT                   GEHMDLTTCPLAAGGQQEKLRCNFELLEVPWKNTTQLLKHDCVQV"
FT   assembly_gap    2228204..2229051
FT                   /estimated_length=848
FT                   /gap_type="unknown"
FT   gene            complement(2236966..2239204)
FT                   /gene="Banf1"
FT                   /locus_tag="mCG_19863"
FT                   /note="gene_id=mCG19863.1"
FT   mRNA            complement(join(2236966..2237483,2238143..2238281,
FT                   2238893..2239204))
FT                   /gene="Banf1"
FT                   /locus_tag="mCG_19863"
FT                   /product="barrier to autointegration factor 1, transcript
FT                   variant mCT17502"
FT                   /note="gene_id=mCG19863.1 transcript_id=mCT17502.1 created
FT                   on 05-JUN-2002"
FT   mRNA            complement(join(2236966..2237483,2238143..2238281,
FT                   2238588..2238673))
FT                   /gene="Banf1"
FT                   /locus_tag="mCG_19863"
FT                   /product="barrier to autointegration factor 1, transcript
FT                   variant mCT169871"
FT                   /note="gene_id=mCG19863.1 transcript_id=mCT169871.0 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(2237337..2237483,2238143..2238265))
FT                   /codon_start=1
FT                   /gene="Banf1"
FT                   /locus_tag="mCG_19863"
FT                   /product="barrier to autointegration factor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19863.1 transcript_id=mCT169871.0
FT                   protein_id=mCP92965.0 isoform=CRA_a"
FT                   /protein_id="EDL33114.1"
FT                   /translation="MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDKAYVV
FT                   LGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL"
FT   CDS             complement(join(2237337..2237483,2238143..2238265))
FT                   /codon_start=1
FT                   /gene="Banf1"
FT                   /locus_tag="mCG_19863"
FT                   /product="barrier to autointegration factor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19863.1 transcript_id=mCT17502.1
FT                   protein_id=mCP11998.1 isoform=CRA_a"
FT                   /protein_id="EDL33115.1"
FT                   /translation="MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDKAYVV
FT                   LGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL"
FT   gene            2238898..2242578
FT                   /gene="2010003J03Rik"
FT                   /locus_tag="mCG_11734"
FT                   /note="gene_id=mCG11734.2"
FT   mRNA            join(2238898..2239535,2240383..2240601,2240747..2240855,
FT                   2240942..2241050,2241220..2241267,2242251..2242578)
FT                   /gene="2010003J03Rik"
FT                   /locus_tag="mCG_11734"
FT                   /product="RIKEN cDNA 2010003J03"
FT                   /note="gene_id=mCG11734.2 transcript_id=mCT17367.2 created
FT                   on 05-JUN-2002"
FT   CDS             join(2240515..2240601,2240747..2240855,2240942..2241050,
FT                   2241220..2241267,2242251..2242410)
FT                   /codon_start=1
FT                   /gene="2010003J03Rik"
FT                   /locus_tag="mCG_11734"
FT                   /product="RIKEN cDNA 2010003J03"
FT                   /note="gene_id=mCG11734.2 transcript_id=mCT17367.2
FT                   protein_id=mCP11984.2"
FT                   /protein_id="EDL33116.1"
FT                   /translation="MSQASKRKHVVQEVLGEHMVPSDHQQIVKVLRTPGNNLHEVETAQ
FT                   GQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKNHVRSLQKEGHWPE
FT                   AFSEVAEKQNNMNRESQPELPAEPQLSGEGSSSEDDSDLFVNTNHRQYHESEEESEEDE
FT                   EEEEEAA"
FT   gene            complement(2252445..2261738)
FT                   /gene="Sart1"
FT                   /locus_tag="mCG_19864"
FT                   /note="gene_id=mCG19864.2"
FT   mRNA            complement(join(2252445..2252520,2252605..2252726,
FT                   2252823..2252912,2253366..2253501,2253595..2253685,
FT                   2254051..2254138,2254346..2254456,2254571..2254744,
FT                   2255100..2255242,2255325..2255458,2255540..2255664,
FT                   2256005..2256211,2256320..2256462,2256549..2256648,
FT                   2256755..2256832,2257003..2257108,2257208..2257334,
FT                   2257848..2257903,2258197..2258254,2260701..2261738))
FT                   /gene="Sart1"
FT                   /locus_tag="mCG_19864"
FT                   /product="squamous cell carcinoma antigen recognized by
FT                   T-cells 1"
FT                   /note="gene_id=mCG19864.2 transcript_id=mCT17503.2 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(2252502..2252520,2252605..2252726,
FT                   2252823..2252912,2253366..2253501,2253595..2253685,
FT                   2254051..2254138,2254346..2254456,2254571..2254744,
FT                   2255100..2255242,2255325..2255458,2255540..2255664,
FT                   2256005..2256211,2256320..2256462,2256549..2256648,
FT                   2256755..2256832,2257003..2257108,2257208..2257334,
FT                   2257848..2257903,2258197..2258254,2260701..2261013))
FT                   /codon_start=1
FT                   /gene="Sart1"
FT                   /locus_tag="mCG_19864"
FT                   /product="squamous cell carcinoma antigen recognized by
FT                   T-cells 1"
FT                   /note="gene_id=mCG19864.2 transcript_id=mCT17503.2
FT                   protein_id=mCP12018.1"
FT                   /protein_id="EDL33117.1"
FT                   /translation="MGSSKKHRGEKEAAGTTAAAGTGGTTEQPPRHREHKKHKHRSSGG
FT                   GSSGGERRKRSRERGSERGSGRRGAEAEARSGAHGRERSQAEPSERRVKREKRDDGYEA
FT                   AASSKASSGDASSLSIEETNKLRAKLGLKPLEVNAVKKEAGTKEEPVAADVINPMALRQ
FT                   REELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAK
FT                   LLEEMDQEFGVSTLVEEEFEQRRQDLYSARDLQGLTVEHAIDSFREGETVVLTLKDKGV
FT                   LQDGEDVLVNVNMVDKERADKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILAKYDEE
FT                   LEGERPHSFRLEQGGMADGLRERELEEIRTKLRLQAQSLSSVGPRLASEYLSPEEMVTF
FT                   KKTKRRVKKIRKKEKEVIMRADDLLPLGDQTQDGDFGSRLRGRGRRRVPEVEEEALEDE
FT                   EKDPVAQPPPSDDTRVENMDISDEEDGGALPPGSPEGLEEDEAELELQKQLEKGRRLRQ
FT                   LQQLQQLRDSGEKVLEIVKKLESRQRGWEEEEDPERKGTIVFNATSEFCRTLGEIPTYG
FT                   LAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQHQDFSASSTTILD
FT                   EEPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRR
FT                   EEYRGFTQDFKEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRM
FT                   KKLDEEALLKKMSSSDTPLGTVALLQEKQKAQKTPYIVLSGSGKSMNANTITK"
FT   gene            <2260735..2262448
FT                   /locus_tag="mCG_140513"
FT                   /note="gene_id=mCG140513.0"
FT   mRNA            <2260735..2262448
FT                   /locus_tag="mCG_140513"
FT                   /product="mCG140513"
FT                   /note="gene_id=mCG140513.0 transcript_id=mCT169872.0
FT                   created on 05-JUN-2002"
FT   CDS             <2260736..2261119
FT                   /codon_start=1
FT                   /locus_tag="mCG_140513"
FT                   /product="mCG140513"
FT                   /note="gene_id=mCG140513.0 transcript_id=mCT169872.0
FT                   protein_id=mCP92923.0"
FT                   /db_xref="MGI:MGI:3041222"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CUU9"
FT                   /protein_id="EDL33118.1"
FT                   /translation="TRRSEGSAWLRSRPCAPLRASASAPRRPLPRSLPRSRLRFRRSPP
FT                   LLPPPLLRCLCFLCSRCRGGCSVVPPVPAAAVVPAASFSPRCFFDDPMIIASAWSRAAT
FT                   LAQTTRNGNASGSRDRPVPVAGN"
FT   gene            complement(2262425..>2272743)
FT                   /locus_tag="mCG_11735"
FT                   /note="gene_id=mCG11735.1"
FT   mRNA            complement(join(2262425..2262574,2262986..2263104,
FT                   2263291..2263390,2266661..2266831,2272197..2272344,
FT                   2272518..>2272743))
FT                   /locus_tag="mCG_11735"
FT                   /product="mCG11735"
FT                   /note="gene_id=mCG11735.1 transcript_id=mCT17368.2 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(2262439..2262574,2262986..2263104,
FT                   2263291..2263390,2266661..2266831,2272197..2272344,
FT                   2272518..>2272743))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11735"
FT                   /product="mCG11735"
FT                   /note="gene_id=mCG11735.1 transcript_id=mCT17368.2
FT                   protein_id=mCP12000.2"
FT                   /protein_id="EDL33119.1"
FT                   /translation="EHSDPHKGKGSSVNKGGNSGEKGSEEGELQSHNQGSSSSFNSLRK
FT                   PQKGISRAKDLKGPWDLERLHRQLQEELECGPQKQTWKALRAAVQASARNKKTPILGDD
FT                   ESFLSANFPNRTFHKRQEATRNLLRAWEQQQVKERQQAEVRRAREQQVQQQVARCLAAY
FT                   TSGGNRGTLAPQRKLEELRRKERQRFAEYQAELQGIQHRVQARPFLFQQAMQTNARLTA
FT                   NRRFSQVLSALGVDEDQLLAEAGNAESTPRKHRSNRSLRAEMEPSSQSPPKTEPTSSQP
FT                   GRRPSPTLDPDYSPREKN"
FT   assembly_gap    2270559..2270578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2279028..2294505
FT                   /locus_tag="mCG_1045479"
FT                   /note="gene_id=mCG1045479.1"
FT   mRNA            join(2279028..2279371,2287903..2288108,2289690..2289762,
FT                   2294417..2294505)
FT                   /locus_tag="mCG_1045479"
FT                   /product="mCG1045479, transcript variant mCT185164"
FT                   /note="gene_id=mCG1045479.1 transcript_id=mCT185164.0
FT                   created on 04-JUN-2003"
FT   mRNA            join(2279028..2279371,2287304..2287408,2287903..2288108,
FT                   2289690..2289979)
FT                   /locus_tag="mCG_1045479"
FT                   /product="mCG1045479, transcript variant mCT163183"
FT                   /note="gene_id=mCG1045479.1 transcript_id=mCT163183.1
FT                   created on 04-JUN-2003"
FT   mRNA            join(2279028..2279371,2287308..2287408,2287903..2288108,
FT                   2289690..2289979)
FT                   /locus_tag="mCG_1045479"
FT                   /product="mCG1045479, transcript variant mCT180411"
FT                   /note="gene_id=mCG1045479.1 transcript_id=mCT180411.0
FT                   created on 04-JUN-2003"
FT   mRNA            join(2279028..2279371,2287903..2288108,2289690..2289979)
FT                   /locus_tag="mCG_1045479"
FT                   /product="mCG1045479, transcript variant mCT180410"
FT                   /note="gene_id=mCG1045479.1 transcript_id=mCT180410.0
FT                   created on 04-JUN-2003"
FT   CDS             join(2279339..2279371,2287903..2288108,2289690..2289753)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045479"
FT                   /product="mCG1045479, isoform CRA_b"
FT                   /note="gene_id=mCG1045479.1 transcript_id=mCT185164.0
FT                   protein_id=mCP106422.0 isoform=CRA_b"
FT                   /protein_id="EDL33121.1"
FT                   /translation="MAWQWRLTNPKFPLVDVLIDRVCALIQGTLEEQGAHCDGEGEGGS
FT                   SAEQQGVQTRRDRRQRHVASLPNSRHCQMYFFMFRCHMHAWYLRMTEEDIRSPGT"
FT   CDS             join(2279339..2279371,2287903..2288108,2289690..2289753)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045479"
FT                   /product="mCG1045479, isoform CRA_b"
FT                   /note="gene_id=mCG1045479.1 transcript_id=mCT180410.0
FT                   protein_id=mCP103333.0 isoform=CRA_b"
FT                   /protein_id="EDL33123.1"
FT                   /translation="MAWQWRLTNPKFPLVDVLIDRVCALIQGTLEEQGAHCDGEGEGGS
FT                   SAEQQGVQTRRDRRQRHVASLPNSRHCQMYFFMFRCHMHAWYLRMTEEDIRSPGT"
FT   CDS             join(2279339..2279371,2287308..2287406)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045479"
FT                   /product="mCG1045479, isoform CRA_a"
FT                   /note="gene_id=mCG1045479.1 transcript_id=mCT180411.0
FT                   protein_id=mCP103332.0 isoform=CRA_a"
FT                   /protein_id="EDL33120.1"
FT                   /translation="MAWQWRLTNPKELCFLLAWNSLHRPDWPEESEICLHVPPEGED"
FT   CDS             join(2279339..2279371,2287304..2287345)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1045479"
FT                   /product="mCG1045479, isoform CRA_c"
FT                   /note="gene_id=mCG1045479.1 transcript_id=mCT163183.1
FT                   protein_id=mCP68235.1 isoform=CRA_c"
FT                   /protein_id="EDL33122.1"
FT                   /translation="MAWQWRLTNPKTGTVFLTGLELTT"
FT   gene            complement(2294720..2297119)
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /note="gene_id=mCG11754.2"
FT   mRNA            complement(join(2294720..2295322,2295628..2295716,
FT                   2295857..2295950,2296069..2296188,2296479..2296572,
FT                   2296658..2296730,2296970..2297119))
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /product="Dr1 associated protein 1 (negative cofactor 2
FT                   alpha), transcript variant mCT17466"
FT                   /note="gene_id=mCG11754.2 transcript_id=mCT17466.2 created
FT                   on 05-JUN-2002"
FT   mRNA            complement(join(2294720..2295322,2295628..2295716,
FT                   2295857..2295971,2296069..2296188,2296479..2296730,
FT                   2296970..2297119))
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /product="Dr1 associated protein 1 (negative cofactor 2
FT                   alpha), transcript variant mCT169859"
FT                   /note="gene_id=mCG11754.2 transcript_id=mCT169859.0 created
FT                   on 05-JUN-2002"
FT   mRNA            complement(join(2294720..2295272,2295628..2295716,
FT                   2295857..2295950,2296069..2296517))
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /product="Dr1 associated protein 1 (negative cofactor 2
FT                   alpha), transcript variant mCT169860"
FT                   /note="gene_id=mCG11754.2 transcript_id=mCT169860.0 created
FT                   on 05-JUN-2002"
FT   mRNA            complement(join(2294720..2295272,2295628..2295950,
FT                   2296069..2296517))
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /product="Dr1 associated protein 1 (negative cofactor 2
FT                   alpha), transcript variant mCT169858"
FT                   /note="gene_id=mCG11754.2 transcript_id=mCT169858.0 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(2295217..2295322,2295628..2295716,
FT                   2295857..2295950,2296069..2296188,2296479..2296572,
FT                   2296658..2296730,2296970..2297011))
FT                   /codon_start=1
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /product="Dr1 associated protein 1 (negative cofactor 2
FT                   alpha), isoform CRA_d"
FT                   /note="gene_id=mCG11754.2 transcript_id=mCT17466.2
FT                   protein_id=mCP12043.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q4FJW2"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="MGI:MGI:1913806"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJW2"
FT                   /protein_id="EDL33127.1"
FT                   /translation="MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELF
FT                   LESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHVDG
FT                   DKGPRRGRKPGSSGRKNGGTGSKGKDKKLSGTDSEQEDESEDTDTDGEEETPQLPPQAS
FT                   HPPAHFQSPPTPFIPFTSPLPLPPAPPGPSAADAEDEEDYDS"
FT   CDS             complement(join(2295217..2295322,2295628..2295716,
FT                   2295857..2295971,2296069..2296188,2296479..2296495))
FT                   /codon_start=1
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /product="Dr1 associated protein 1 (negative cofactor 2
FT                   alpha), isoform CRA_c"
FT                   /note="gene_id=mCG11754.2 transcript_id=mCT169859.0
FT                   protein_id=mCP92940.0 isoform=CRA_c"
FT                   /protein_id="EDL33126.1"
FT                   /translation="MTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHVDGDKGPR
FT                   RWTVPSRRGRKPGSSGRKNGGTGSKGKDKKLSGTDSEQEDESEDTDTDGEEETPQLPPQ
FT                   ASHPPAHFQSPPTPFIPFTSPLPLPPAPPGPSAADAEDEEDYDS"
FT   CDS             complement(join(2295217..2295272,2295628..2295716,
FT                   2295857..2295950,2296069..2296111))
FT                   /codon_start=1
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /product="Dr1 associated protein 1 (negative cofactor 2
FT                   alpha), isoform CRA_b"
FT                   /note="gene_id=mCG11754.2 transcript_id=mCT169860.0
FT                   protein_id=mCP92932.0 isoform=CRA_b"
FT                   /protein_id="EDL33125.1"
FT                   /translation="MGRTTTWMGTRVLEGAGNRAAAAGRTEAREAKAKTRSCPGQTLSR
FT                   RMSLRIQILMGKKRHHSFHPKPVTLLPTFRAPPGPSAADAEDEEDYDS"
FT   CDS             complement(join(2295217..2295272,2295628..2295763))
FT                   /codon_start=1
FT                   /gene="Drap1"
FT                   /locus_tag="mCG_11754"
FT                   /product="Dr1 associated protein 1 (negative cofactor 2
FT                   alpha), isoform CRA_a"
FT                   /note="gene_id=mCG11754.2 transcript_id=mCT169858.0
FT                   protein_id=mCP92926.0 isoform=CRA_a"
FT                   /protein_id="EDL33124.1"
FT                   /translation="MGPGPLINPDPFRALRMSLRIQILMGKKRHHSFHPKPVTLLPTFR
FT                   APPGPSAADAEDEEDYDS"
FT   assembly_gap    2297120..2297478
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   gene            <2297479..2299573
FT                   /gene="AI837181"
FT                   /locus_tag="mCG_19859"
FT                   /note="gene_id=mCG19859.2"
FT   mRNA            join(2297479..2297568,2298211..2299573)
FT                   /gene="AI837181"
FT                   /locus_tag="mCG_19859"
FT                   /product="expressed sequence AI837181, transcript variant
FT                   mCT17497"
FT                   /note="gene_id=mCG19859.2 transcript_id=mCT17497.2 created
FT                   on 09-SEP-2002"
FT   mRNA            join(<2297479..2297568,2298197..2299572)
FT                   /gene="AI837181"
FT                   /locus_tag="mCG_19859"
FT                   /product="expressed sequence AI837181, transcript variant
FT                   mCT193099"
FT                   /note="gene_id=mCG19859.2 transcript_id=mCT193099.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2297560..2297568,2298197..2298967)
FT                   /codon_start=1
FT                   /gene="AI837181"
FT                   /locus_tag="mCG_19859"
FT                   /product="expressed sequence AI837181, isoform CRA_b"
FT                   /note="gene_id=mCG19859.2 transcript_id=mCT193099.0
FT                   protein_id=mCP114073.0 isoform=CRA_b"
FT                   /protein_id="EDL33129.1"
FT                   /translation="RPEFPHNRMEPNEELEEEDSPGGREDGFTAEHLAAEAMAADMDPW
FT                   LVFDARTTPATELDAWLAKYPPSQVTRYGDPGSPNSEPVGWIAAYGQGYTPNSGDVQGL
FT                   QAAWEALQTSGRPITPGTLRQLAITHHVLSGKWLIHLSPGFKLDHAWAGIARAVVEGRL
FT                   QVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKCLLTYKPDVYTYLGIY
FT                   RANRWHLCPTLYESRFQLGGNTRGSRVLDRANNVELT"
FT   CDS             2298212..2298967
FT                   /codon_start=1
FT                   /gene="AI837181"
FT                   /locus_tag="mCG_19859"
FT                   /product="expressed sequence AI837181, isoform CRA_a"
FT                   /note="gene_id=mCG19859.2 transcript_id=mCT17497.2
FT                   protein_id=mCP11987.2 isoform=CRA_a"
FT                   /protein_id="EDL33128.1"
FT                   /translation="MEPNEELEEEDSPGGREDGFTAEHLAAEAMAADMDPWLVFDARTT
FT                   PATELDAWLAKYPPSQVTRYGDPGSPNSEPVGWIAAYGQGYTPNSGDVQGLQAAWEALQ
FT                   TSGRPITPGTLRQLAITHHVLSGKWLIHLSPGFKLDHAWAGIARAVVEGRLQVAKVSPR
FT                   AKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKCLLTYKPDVYTYLGIYRANRWHLC
FT                   PTLYESRFQLGGNTRGSRVLDRANNVELT"
FT   gene            2308171..2309057
FT                   /pseudo
FT                   /locus_tag="mCG_19857"
FT                   /note="gene_id=mCG19857.2"
FT   mRNA            2308171..2309057
FT                   /pseudo
FT                   /locus_tag="mCG_19857"
FT                   /note="gene_id=mCG19857.2 transcript_id=mCT17493.2 created
FT                   on 05-JUN-2002"
FT   gene            2319672..2327911
FT                   /gene="Fosl1"
FT                   /locus_tag="mCG_11767"
FT                   /note="gene_id=mCG11767.1"
FT   mRNA            join(2319672..2320029,2322134..2322325,2326386..2326493,
FT                   2326865..2327911)
FT                   /gene="Fosl1"
FT                   /locus_tag="mCG_11767"
FT                   /product="fos-like antigen 1"
FT                   /note="gene_id=mCG11767.1 transcript_id=mCT17479.1 created
FT                   on 05-JUN-2002"
FT   CDS             join(2319925..2320029,2322134..2322325,2326386..2326493,
FT                   2326865..2327281)
FT                   /codon_start=1
FT                   /gene="Fosl1"
FT                   /locus_tag="mCG_11767"
FT                   /product="fos-like antigen 1"
FT                   /note="gene_id=mCG11767.1 transcript_id=mCT17479.1
FT                   protein_id=mCP11967.2"
FT                   /db_xref="GOA:Q3UMK5"
FT                   /db_xref="InterPro:IPR000837"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="MGI:MGI:107179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UMK5"
FT                   /protein_id="EDL33130.1"
FT                   /translation="MYRDYGEPGPSSGAGSPYGRPAQPPQAQAQTAQQQKFHLVPSIDS
FT                   SSQELHWMVQPHFLGPTGYPRPLAYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEE
FT                   EERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLEL
FT                   VLEAHRPICKIPEGDKKDPGGSGSTSGASSPPAPGRPVPCISLSPGPVLEPEALHTPTL
FT                   MTTPSLTPFTPSLVFTYPSTPEPCSSAHRKSSSSSGDPSSDPLGSPTLLAL"
FT   gene            complement(2328520..2329471)
FT                   /locus_tag="mCG_148134"
FT                   /note="gene_id=mCG148134.0"
FT   mRNA            complement(join(2328520..2329157,2329313..2329471))
FT                   /locus_tag="mCG_148134"
FT                   /product="mCG148134"
FT                   /note="gene_id=mCG148134.0 transcript_id=mCT188397.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(2328958..2329157,2329313..2329370))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148134"
FT                   /product="mCG148134"
FT                   /note="gene_id=mCG148134.0 transcript_id=mCT188397.0
FT                   protein_id=mCP108420.0"
FT                   /protein_id="EDL33131.1"
FT                   /translation="MEAEAGGLEELTDEEMAALGGEPGAARPLLLSGLGAPTRTACGAP
FT                   VAALWDPSIPGGARGPGWLLAEASGAGRPPGGAAAGKSGP"
FT   gene            2332579..2337026
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /note="gene_id=mCG19865.4"
FT   mRNA            join(2332579..2332751,2332934..2333132,2333363..2333489,
FT                   2334504..2334604,2335143..2335297,2335576..2335684,
FT                   2335759..2335822,2336101..2336187,2336306..2336403,
FT                   2336897..2337026)
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /product="fibroblast growth factor (acidic) intracellular
FT                   binding protein, transcript variant mCT180438"
FT                   /note="gene_id=mCG19865.4 transcript_id=mCT180438.1 created
FT                   on 11-JUN-2003"
FT   mRNA            join(2332579..2332751,2332934..2333132,2333363..2333489,
FT                   2334504..2334604,2335143..2335276,2335576..2335684,
FT                   2335759..2335822,2336101..2336187,2336306..2336403,
FT                   2336897..2337026)
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /product="fibroblast growth factor (acidic) intracellular
FT                   binding protein, transcript variant mCT17504"
FT                   /note="gene_id=mCG19865.4 transcript_id=mCT17504.3 created
FT                   on 11-JUN-2003"
FT   mRNA            join(2332579..2332751,2332934..2333132,2333363..2333489,
FT                   2334504..2334604,2335143..2335276,2335576..2336774)
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /product="fibroblast growth factor (acidic) intracellular
FT                   binding protein, transcript variant mCT169873"
FT                   /note="gene_id=mCG19865.4 transcript_id=mCT169873.2 created
FT                   on 11-JUN-2003"
FT   mRNA            join(2332579..2332751,2332934..2335046)
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /product="fibroblast growth factor (acidic) intracellular
FT                   binding protein, transcript variant mCT180439"
FT                   /note="gene_id=mCG19865.4 transcript_id=mCT180439.1 created
FT                   on 11-JUN-2003"
FT   CDS             join(2332667..2332751,2332934..2333132,2333363..2333489,
FT                   2334504..2334604,2335143..2335297,2335576..2335684,
FT                   2335759..2335822,2336101..2336187,2336306..2336403,
FT                   2336897..2336966)
FT                   /codon_start=1
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /product="fibroblast growth factor (acidic) intracellular
FT                   binding protein, isoform CRA_d"
FT                   /note="gene_id=mCG19865.4 transcript_id=mCT180438.1
FT                   protein_id=mCP103361.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q8K2D8"
FT                   /db_xref="InterPro:IPR008614"
FT                   /db_xref="MGI:MGI:1926233"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K2D8"
FT                   /protein_id="EDL33135.1"
FT                   /translation="MTSELDIFVGNTTLIDEDVYRLWLDGYSVNDAVALRVRSGILEQT
FT                   GATTGVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQTLLIERYYTFDEAFV
FT                   REVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHF
FT                   LLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDP
FT                   DSQVDDMDVDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMETNFKN
FT                   LSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRLFLSQYSASVHSLDG
FT                   FRHQALWDRYMGTLRGCLLRLYHD"
FT   CDS             join(2332667..2332751,2332934..2333132,2333363..2333489,
FT                   2334504..2334604,2335143..2335276,2335576..2335684,
FT                   2335759..2335822,2336101..2336187,2336306..2336403,
FT                   2336897..2336966)
FT                   /codon_start=1
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /product="fibroblast growth factor (acidic) intracellular
FT                   binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG19865.4 transcript_id=mCT17504.3
FT                   protein_id=mCP12065.0 isoform=CRA_b"
FT                   /protein_id="EDL33133.1"
FT                   /translation="MTSELDIFVGNTTLIDEDVYRLWLDGYSVNDAVALRVRSGILEQT
FT                   GATTGVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQTLLIERYYTFDEAFV
FT                   REVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHF
FT                   LLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQVDDM
FT                   DVDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMETNFKNLSRGLVN
FT                   VAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRLFLSQYSASVHSLDGFRHQALW
FT                   DRYMGTLRGCLLRLYHD"
FT   CDS             join(2332667..2332751,2332934..2333132,2333363..2333489,
FT                   2334504..2334604,2335143..2335276,2335576..2335688)
FT                   /codon_start=1
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /product="fibroblast growth factor (acidic) intracellular
FT                   binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG19865.4 transcript_id=mCT169873.2
FT                   protein_id=mCP92915.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D8E9"
FT                   /db_xref="InterPro:IPR008614"
FT                   /db_xref="MGI:MGI:1926233"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D8E9"
FT                   /protein_id="EDL33132.1"
FT                   /translation="MTSELDIFVGNTTLIDEDVYRLWLDGYSVNDAVALRVRSGILEQT
FT                   GATTGVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQTLLIERYYTFDEAFV
FT                   REVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHF
FT                   LLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQVDDM
FT                   DVDLDKEFLQDLKELKVLVADKDLLDLHKR"
FT   CDS             join(2332667..2332751,2332934..2333190)
FT                   /codon_start=1
FT                   /gene="Fibp"
FT                   /locus_tag="mCG_19865"
FT                   /product="fibroblast growth factor (acidic) intracellular
FT                   binding protein, isoform CRA_c"
FT                   /note="gene_id=mCG19865.4 transcript_id=mCT180439.1
FT                   protein_id=mCP103360.0 isoform=CRA_c"
FT                   /protein_id="EDL33134.1"
FT                   /translation="MTSELDIFVGNTTLIDEDVYRLWLDGYSVNDAVALRVRSGILEQT
FT                   GATTGVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQTLLIERCSPGVGDGG
FT                   GYWQGCQSI"
FT   gene            complement(2337016..>2340460)
FT                   /gene="Ctsw"
FT                   /locus_tag="mCG_11758"
FT                   /note="gene_id=mCG11758.2"
FT   mRNA            complement(join(2337016..2337423,2337502..2337702,
FT                   2337777..2337841,2337992..2338117,2338203..2338457,
FT                   2338553..2338707,2338995..2339108,2339810..2339894,
FT                   2340375..>2340460))
FT                   /gene="Ctsw"
FT                   /locus_tag="mCG_11758"
FT                   /product="cathepsin W, transcript variant mCT193092"
FT                   /note="gene_id=mCG11758.2 transcript_id=mCT193092.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2337220..2337423,2337502..2337702,
FT                   2337777..2337841,2337992..2338117,2338203..2338283,
FT                   2338361..2338457,2338553..2338707,2338995..2339108,
FT                   2339810..2339894,2340375..2340460))
FT                   /gene="Ctsw"
FT                   /locus_tag="mCG_11758"
FT                   /product="cathepsin W, transcript variant mCT17470"
FT                   /note="gene_id=mCG11758.2 transcript_id=mCT17470.1 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(2337313..2337423,2337502..2337702,
FT                   2337777..2337841,2337992..2338117,2338203..2338283,
FT                   2338361..2338457,2338553..2338707,2338995..2339108,
FT                   2339810..2339894,2340375..2340455))
FT                   /codon_start=1
FT                   /gene="Ctsw"
FT                   /locus_tag="mCG_11758"
FT                   /product="cathepsin W, isoform CRA_b"
FT                   /note="gene_id=mCG11758.2 transcript_id=mCT17470.1
FT                   protein_id=mCP12088.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C2M0"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR013201"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="InterPro:IPR033158"
FT                   /db_xref="MGI:MGI:1338045"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C2M0"
FT                   /protein_id="EDL33137.1"
FT                   /translation="MTLTAHLSYFLVLLLAGQGLSDSLLTKDAGPRPLELKEVFKLFQI
FT                   RFNRSYWNPAEYTRRLSIFAHNLAQAQRLQQEDLGTAEFGETPFSDLTEEEFGQLYGQE
FT                   RSPERTPNMTKKVESNTWGESVPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQAL
FT                   WRIKHQQFVDVSVQELLDCERCGNGCNGGFVWDAYLTVLNNSGLASEKDYPFQGDRKPH
FT                   RCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSS
FT                   CDPRQVDHSVLLVGFGKEKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRL
FT                   YRGNNTCGVTKYPFTAQVDSPVKKARTSCPP"
FT   CDS             complement(join(2338218..2338457,2338553..2338707,
FT                   2338995..2339108,2339810..2339894,2340375..>2340458))
FT                   /codon_start=1
FT                   /gene="Ctsw"
FT                   /locus_tag="mCG_11758"
FT                   /product="cathepsin W, isoform CRA_a"
FT                   /note="gene_id=mCG11758.2 transcript_id=mCT193092.0
FT                   protein_id=mCP114025.0 isoform=CRA_a"
FT                   /protein_id="EDL33136.1"
FT                   /translation="TMTLTAHLSYFLVLLLAGQGLSDSLLTKDAGPRPLELKEVFKLFQ
FT                   IRFNRSYWNPAEYTRRLSIFAHNLAQAQRLQQEDLGTAEFGETPFSDLTEEEFGQLYGQ
FT                   ERSPERTPNMTKKVESNTWGESVPRTCDWRKAKNIISSVKNQGSCKCCWAMAAADNIQA
FT                   LWRIKHQQFVDVSVQGMTGNGHVSGQWPRGPAHLCCPFLSQSCWTANAVEMVAMVASCG
FT                   THI"
FT   assembly_gap    2342863..2342882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2345744..2353552
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /note="gene_id=mCG11764.2"
FT   mRNA            join(2345744..2346094,2346798..2346915,2347145..2347193,
FT                   2347803..2348009,2349264..2349386,2349629..2349745,
FT                   2349903..2350022,2351730..2351849,2351934..2352060,
FT                   2352246..2352441,2353261..2353552)
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2, transcript variant
FT                   mCT169863"
FT                   /note="gene_id=mCG11764.2 transcript_id=mCT169863.0 created
FT                   on 10-FEB-2003"
FT   assembly_gap    2346405..2346424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(2346442..2346511,2346798..2346915,2347145..2347193,
FT                   2347803..2348009,2349264..2349386,2349629..2349745,
FT                   2349903..2350035,2351730..2351849,2351934..2352060,
FT                   2352246..2352441,2353261..2353552)
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2, transcript variant
FT                   mCT180414"
FT                   /note="gene_id=mCG11764.2 transcript_id=mCT180414.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(2346442..2346511,2346798..2346915,2347145..2347193,
FT                   2347803..2348009,2349264..2349386,2349629..2349745,
FT                   2349903..2350022,2351730..2351849,2351934..2352060,
FT                   2352246..2352441,2353261..2353552)
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2, transcript variant
FT                   mCT169862"
FT                   /note="gene_id=mCG11764.2 transcript_id=mCT169862.0 created
FT                   on 10-FEB-2003"
FT   mRNA            join(2346480..2346915,2347145..2347193,2347803..2348009,
FT                   2349264..2349386,2349629..2349745,2349903..2350022,
FT                   2351730..2351849,2351934..2352060,2352246..2352441,
FT                   2353261..2353552)
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2, transcript variant
FT                   mCT17476"
FT                   /note="gene_id=mCG11764.2 transcript_id=mCT17476.1 created
FT                   on 10-FEB-2003"
FT   CDS             join(2346748..2346915,2347145..2347193,2347803..2348009,
FT                   2349264..2349386,2349629..2349745,2349903..2350022,
FT                   2351730..2351849,2351934..2352060,2352246..2352441,
FT                   2353261..2353422)
FT                   /codon_start=1
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG11764.2 transcript_id=mCT17476.1
FT                   protein_id=mCP12032.1 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8D6"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="InterPro:IPR026824"
FT                   /db_xref="MGI:MGI:1891209"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8D6"
FT                   /protein_id="EDL33141.1"
FT                   /translation="MGGAVAETPDFCPPPPSLRMLPFASCLPGSLLLWAFLLLLLGAAS
FT                   PQDPEEPDSYTECTDGYEWDADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSA
FT                   AVISDLHGEGPPPPAAHAQQPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLP
FT                   GSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVD
FT                   VNECDMGAPCEQRCFNSYGTFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEP
FT                   GRFSCHCPQGYQLLATRLCQDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQ
FT                   VSDNRCLCPASNPLCREQPSSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRS
FT                   GNTQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVG
FT                   AYTF"
FT   CDS             join(2346805..2346915,2347145..2347193,2347803..2348009,
FT                   2349264..2349386,2349629..2349745,2349903..2350022,
FT                   2351730..2351849,2351934..2352060,2352246..2352441,
FT                   2353261..2353422)
FT                   /codon_start=1
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG11764.2 transcript_id=mCT169862.0
FT                   protein_id=mCP92969.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542X5"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="InterPro:IPR026824"
FT                   /db_xref="MGI:MGI:1891209"
FT                   /db_xref="UniProtKB/TrEMBL:Q542X5"
FT                   /protein_id="EDL33138.1"
FT                   /translation="MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEW
FT                   DADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQ
FT                   QPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECV
FT                   DIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYG
FT                   TFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLC
FT                   QDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQP
FT                   SSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAML
FT                   VLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF"
FT   CDS             join(2346805..2346915,2347145..2347193,2347803..2348009,
FT                   2349264..2349386,2349629..2349745,2349903..2350022,
FT                   2351730..2351849,2351934..2352060,2352246..2352441,
FT                   2353261..2353422)
FT                   /codon_start=1
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG11764.2 transcript_id=mCT169863.0
FT                   protein_id=mCP92957.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542X5"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="InterPro:IPR026824"
FT                   /db_xref="MGI:MGI:1891209"
FT                   /db_xref="UniProtKB/TrEMBL:Q542X5"
FT                   /protein_id="EDL33139.1"
FT                   /translation="MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEW
FT                   DADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQ
FT                   QPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECV
FT                   DIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYG
FT                   TFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLC
FT                   QDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQP
FT                   SSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAML
FT                   VLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF"
FT   CDS             join(2346805..2346915,2347145..2347193,2347803..2348009,
FT                   2349264..2349386,2349629..2349745,2349903..2350035,
FT                   2351730..2351739)
FT                   /codon_start=1
FT                   /gene="Efemp2"
FT                   /locus_tag="mCG_11764"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG11764.2 transcript_id=mCT180414.0
FT                   protein_id=mCP103336.0 isoform=CRA_b"
FT                   /protein_id="EDL33140.1"
FT                   /translation="MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEW
FT                   DADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQ
FT                   QPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECV
FT                   DIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYG
FT                   TFLCRCNQGYELHRDGFSCSGESHLYR"
FT   assembly_gap    2348931..2348950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2354457..2360041)
FT                   /locus_tag="mCG_140511"
FT                   /note="gene_id=mCG140511.0"
FT   mRNA            complement(join(2354457..2354729,2354808..2354891,
FT                   2355155..2355258,2355335..2355463,2355630..2355725,
FT                   2355813..2355929,2356559..2356656,2356739..2356860,
FT                   2356958..2357053,2357188..2357325,2357729..2357814,
FT                   2357980..2358048,2358187..2358288,2358725..2358807,
FT                   2359462..2359591,2359688..2360041))
FT                   /locus_tag="mCG_140511"
FT                   /product="mCG140511, transcript variant mCT169865"
FT                   /note="gene_id=mCG140511.0 transcript_id=mCT169865.0
FT                   created on 06-JUN-2002"
FT   mRNA            complement(join(2354457..2354729,2354808..2354891,
FT                   2355155..2355258,2355335..2355365,2355630..2355725,
FT                   2355813..2355929,2356559..2356656,2356739..2356860,
FT                   2356958..2357053,2357188..2357814,2357980..2358048,
FT                   2358187..2358288,2358725..2358807,2359462..2360041))
FT                   /locus_tag="mCG_140511"
FT                   /product="mCG140511, transcript variant mCT169868"
FT                   /note="gene_id=mCG140511.0 transcript_id=mCT169868.0
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(2354663..2354729,2354808..2354891,
FT                   2355155..2355258,2355335..2355463,2355630..2355725,
FT                   2355813..2355929,2356559..2356656,2356739..2356860,
FT                   2356958..2357053,2357188..2357325,2357729..2357814,
FT                   2357980..2358048,2358187..2358288,2358725..2358807,
FT                   2359462..2359591,2359688..2359822))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140511"
FT                   /product="mCG140511, isoform CRA_b"
FT                   /note="gene_id=mCG140511.0 transcript_id=mCT169865.0
FT                   protein_id=mCP92951.0 isoform=CRA_b"
FT                   /protein_id="EDL33143.1"
FT                   /translation="MAEPVRLGRKRPLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQK
FT                   ALRSLQRYPLPLRSGKEAKILQHFGDRLCRMLDEKLKQHLASGGDHAPSSPSGKKGASK
FT                   GPPEQVQDSSMPVPTQPQAGSTSVGYWPAQNSGAREILLQLYREHLNSDGHSFLTKEEL
FT                   LQKCAQKTPRVVPGSSKPWPALRSLLHRNLILGTHRPARYALTPEGLELAQKLAEAEGL
FT                   STRHAGFRPEEHHGEDSAVPEALSEPGTTEGAVQQRPLELRPSEYRVLLCVDIGETRGA
FT                   GHRPEMLRELQRLRVPHTVRKLHVGDFVWVAQETRPRDPERPGELVLDHIVERKRLDDL
FT                   CSSIIDGRFREQKFRLKRCGLGHRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFV
FT                   KRTMDIKESAGYLALLTKGLERLYQGHTLRSRPWGAPGAAESEAKPSTNPLCSLLTFSD
FT                   FNAEAVKNKAQSVREVFARQLMQVRGLSGEKAAAVVDRYSTPASLLAAYDACATAKEQE
FT                   MLLSTIKCGRLQRNLGPALSRTLYQLYCSHSPLS"
FT   CDS             complement(join(2355363..2355365,2355630..2355725,
FT                   2355813..2355929,2356559..2356656,2356739..2356860,
FT                   2356958..2357053,2357188..2357345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140511"
FT                   /product="mCG140511, isoform CRA_a"
FT                   /note="gene_id=mCG140511.0 transcript_id=mCT169868.0
FT                   protein_id=mCP92980.0 isoform=CRA_a"
FT                   /protein_id="EDL33142.1"
FT                   /translation="MCPSPPRYALTPEGLELAQKLAEAEGLSTRHAGFRPEEHHGEDSA
FT                   VPEALSEPGTTEGAVQQRPLELRPSEYRVLLCVDIGETRGAGHRPEMLRELQRLRVPHT
FT                   VRKLHVGDFVWVAQETRPRDPERPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKR
FT                   CGLGHRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTMDIKESAGYLALLTK
FT                   GLERLYQ"
FT   gene            2362163..2366844
FT                   /gene="Cfl1"
FT                   /locus_tag="mCG_11768"
FT                   /note="gene_id=mCG11768.2"
FT   mRNA            join(2362163..2362301,2364196..2364503,2364854..2364930,
FT                   2365080..2366844)
FT                   /gene="Cfl1"
FT                   /locus_tag="mCG_11768"
FT                   /product="cofilin 1, non-muscle"
FT                   /note="gene_id=mCG11768.2 transcript_id=mCT17481.2 created
FT                   on 06-JUN-2002"
FT   CDS             join(2362299..2362301,2364196..2364503,2364854..2364930,
FT                   2365080..2365192)
FT                   /codon_start=1
FT                   /gene="Cfl1"
FT                   /locus_tag="mCG_11768"
FT                   /product="cofilin 1, non-muscle"
FT                   /note="gene_id=mCG11768.2 transcript_id=mCT17481.2
FT                   protein_id=mCP12071.2"
FT                   /db_xref="GOA:Q544Y7"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR027234"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="MGI:MGI:101757"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y7"
FT                   /protein_id="EDL33144.1"
FT                   /translation="MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
FT                   NIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFW
FT                   APENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEG
FT                   KPL"
FT   gene            complement(2366547..>2382160)
FT                   /gene="B930037P14Rik"
FT                   /locus_tag="mCG_140512"
FT                   /note="gene_id=mCG140512.0"
FT   mRNA            complement(join(2366547..2367687,2367763..2367922,
FT                   2368021..2368107,2368691..2368730,2368995..2369070,
FT                   2369152..2369257,2369380..2369484,2369610..2369733,
FT                   2369885..2370116,2370330..2370434,2381922..>2382160))
FT                   /gene="B930037P14Rik"
FT                   /locus_tag="mCG_140512"
FT                   /product="RIKEN cDNA B930037P14, transcript variant
FT                   mCT169867"
FT                   /note="gene_id=mCG140512.0 transcript_id=mCT169867.0
FT                   created on 06-JUN-2002"
FT   mRNA            complement(join(2366547..2367687,2367763..2367922,
FT                   2368021..2368730,2368995..2369070,2369152..2369257,
FT                   2369380..2369484,2369610..2369733,2369885..2370116,
FT                   2370330..2370434,2381922..>2382160))
FT                   /gene="B930037P14Rik"
FT                   /locus_tag="mCG_140512"
FT                   /product="RIKEN cDNA B930037P14, transcript variant
FT                   mCT169866"
FT                   /note="gene_id=mCG140512.0 transcript_id=mCT169866.0
FT                   created on 06-JUN-2002"
FT   mRNA            complement(join(2366983..2367353,2367602..2367687,
FT                   2367763..2367922,2368021..2368107,2368691..2368730,
FT                   2368995..2369070,2369152..2369257,2369380..2369484,
FT                   2369610..2369733,2369885..2370116,2370330..2370434,
FT                   2381922..>2382078))
FT                   /gene="B930037P14Rik"
FT                   /locus_tag="mCG_140512"
FT                   /product="RIKEN cDNA B930037P14, transcript variant
FT                   mCT193058"
FT                   /note="gene_id=mCG140512.0 transcript_id=mCT193058.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(2367300..2367353,2367602..2367687,
FT                   2367763..2367922,2368021..2368107,2368691..2368730,
FT                   2368995..2369070,2369152..2369257,2369380..2369484,
FT                   2369610..2369733,2369885..>2369973))
FT                   /codon_start=1
FT                   /gene="B930037P14Rik"
FT                   /locus_tag="mCG_140512"
FT                   /product="RIKEN cDNA B930037P14, isoform CRA_c"
FT                   /note="gene_id=mCG140512.0 transcript_id=mCT193058.0
FT                   protein_id=mCP114036.0 isoform=CRA_c partial"
FT                   /protein_id="EDL33147.1"
FT                   /translation="GLREKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEV
FT                   FLQRLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLGGLLRSIVRSADEVLITGISG
FT                   LKEVDDFFEHERTFLVEYHTRIRDTCQRADRVMHSHKCLADNYIPISAALSSLGTQEVN
FT                   QLKRSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADY
FT                   ENANKALDKARTRNREVRPAESRQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIE
FT                   LAELELKHAKASTLLLQNTLVALKGEP"
FT   CDS             complement(join(2367407..2367687,2367763..2367922,
FT                   2368021..2368107,2368691..2368730,2368995..2369070,
FT                   2369152..2369257,2369380..2369484,2369610..2369733,
FT                   2369885..>2369967))
FT                   /codon_start=1
FT                   /gene="B930037P14Rik"
FT                   /locus_tag="mCG_140512"
FT                   /product="RIKEN cDNA B930037P14, isoform CRA_b"
FT                   /note="gene_id=mCG140512.0 transcript_id=mCT169867.0
FT                   protein_id=mCP92944.0 isoform=CRA_b partial"
FT                   /protein_id="EDL33146.1"
FT                   /translation="REKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEVFL
FT                   QRLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLGGLLRSIVRSADEVLITGISGLK
FT                   EVDDFFEHERTFLVEYHTRIRDTCQRADRVMHSHKCLADNYIPISAALSSLGTQEVNQL
FT                   KRSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYEN
FT                   ANKALDKARTRNREVRPAESRQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELA
FT                   ELELKHAKVSAHCLLHHELLCCSHLLSPRYGGAPSDEGAAVYSQARGSRQRSSEARVFC
FT                   PSLPWVVGGEPEG"
FT   CDS             complement(join(2368646..2368730,2368995..2369070,
FT                   2369152..2369257,2369380..2369484,2369610..2369733,
FT                   2369885..>2369967))
FT                   /codon_start=1
FT                   /gene="B930037P14Rik"
FT                   /locus_tag="mCG_140512"
FT                   /product="RIKEN cDNA B930037P14, isoform CRA_a"
FT                   /note="gene_id=mCG140512.0 transcript_id=mCT169866.0
FT                   protein_id=mCP92952.0 isoform=CRA_a partial"
FT                   /protein_id="EDL33145.1"
FT                   /translation="REKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEVFL
FT                   QRLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLGGLLRSIVRSADEVLITGISGLK
FT                   EVDDFFEHERTFLVEYHTRIRDTCQRADRVMHSHKCLADNYIPISAALSSLGTQEVNQL
FT                   KRSFLKLAELFERLRVSTAFCTRSSLAAP"
FT   assembly_gap    2369981..2370000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2374226..2375396)
FT                   /gene="1700020D05Rik"
FT                   /locus_tag="mCG_11721"
FT                   /note="gene_id=mCG11721.2"
FT   mRNA            complement(2374226..2375396)
FT                   /gene="1700020D05Rik"
FT                   /locus_tag="mCG_11721"
FT                   /product="RIKEN cDNA 1700020D05"
FT                   /note="gene_id=mCG11721.2 transcript_id=mCT17364.2 created
FT                   on 06-JUN-2002"
FT   CDS             complement(2374475..2375359)
FT                   /codon_start=1
FT                   /gene="1700020D05Rik"
FT                   /locus_tag="mCG_11721"
FT                   /product="RIKEN cDNA 1700020D05"
FT                   /note="gene_id=mCG11721.2 transcript_id=mCT17364.2
FT                   protein_id=mCP12012.1"
FT                   /db_xref="GOA:Q99PB1"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="MGI:MGI:1922805"
FT                   /db_xref="UniProtKB/TrEMBL:Q99PB1"
FT                   /protein_id="EDL33148.1"
FT                   /translation="MSVSPPGHMLQKTRSRSHPGAQLWSPSDCCPGVSREIARASGHPD
FT                   ASQDTPGTPSPSFRQVQATSAPELWTQKQLELKVAELVQFLLIKDQRKIPIKQSGIMKH
FT                   VVRDYKNIFPDLLKLAAERLHYVFGYKLVELDPKSNAYILINALEPVGKDGELRGYQRT
FT                   PTTGLLMIILGLILMNGHSIPENDVWCFLRRLGVYPTKKHSVFGYPKKLITEDFVKQRY
FT                   LEYRRIPHTDPVDCELQWGPRANLETSKMKVLKFVAKIHNQDPKDWPTQYCEALADEQR
FT                   RVRPEPNGPALTS"
FT   assembly_gap    2386561..2386641
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    2408748..2408838
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    2417269..2417333
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(2420389..2431858)
FT                   /gene="Ovol1"
FT                   /locus_tag="mCG_11736"
FT                   /note="gene_id=mCG11736.3"
FT   mRNA            complement(join(2420389..2422505,2422737..2422926,
FT                   2424806..2425023,2431448..2431858))
FT                   /gene="Ovol1"
FT                   /locus_tag="mCG_11736"
FT                   /product="OVO homolog-like 1 (Drosophila)"
FT                   /note="gene_id=mCG11736.3 transcript_id=mCT17369.3 created
FT                   on 19-MAR-2004"
FT   CDS             complement(join(2422210..2422505,2422737..2422926,
FT                   2424806..2425023,2431448..2431547))
FT                   /codon_start=1
FT                   /gene="Ovol1"
FT                   /locus_tag="mCG_11736"
FT                   /product="OVO homolog-like 1 (Drosophila)"
FT                   /note="gene_id=mCG11736.3 transcript_id=mCT17369.3
FT                   protein_id=mCP12054.3"
FT                   /protein_id="EDL33149.1"
FT                   /translation="MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYR
FT                   EPEASVAEPPSCPLALDMSLRDSSYSVAPGPCVVAQLPSEDVSHLTDPQSRDQGFLRTK
FT                   MKVTLGDSPNGDLFTCHICQKSFTHQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKR
FT                   HVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTS
FT                   ESQEGHVLHLKERHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL"
FT   gene            2431507..2432927
FT                   /locus_tag="mCG_148127"
FT                   /note="gene_id=mCG148127.1"
FT   mRNA            join(2431507..2431582,2432289..2432927)
FT                   /locus_tag="mCG_148127"
FT                   /product="mCG148127"
FT                   /note="gene_id=mCG148127.1 transcript_id=mCT188390.1
FT                   created on 19-MAR-2004"
FT   CDS             join(2431517..2431582,2432289..2432630)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148127"
FT                   /product="mCG148127"
FT                   /note="gene_id=mCG148127.1 transcript_id=mCT188390.1
FT                   protein_id=mCP108414.1"
FT                   /protein_id="EDL33150.1"
FT                   /translation="MASSPGTREASSVPPGPARFALVRAQPGAPGAPGEAQSRGAGTGG
FT                   PGPNPAARDPQGQGEQFLVQRRGICWAPGSCGKARETRGARGPGGSDAPVNPKLEPAFW
FT                   FRGRLNCPESNLTQASTLAYGRVYSPKLSWS"
FT   assembly_gap    2438987..2439103
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            <2439680..2442485
FT                   /locus_tag="mCG_55892"
FT                   /note="gene_id=mCG55892.2"
FT   mRNA            <2439680..2442485
FT                   /locus_tag="mCG_55892"
FT                   /product="mCG55892"
FT                   /note="gene_id=mCG55892.2 transcript_id=mCT56075.2 created
FT                   on 06-JUN-2002"
FT   CDS             2439680..2442406
FT                   /codon_start=1
FT                   /locus_tag="mCG_55892"
FT                   /product="mCG55892"
FT                   /note="gene_id=mCG55892.2 transcript_id=mCT56075.2
FT                   protein_id=mCP33765.1"
FT                   /protein_id="EDL33151.1"
FT                   /translation="MGPLGREAWAQRLGAFRASPSAFLAGAEGEDLGRDLLSDLRSEKL
FT                   SEQTKVGPARVPCRGPHGCFILPHAELNEFLLNPPSQVSLLTLSLEYSDKLWPDAPAAE
FT                   AAATSLLDTLVLLPTRPSALRRLLLLAATTALVSGDALGPTSGASCRLLPLLLGLASGR
FT                   DLGRSFGTPSEQRHLQATACECLGELERCKPGLLAGALGMLRSLPGQTGPIQPVSLLLA
FT                   LVLHDTLVVQSRSGAGLQGLLVAEDFSTGSCPWDWTLAEEWDAHLKPQGPSWPTAGEEE
FT                   RGFPVLEPSPEDARELKAAVAQLLDTSYLLTPVAQAQLLWLLGWALRGLRGQPPVLFKP
FT                   QLVRLLGTAQLTLLHSVLSLKAAFGEALFTAQDEALLLRRLTLGAQHPALPSPTHLFYL
FT                   HCILSFPENCPLGPEGEEAAPLLLGPQLCRGLMPSLLHDPTVLLARLHLLCLLCADDEE
FT                   EEKDQTQGPQWFLQEVLAGLQQRAALDGGPRALATLCFQASYLVTNCLTRHSTVQTFLI
FT                   RGLAQLYRARPSLAPHFVDLLDQVSPELREPLREVLLQEAVARPGESEALCWHLQMLAK
FT                   VAEGATQSTTLSFLQAAAVHCTDWGLHQALLRVCRALLRTGGGDGLANLLQELARQLEN
FT                   ADGRDHARLYYVLLSHLSSSKLGMALGPSLAAPALASSLMAENQGFSSALMVQETSAPI
FT                   QLSVGPQQAKGPLPVLCLQVQALDAPVYSLELRFRVEGQLYEPLEAVHIPCLRPGQPAH
FT                   PLYLLLQPRCPAPARLHVRALYSTSAGLTCHARLPPLSVNFADLFLPFPRLPKGSELRF
FT                   FDELWNSCLPKGVESRVWCPLGQQGLEALVSQYLEPFVVLAQPPTTYLIAIRLPPASML
FT                   LLRLEKAQVDGVPVALRTDDWAVLPLVGDYLRGLAAH"
FT   assembly_gap    2464174..2464193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2471854..2472902
FT                   /gene="1500026D16Rik"
FT                   /locus_tag="mCG_11757"
FT                   /note="gene_id=mCG11757.0"
FT   mRNA            join(2471854..2472050,2472163..2472344,2472420..2472539,
FT                   2472794..2472902)
FT                   /gene="1500026D16Rik"
FT                   /locus_tag="mCG_11757"
FT                   /product="RIKEN cDNA 1500026D16"
FT                   /note="gene_id=mCG11757.0 transcript_id=mCT17469.1 created
FT                   on 06-JUN-2002"
FT   CDS             join(2471879..2472050,2472163..2472344,2472420..2472539,
FT                   2472794..2472820)
FT                   /codon_start=1
FT                   /gene="1500026D16Rik"
FT                   /locus_tag="mCG_11757"
FT                   /product="RIKEN cDNA 1500026D16"
FT                   /note="gene_id=mCG11757.0 transcript_id=mCT17469.1
FT                   protein_id=mCP12084.2"
FT                   /protein_id="EDL33152.1"
FT                   /translation="MKNPEEAADGKQRIHLRPGSLRGAAPAKLHLLPCDVLVSRPAPVD
FT                   RFFTPAVRHDADGLQASFRGRGLRGEEVAVPPGFAGFVMVTEEKGEGLIGKLNFSGDAE
FT                   DKADEAQEPLERDFDRLIGATGSFSHFTLWGLETVPGPDAKVHRALGWPSLAAAIHAQV
FT                   PED"
FT   gene            complement(2472442..2480209)
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /note="gene_id=mCG19860.2"
FT   mRNA            complement(join(2472442..2473522,2473604..2473685,
FT                   2473800..2473959,2475342..2475435,2475513..2475653,
FT                   2477521..2477610,2477686..2477934,2478225..2478299,
FT                   2478608..2478682,2478772..2478927,2479206..2479342,
FT                   2479433..2479501,2479822..2479888,2479988..2480209))
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /product="HIV-1 tat interactive protein, homolog (human),
FT                   transcript variant mCT169870"
FT                   /note="gene_id=mCG19860.2 transcript_id=mCT169870.0 created
FT                   on 06-JUN-2002"
FT   mRNA            complement(join(2472442..2473522,2473604..2473685,
FT                   2473800..2473959,2475342..2475435,2475513..2475653,
FT                   2477521..2477610,2477686..2477934,2478225..2478299,
FT                   2478608..2478682,2478772..2478927,2479206..2479342,
FT                   2479433..2479501,2479822..2480017))
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /product="HIV-1 tat interactive protein, homolog (human),
FT                   transcript variant mCT17498"
FT                   /note="gene_id=mCG19860.2 transcript_id=mCT17498.2 created
FT                   on 06-JUN-2002"
FT   mRNA            complement(join(2472986..2473522,2473604..2473685,
FT                   2473800..2473959,2475342..2475435,2475513..2475653,
FT                   2477521..2477610,2477686..2477934,2478225..2478299,
FT                   2478608..2478682,2479206..2479342,2479433..>2479655))
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /product="HIV-1 tat interactive protein, homolog (human),
FT                   transcript variant mCT193061"
FT                   /note="gene_id=mCG19860.2 transcript_id=mCT193061.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2473388..2473522,2473604..2473685,
FT                   2473800..2473959,2475342..2475435,2475513..2475653,
FT                   2477521..2477610,2477686..2477934,2478225..2478299,
FT                   2478608..2478682,2478772..2478927,2479206..2479342,
FT                   2479433..2479501,2479822..2479888,2479988..2479999))
FT                   /codon_start=1
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /product="HIV-1 tat interactive protein, homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19860.2 transcript_id=mCT169870.0
FT                   protein_id=mCP92928.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UJQ1"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR025995"
FT                   /db_xref="MGI:MGI:1932051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJQ1"
FT                   /protein_id="EDL33153.1"
FT                   /translation="MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYV
FT                   HYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGK
FT                   TLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSE
FT                   TAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSH
FT                   DDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLT
FT                   KCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYV
FT                   MTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKT
FT                   GTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVIST
FT                   LQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW"
FT   CDS             complement(join(2473388..2473522,2473604..2473685,
FT                   2473800..2473959,2475342..2475435,2475513..2475653,
FT                   2477521..2477610,2477686..2477934,2478225..2478299,
FT                   2478608..2478682,2478772..2478927,2479206..2479342,
FT                   2479433..2479501,2479822..2479999))
FT                   /codon_start=1
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /product="HIV-1 tat interactive protein, homolog (human),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19860.2 transcript_id=mCT17498.2
FT                   protein_id=mCP11988.2 isoform=CRA_b"
FT                   /protein_id="EDL33154.1"
FT                   /translation="MAEVVSPVPGAGRREPGEVGRARGPPVADPGAALSPQGEIIEGCR
FT                   LPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFP
FT                   KKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEP
FT                   DQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRK
FT                   SNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFS
FT                   PYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGR
FT                   KNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYN
FT                   VACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEI
FT                   LMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGH
FT                   ERAMLKRLLRIDSKCLHFTPKDWSKRGKW"
FT   mRNA            complement(join(<2473388..2473522,2473604..2473685,
FT                   2473800..2473959,2475342..2475435,2475513..2475653,
FT                   2477521..2477610,2477686..2477934,2478225..2478299,
FT                   2478608..2478682,2479206..2479342,2479433..2479501,
FT                   2479822..>2479889))
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /product="HIV-1 tat interactive protein, homolog (human),
FT                   transcript variant mCT193060"
FT                   /note="gene_id=mCG19860.2 transcript_id=mCT193060.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2473388..2473522,2473604..2473685,
FT                   2473800..2473959,2475342..2475435,2475513..2475653,
FT                   2477521..2477610,2477686..2477934,2478225..2478299,
FT                   2478608..2478682,2479206..2479342,2479433..2479501,
FT                   2479822..>2479888))
FT                   /codon_start=1
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /product="HIV-1 tat interactive protein, homolog (human),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19860.2 transcript_id=mCT193060.0
FT                   protein_id=mCP114051.0 isoform=CRA_c"
FT                   /protein_id="EDL33155.1"
FT                   /translation="GEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYID
FT                   FNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVKRKVEVVSPATPV
FT                   PSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSD
FT                   RSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQR
FT                   HLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFL
FT                   FYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVE
FT                   GKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDV
FT                   ISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW"
FT   CDS             complement(join(2473388..2473522,2473604..2473685,
FT                   2473800..2473959,2475342..2475435,2475513..2475653,
FT                   2477521..2477610,2477686..2477934,2478225..2478299,
FT                   2478608..2478682,2479206..2479342,2479433..>2479604))
FT                   /codon_start=1
FT                   /gene="Htatip"
FT                   /locus_tag="mCG_19860"
FT                   /product="HIV-1 tat interactive protein, homolog (human),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG19860.2 transcript_id=mCT193061.0
FT                   protein_id=mCP114052.0 isoform=CRA_d"
FT                   /protein_id="EDL33156.1"
FT                   /translation="VLGHRPPAWRWDSGRRVESPDLPWLRLPVCVVLIALAEILSVKDI
FT                   SGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVK
FT                   RKVEVVSPATPVPSETAPASVFPQNGSARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIP
FT                   SAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFC
FT                   LKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLD
FT                   HKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKL
FT                   LIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINE
FT                   ISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHF
FT                   TPKDWSKRGKW"
FT   assembly_gap    2481942..2487721
FT                   /estimated_length=5780
FT                   /gap_type="unknown"
FT   gene            2507083..2517707
FT                   /gene="Rela"
FT                   /locus_tag="mCG_11759"
FT                   /note="gene_id=mCG11759.2"
FT   mRNA            join(2507083..2507433,2508024..2508050,2508143..2508294,
FT                   2508447..2508595,2509451..2509542,2509895..2510026,
FT                   2510773..2510877,2511056..2511268,2514902..2514982,
FT                   2515090..2515164,2516377..2517707)
FT                   /gene="Rela"
FT                   /locus_tag="mCG_11759"
FT                   /product="v-rel reticuloendotheliosis viral oncogene
FT                   homolog A (avian)"
FT                   /note="gene_id=mCG11759.2 transcript_id=mCT17471.2 created
FT                   on 06-JUN-2002"
FT   CDS             join(2507427..2507433,2508024..2508050,2508143..2508294,
FT                   2508447..2508595,2509451..2509542,2509895..2510026,
FT                   2510773..2510877,2511056..2511268,2514902..2514982,
FT                   2515090..2515164,2516377..2516993)
FT                   /codon_start=1
FT                   /gene="Rela"
FT                   /locus_tag="mCG_11759"
FT                   /product="v-rel reticuloendotheliosis viral oncogene
FT                   homolog A (avian)"
FT                   /note="gene_id=mCG11759.2 transcript_id=mCT17471.2
FT                   protein_id=mCP12102.2"
FT                   /db_xref="GOA:Q548Y4"
FT                   /db_xref="InterPro:IPR000451"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR011539"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030492"
FT                   /db_xref="InterPro:IPR032397"
FT                   /db_xref="MGI:MGI:103290"
FT                   /db_xref="UniProtKB/TrEMBL:Q548Y4"
FT                   /protein_id="EDL33157.1"
FT                   /translation="MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGS
FT                   IPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADL
FT                   CPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQV
FT                   TVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKE
FT                   DIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELS
FT                   EPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTS
FT                   VPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMV
FT                   PLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTD
FT                   PGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPL
FT                   GTSGLPNGLSGDEDFSSIADMDFSALLSQISS"
FT   gene            complement(2520411..2525940)
FT                   /gene="Sipa1"
FT                   /locus_tag="mCG_11761"
FT                   /note="gene_id=mCG11761.2"
FT   mRNA            complement(join(2520411..2521161,2521235..2521313,
FT                   2521505..2521559,2521642..2521742,2521856..2521964,
FT                   2522050..2522161,2522250..2522468,2523598..2523872,
FT                   2524146..2524755,2524857..2525014,2525284..2525387,
FT                   2525750..2525940))
FT                   /gene="Sipa1"
FT                   /locus_tag="mCG_11761"
FT                   /product="signal-induced proliferation associated gene 1"
FT                   /note="gene_id=mCG11761.2 transcript_id=mCT17473.2 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(2521518..2521559,2521642..2521742,
FT                   2521856..2521964,2522050..2522161,2522250..2522468,
FT                   2523598..2523872,2524146..2524755,2524857..2525014,
FT                   2525284..2525387,2525750..2525861))
FT                   /codon_start=1
FT                   /gene="Sipa1"
FT                   /locus_tag="mCG_11761"
FT                   /product="signal-induced proliferation associated gene 1"
FT                   /note="gene_id=mCG11761.2 transcript_id=mCT17473.2
FT                   protein_id=mCP12007.1"
FT                   /protein_id="EDL33158.1"
FT                   /translation="MYNNQEAGAAFMQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHS
FT                   LYTTYQDHEIMFHVSTMLPYTPNNQQQLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSH
FT                   FQHVFLVVRAHAPCTPHTSYRVAVSRTQDTPAFGPALPEGGGPFAANADFRAFLLAKAL
FT                   NGEQAAGHARQFHAMATRTRQQYLQDLATNEVTTTSLDSASRFGLPSLGGRRRATPRSP
FT                   GAELQAAGALMWGVRAAPGARVAAGAETSGPEDAEVPCLLGISAETLVLVAPRDGRVVF
FT                   NCACRDVLAWTFSEHQLDLYHGRGEAITLRLDGAPGQAVGEVVARLQLVSRGCETRELA
FT                   LPRDGQGRLGFEVDAEGFITHVERFTFAETTGLRPGARLLRVCGQTLPKLGPETAAQML
FT                   RSAPKVCVTVLPPDESGRPRRSFSELYMLSLKEPSRRGGPEPVQDETGKLVILPPTKQL
FT                   LHFCLKDSSSPPGPGDLTEERTEFLRSHNSLSSGSSLSDEAPVLPNTTPDLLLVTTANP
FT                   SAPGTDRETPPSQDQSGSPSSHEDTSDSGPELRASILPRTLSLRNSISKIMSEAGSETL
FT                   EDEWQSISEIASTCNTILESLSREDNPSQRAETPRKL"
FT   gene            complement(2534226..>2558188)
FT                   /gene="Pcnxl3"
FT                   /locus_tag="mCG_140510"
FT                   /note="gene_id=mCG140510.1"
FT   mRNA            complement(join(2534226..2534838,2534920..2535218,
FT                   2535299..2535432,2535743..2536017,2536102..2536332,
FT                   2536428..2536575,2536742..2536845,2536972..2537202,
FT                   2541116..2541369,2542040..2542255,2542351..2542409,
FT                   2542818..2542947,2543073..2543181,2544452..2544629,
FT                   2544935..2545079,2546700..2546850,2546981..2547073,
FT                   2547195..2547300,2548218..2548327,2548487..2548578,
FT                   2548935..2549045,2549145..2549316,2549543..2549575,
FT                   2549818..2549971,2551007..2551128,2552854..2552989,
FT                   2553365..2553455,2553867..2554045,2554126..2554249,
FT                   2554669..>2555233))
FT                   /gene="Pcnxl3"
FT                   /locus_tag="mCG_140510"
FT                   /product="pecanex-like 3 (Drosophila), transcript variant
FT                   mCT193054"
FT                   /note="gene_id=mCG140510.1 transcript_id=mCT193054.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(2534231..2534838,2534920..2535218,
FT                   2535299..2535432,2535743..2536017,2536102..2536332,
FT                   2536428..2536575,2536742..2536845,2536972..2537202,
FT                   2541116..2541369,2542040..2542255,2542351..2542409,
FT                   2542818..2542947,2543073..2543181,2544452..2544629,
FT                   2544935..2545079,2546700..2546850,2546981..2547073,
FT                   2547195..2547300,2548218..2548327,2548487..2548578,
FT                   2548935..2549045,2549145..2549316,2549543..2549575,
FT                   2549818..2549971,2551007..2551128,2552854..2552989,
FT                   2553365..2553455,2553867..2554045,2554126..2554249,
FT                   2556204..2556243,2557158..2557257,2557490..2557677,
FT                   2558036..>2558188))
FT                   /gene="Pcnxl3"
FT                   /locus_tag="mCG_140510"
FT                   /product="pecanex-like 3 (Drosophila), transcript variant
FT                   mCT180422"
FT                   /note="gene_id=mCG140510.1 transcript_id=mCT180422.0
FT                   created on 10-FEB-2003"
FT   mRNA            complement(join(2534231..2535218,2535299..2535432,
FT                   2535743..2536017,2536102..2536332,2536428..2536575,
FT                   2536742..2536845,2536972..2537202,2541116..2541369,
FT                   2542040..2542255,2542351..2542409,2542818..2542947,
FT                   2543073..2543181,2544452..2544629,2544935..2545079,
FT                   2546700..2546846,2546977..2547073,2547195..2547300,
FT                   2548218..2548327,2548487..2548578,2548935..2549045,
FT                   2549145..2549316,2549543..2549575,2549818..2549971,
FT                   2551007..2551167,2552884..2552989,2553365..2553455,
FT                   2553867..2554042,2554126..2554249,2554669..2555757,
FT                   2556863..2557257,2557490..2557677,2558036..>2558188))
FT                   /gene="Pcnxl3"
FT                   /locus_tag="mCG_140510"
FT                   /product="pecanex-like 3 (Drosophila), transcript variant
FT                   mCT169861"
FT                   /note="gene_id=mCG140510.1 transcript_id=mCT169861.0
FT                   created on 10-FEB-2003"
FT   CDS             complement(join(2534644..2534838,2534920..2535218,
FT                   2535299..2535432,2535743..2536017,2536102..2536332,
FT                   2536428..2536575,2536742..2536845,2536972..2537202,
FT                   2541116..2541369,2542040..2542255,2542351..2542409,
FT                   2542818..2542947,2543073..2543181,2544452..2544629,
FT                   2544935..2545079,2546700..2546850,2546981..2547073,
FT                   2547195..2547300,2548218..2548327,2548487..2548578,
FT                   2548935..2549045,2549145..2549316,2549543..2549575,
FT                   2549818..2549971,2551007..2551128,2552854..2552989,
FT                   2553365..2553455,2553867..2554045,2554126..2554249,
FT                   2556204..2556243,2557158..2557257,2557490..2557677,
FT                   2558036..2558188))
FT                   /codon_start=1
FT                   /gene="Pcnxl3"
FT                   /locus_tag="mCG_140510"
FT                   /product="pecanex-like 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG140510.1 transcript_id=mCT180422.0
FT                   protein_id=mCP103344.0 isoform=CRA_b"
FT                   /protein_id="EDL33160.1"
FT                   /translation="MGSQVLQILRQGVWASLTGGWFFDPHQSTFSNCFHLYVWIFLLIF
FT                   PFLLYMVLPPSLMVAGVYCLVVAVIFATIKTVNYRLHAMFDQGEIVEKRNSTMGEQEEE
FT                   AAQGESSLPRDPGVEMTVFRKVSSTPPVRCSSQHSVFGFNQVSELLPRMEDSGPLRAPE
FT                   ETGQRECTSNVRRAQAIRRRHNAGSNPTPPASVMGSPPSSLQEAQRGRAASHSRALTLP
FT                   SALHFASSLLLTRAGPNVHEASNFDDTSEGAVHYFYDESGVRRSYTFGLAGGGYENPVS
FT                   QPGEQAANGAWDRHSHSSSFHSADVPEATGGLNLLQPRPVVLQGMQVRRVPLEIPEEQT
FT                   LMEEAPPRAQHSYKYWFLPGRWTSVRYERLALLALLDRTRGVMENIFGVGLSSLVAFLG
FT                   YLLLLKGFFTDIWVFQFCLVIASCQYSLLKSVQPDAASPMHGHNWVIAYSRPVYFCICC
FT                   LLIWLLDALGTAQPFPPVSLYGLTLFSASFFFCARDVATVFTLCFPFVFLLGLLPQVNT
FT                   CLMYLLEQIDMHGFGGTAATSPLTAVFSLTRSLLAAALLYGFCLGAIKTPWPEQHVPVL
FT                   FSVFCGLLVAMSYHLSRQSSDPTVLWSLVRSKLFPELEERSLETARVEPPDPLPEKMRQ
FT                   SVREVLHSDLVMCVVIAVLTFAVSASTVFIALKSVLGFVLYALAGAVGFFTHYLLPQLR
FT                   KQLPWFCLSQPVLKPLEYSQYEVRGAAQVMWFEKLYAGLQCAEKYLIYPAVVLNALTVD
FT                   AHTVVSHPDKFCLYCRALLMTVAGLKLLRSAFCCPPQQYLTLAFTVLLFHFDYPRLSQG
FT                   FLLDYFLMSLLCSKLWDLLYKLRFVLTYIAPWQITWGSAFHAFAQPFAVPHSAMLFLQA
FT                   LLSGLFSTPLNPLLGSAVFIMSYARPLKFWERDYNTKRVDHSNTRLVTQLDRNPGADDN
FT                   NLNSIFYEHLTRSLQHTLCGDLVLGRWGNYGPGDCFVLASDYLNALVHLIEVGNGLITF
FT                   QLRGLEFRGTYCQQREVEAITEGVEEDEGCCCCEPGHLPRVLSFNAAFGQRWLAWEVTA
FT                   SKYVLEGYSISDNNAASMLQVFDLRKILVTYYVKSIIYYVSRSPKLETWLNHEGIAAAL
FT                   RPVRALGYADSDPTFSLSVDEDYDLRLSGLSLPSFCAVHLEWIQYCASRRSQPVDQDWN
FT                   SPLVTLCFGLCVLGRRALGTASHSMSASLEPFLYGLHALFKGDFRITSPRDEWVFADMD
FT                   LLHRVVAPGVRMALKLHQDHFTSPDEYEEPAALYDAIAANEERLVISHEGDPAWRSAIL
FT                   SNTPSLLALRHVMDDASDEYKIIMLNRRHLSFRVIKVNRECVRGLWAGQQQELVFLRNR
FT                   NPERGSIQNAKQALRNMINSSCDQPLGYPIYVSPLTTSLAGSHPQLRALWGGPVSLGAI
FT                   ARWLLRSWERLHKGCGAGCNSGGNVDDSDCGGGGGLTSLSNHPPLAHPTPENAAGSSEQ
FT                   PLPPGPSWGPRPSLSGSGDGRPPPLLQWPPPRLPGPPPASPAPTEGPRPSRPSGPALLN
FT                   SEGPSGKWSLGGRKGLGGPDGEPASGSPKGGTPKSQAPLDLSLSPDVSSEASPARTTQD
FT                   LPCLDSSIPEGCTPSGAPGDWPVPAEERESPAAQPLLEHQY"
FT   CDS             complement(join(2534644..2534838,2534920..2535218,
FT                   2535299..2535432,2535743..2536017,2536102..2536332,
FT                   2536428..2536575,2536742..2536845,2536972..2537202,
FT                   2541116..2541369,2542040..2542255,2542351..2542409,
FT                   2542818..2542947,2543073..2543181,2544452..2544629,
FT                   2544935..2545079,2546700..2546850,2546981..2547073,
FT                   2547195..2547300,2548218..2548327,2548487..2548578,
FT                   2548935..2549045,2549145..2549316,2549543..2549575,
FT                   2549818..2549971,2551007..2551128,2552854..2552989,
FT                   2553365..2553455,2553867..2554045,2554126..2554249,
FT                   2554669..>2555233))
FT                   /codon_start=1
FT                   /gene="Pcnxl3"
FT                   /locus_tag="mCG_140510"
FT                   /product="pecanex-like 3 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG140510.1 transcript_id=mCT193054.0
FT                   protein_id=mCP114035.0 isoform=CRA_c"
FT                   /protein_id="EDL33161.1"
FT                   /translation="VRPKDLALLRPSKRRPPMRGHSPPGRTPRRPLLEGSGFFEDEDTS
FT                   EGSELSPASSLRSQRRYSTDSSSSTSCYSPESSQGAAGGPRKRRAPHGAEEGTAVPPKR
FT                   PYGTQRTPSTASAKTHARVLSMDGAGGDVLRAPLAGSKAELEAQPGMELAAGEPAVLPP
FT                   EARRGPAANQPGWRGELQEEGAVGGAPEETGQRECTSNVRRAQAIRRRHNAGSNPTPPA
FT                   SVMGSPPSSLQEAQRGRAASHSRALTLPSALHFASSLLLTRAGPNVHEASNFDDTSEGA
FT                   VHYFYDESGVRRSYTFGLAGGGYENPVSQPGEQAANGAWDRHSHSSSFHSADVPEATGG
FT                   LNLLQPRPVVLQGMQVRRVPLEIPEEQTLMEEAPPRAQHSYKYWFLPGRWTSVRYERLA
FT                   LLALLDRTRGVMENIFGVGLSSLVAFLGYLLLLKGFFTDIWVFQFCLVIASCQYSLLKS
FT                   VQPDAASPMHGHNWVIAYSRPVYFCICCLLIWLLDALGTAQPFPPVSLYGLTLFSASFF
FT                   FCARDVATVFTLCFPFVFLLGLLPQVNTCLMYLLEQIDMHGFGGTAATSPLTAVFSLTR
FT                   SLLAAALLYGFCLGAIKTPWPEQHVPVLFSVFCGLLVAMSYHLSRQSSDPTVLWSLVRS
FT                   KLFPELEERSLETARVEPPDPLPEKMRQSVREVLHSDLVMCVVIAVLTFAVSASTVFIA
FT                   LKSVLGFVLYALAGAVGFFTHYLLPQLRKQLPWFCLSQPVLKPLEYSQYEVRGAAQVMW
FT                   FEKLYAGLQCAEKYLIYPAVVLNALTVDAHTVVSHPDKFCLYCRALLMTVAGLKLLRSA
FT                   FCCPPQQYLTLAFTVLLFHFDYPRLSQGFLLDYFLMSLLCSKLWDLLYKLRFVLTYIAP
FT                   WQITWGSAFHAFAQPFAVPHSAMLFLQALLSGLFSTPLNPLLGSAVFIMSYARPLKFWE
FT                   RDYNTKRVDHSNTRLVTQLDRNPGADDNNLNSIFYEHLTRSLQHTLCGDLVLGRWGNYG
FT                   PGDCFVLASDYLNALVHLIEVGNGLITFQLRGLEFRGTYCQQREVEAITEGVEEDEGCC
FT                   CCEPGHLPRVLSFNAAFGQRWLAWEVTASKYVLEGYSISDNNAASMLQVFDLRKILVTY
FT                   YVKSIIYYVSRSPKLETWLNHEGIAAALRPVRALGYADSDPTFSLSVDEDYDLRLSGLS
FT                   LPSFCAVHLEWIQYCASRRSQPVDQDWNSPLVTLCFGLCVLGRRALGTASHSMSASLEP
FT                   FLYGLHALFKGDFRITSPRDEWVFADMDLLHRVVAPGVRMALKLHQDHFTSPDEYEEPA
FT                   ALYDAIAANEERLVISHEGDPAWRSAILSNTPSLLALRHVMDDASDEYKIIMLNRRHLS
FT                   FRVIKVNRECVRGLWAGQQQELVFLRNRNPERGSIQNAKQALRNMINSSCDQPLGYPIY
FT                   VSPLTTSLAGSHPQLRALWGGPVSLGAIARWLLRSWERLHKGCGAGCNSGGNVDDSDCG
FT                   GGGGLTSLSNHPPLAHPTPENAAGSSEQPLPPGPSWGPRPSLSGSGDGRPPPLLQWPPP
FT                   RLPGPPPASPAPTEGPRPSRPSGPALLNSEGPSGKWSLGGRKGLGGPDGEPASGSPKGG
FT                   TPKSQAPLDLSLSPDVSSEASPARTTQDLPCLDSSIPEGCTPSGAPGDWPVPAEERESP
FT                   AAQPLLEHQY"
FT   CDS             complement(join(2534839..2535218,2535299..2535432,
FT                   2535743..2536017,2536102..2536332,2536428..2536575,
FT                   2536742..2536845,2536972..2537202,2541116..2541369,
FT                   2542040..2542255,2542351..2542409,2542818..2542947,
FT                   2543073..2543181,2544452..2544629,2544935..2545079,
FT                   2546700..2546846,2546977..2547073,2547195..2547300,
FT                   2548218..2548327,2548487..2548578,2548935..2549045,
FT                   2549145..2549316,2549543..2549575,2549818..2549971,
FT                   2551007..2551167,2552884..2552989,2553365..2553455,
FT                   2553867..2554042,2554126..2554249,2554669..2555757,
FT                   2556863..2557257,2557490..2557677,2558036..2558188))
FT                   /codon_start=1
FT                   /gene="Pcnxl3"
FT                   /locus_tag="mCG_140510"
FT                   /product="pecanex-like 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG140510.1 transcript_id=mCT169861.0
FT                   protein_id=mCP92922.0 isoform=CRA_a"
FT                   /protein_id="EDL33159.1"
FT                   /translation="MGSQVLQILRQGVWASLTGGWFFDPHQSTFSNCFHLYVWIFLLIF
FT                   PFLLYMVLPPSLMVAGVYCLVVAVIFATIKTVNYRLHAMFDQGEIVEKRNSTMGEQEEE
FT                   AAQGESSLPRDPGVEMTVFRKVSSTPPVRCSSQHSVFGFNQVSVSRLPSPLSWESAPGV
FT                   GLLPACSSESAPGVGLLPACSSESAPGVGLLPACSSESAPGVGLLPACSSESAPGVGLL
FT                   PACSWESAPGVGLLPACSWESAPDPSLPSTDSSERSPMAGDGVPWGGSGVADTPMSPLL
FT                   KGSLSQELSKSFLTLTRPDRALVRTSSRREQCRGTGGYQPLDRRGSGDPMPQKAGSSDS
FT                   CFSGTDRETLSSFKSEKTNSTHLDSPPGGHAPEGSDTDPPSEAELPASPDAGVPSDDTL
FT                   RSFDTVIGAGTPPGQTEPLLVVRPKDLALLRPSKRRPPMRGHSPPGRTPRRPLLEGSGF
FT                   FEDEDTSEGSELSPASSLRSQRRYSTDSSSSTSCYSPESSQGAAGGPRKRRAPHGAEEG
FT                   TAVPPKRPYGTQRTPSTASAKTHARVLSMDGAGGDVLRAPLAGSKAELEAQPGMELAAG
FT                   EPAVLPPEARRGPAANQPGWRGELQEEGAVGGAPEETGQRECTSNVRRAQAIRRRHNAG
FT                   SNPTPPASVMGSPPSLQEAQRGRAASHSRALTLPSALHFASSLLLTRAGPNVHEASNFD
FT                   DTSEGAVHYFYDESGVRRSYTFGLAGGGYENPVSQPGEQAANGAWDRHSHSSSFHSADV
FT                   PEATGGLNLLQPRPVVLQGMQFDLLDQDSLHESQEQTLMEEAPPRAQHSYKYWFLPGRW
FT                   TSVRYERLALLALLDRTRGVMENIFGVGLSSLVAFLGYLLLLKGFFTDIWVFQFCLVIA
FT                   SCQYSLLKSVQPDAASPMHGHNWVIAYSRPVYFCICCLLIWLLDALGTAQPFPPVSLYG
FT                   LTLFSASFFFCARDVATVFTLCFPFVFLLGLLPQVNTCLMYLLEQIDMHGFGGTAATSP
FT                   LTAVFSLTRSLLAAALLYGFCLGAIKTPWPEQHVPVLFSVFCGLLVAMSYHLSRQSSDP
FT                   TVLWSLVRSKLFPELEERSLETARVEPPDPLPEKMRQSVREVLHSDLVMCVVIAVLTFA
FT                   VSASTVFIALKVFLGFVLYALAGAVGFFTHYLLPQLRKQLPWFCLSQPVLKPLEYSQYE
FT                   VRGAAQVMWFEKLYAGLQCAEKYLIYPAVVLNALTVDAHTVVSHPDKFCLYCRALLMTV
FT                   AGLKLLRSAFCCPPQQYLTLAFTVLLFHFDYPRLSQGFLLDYFLMSLLCSKLWDLLYKL
FT                   RFVLTYIAPWQITWGSAFHAFAQPFAVPHSAMLFLQALLSGLFSTPLNPLLGSAVFIMS
FT                   YARPLKFWERDYNTKRVDHSNTRLVTQLDRNPGADDNNLNSIFYEHLTRSLQHTLCGDL
FT                   VLGRWGNYGPGDCFVLASDYLNALVHLIEVGNGLITFQLRGLEFRGTYCQQREVEAITE
FT                   GVEEDEGCCCCEPGHLPRVLSFNAAFGQRWLAWEVTASKYVLEGYSISDNNAASMLQVF
FT                   DLRKILVTYYVKSIIYYVSRSPKLETWLNHEGIAAALRPVRALGYADSDPTFSLSVDED
FT                   YDLRLSGLSLPSFCAVHLEWIQYCASRRSQPVDQDWNSPLVTLCFGLCVLGRRALGTAS
FT                   HSMSASLEPFLYGLHALFKGDFRITSPRDEWVFADMDLLHRVVAPGVRMALKLHQDHFT
FT                   SPDEYEEPAALYDAIAANEERLVISHEGDPAWRSAILSNTPSLLALRHVMDDASDEYKI
FT                   IMLNRRHLSFRVIKVNRECVRGLWAGQQQELVFLRNRNPERGSIQNAKQALRNMINSSC
FT                   DQPLGYPIYVSPLTTSLAGSHPQLRALWGGPVSLGAIARWLLRSWERLHKGCGAGCNSG
FT                   GNVDDSDCGGGGGLTSLSNHPPLAHPTPENAAGSSEQPLPPGPSWGPRPSLSGSGDGRP
FT                   PPLLQWPPPRLPGPPPASPAPTEGPRPSRPSGPALLNSEGPSGKWSLGGRKGLGGPDGE
FT                   PASGSPKGGTPKSQVRSLWKKTTPGVLRSVCLLICLSSLP"
FT   gene            2559806..2572915
FT                   /gene="Map3k11"
FT                   /locus_tag="mCG_11766"
FT                   /note="gene_id=mCG11766.2"
FT   mRNA            join(2559806..2561036,2565211..2565391,2565547..2565695,
FT                   2565782..2565957,2566057..2566300,2566734..2566847,
FT                   2567394..2567529,2567608..2567699,2570640..2571020,
FT                   2572057..2572915)
FT                   /gene="Map3k11"
FT                   /locus_tag="mCG_11766"
FT                   /product="mitogen activated protein kinase kinase kinase
FT                   11"
FT                   /note="gene_id=mCG11766.2 transcript_id=mCT17478.2 created
FT                   on 21-JUN-2002"
FT   CDS             join(2560295..2561036,2565211..2565391,2565547..2565695,
FT                   2565782..2565957,2566057..2566300,2566734..2566847,
FT                   2567394..2567529,2567608..2567699,2570640..2571020,
FT                   2572057..2572394)
FT                   /codon_start=1
FT                   /gene="Map3k11"
FT                   /locus_tag="mCG_11766"
FT                   /product="mitogen activated protein kinase kinase kinase
FT                   11"
FT                   /note="gene_id=mCG11766.2 transcript_id=mCT17478.2
FT                   protein_id=mCP12053.0"
FT                   /protein_id="EDL33162.1"
FT                   /translation="MEPLKNLFLKSPLGSWNGSGSGGGGGTGGVRPEGSPKATAAYANP
FT                   VWTALFDYEPNGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRG
FT                   GGPPPCEVASFQELRLEEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVR
FT                   QEARLFAMLAHPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQ
FT                   IARGMHYLHCEALVPVIHRDLKSNNILLLQPIEGDDMEHKTLKITDFGLAREWHKTTQM
FT                   SAAGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKL
FT                   TLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEG
FT                   WKREIQGLFDELRAKEKELLSREEELTRAAREQRSQAEQLRRREHLLAQWELEVFEREL
FT                   TLLLQQVDRERPHVRRRRGTFKRSKLRARDGGERISMPLDFKHRITVQASPGLDRRRNV
FT                   FEVGAGDSPTFPRFRAIQLEPTESGQTWGRQSPRRLEDSSNGERRACWAWGPSSPKPGE
FT                   AQNGRRRSRMDEATWYLDSDDSSPLGSPSTPPALNGNPPRPSPEPEEPRRAGPTERGNS
FT                   SGTPKLIQRALLRGTALLASLGLGRDLQPPGGLSRERGESPTAPPPAQMPSPCPPELPS
FT                   TPLIRLSQTTPDAHSSPTPGPLLLDLGVPSGQPSAKSPRREETRGRTVSPPPGISRSAP
FT                   GTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDS
FT                   DPFWDSPPANPFRGGSQDCRTQTKDMGAQAPWAPEAGP"
FT   gene            2574417..2577150
FT                   /gene="Kcnk7"
FT                   /locus_tag="mCG_11720"
FT                   /note="gene_id=mCG11720.1"
FT   mRNA            join(2574417..2574845,2576118..2576516,2576753..2577150)
FT                   /gene="Kcnk7"
FT                   /locus_tag="mCG_11720"
FT                   /product="potassium channel, subfamily K, member 7,
FT                   transcript variant mCT17363"
FT                   /note="gene_id=mCG11720.1 transcript_id=mCT17363.1 created
FT                   on 06-JUN-2002"
FT   mRNA            join(2574417..2574845,2576118..2576516,2576753..2576958,
FT                   2577043..2577150)
FT                   /gene="Kcnk7"
FT                   /locus_tag="mCG_11720"
FT                   /product="potassium channel, subfamily K, member 7,
FT                   transcript variant mCT169856"
FT                   /note="gene_id=mCG11720.1 transcript_id=mCT169856.0 created
FT                   on 06-JUN-2002"
FT   CDS             join(2574527..2574845,2576118..2576516,2576753..2577066)
FT                   /codon_start=1
FT                   /gene="Kcnk7"
FT                   /locus_tag="mCG_11720"
FT                   /product="potassium channel, subfamily K, member 7, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11720.1 transcript_id=mCT17363.1
FT                   protein_id=mCP12009.2 isoform=CRA_b"
FT                   /protein_id="EDL33164.1"
FT                   /translation="MGSLKPWARYLLLLMAHLLAMGLGAVVLQALEGPPARHLQAQVQA
FT                   ELASFQAEHRACLPPEALEELLGAVLRAQAHGVSSLGNGSETSNWDLPSALLFTASILT
FT                   TTGYGHMAPLSSGGKAFCVVYAALGLPASLALVAALRHCLLPVFSRPGDWVAIRWQLAP
FT                   AQAALLQAAGLGLLVACVFMLLPALVLWGVQGDCSLLEAIYFCFGSLSTIGLGDLLPAH
FT                   GRGLHPAIYHLGQFALLGYLLLGLLAMLLAVETFSELPQVRAMVKFFGPSGSRTDEDQD
FT                   GILGQDELALSTVLPDAPVLGPTTPASVSEHQNRPQPADPSQATGSQLDRVGGPEREAP
FT                   RSA"
FT   CDS             join(2574527..2574845,2576118..2576516,2576753..2576958,
FT                   2577043..2577066)
FT                   /codon_start=1
FT                   /gene="Kcnk7"
FT                   /locus_tag="mCG_11720"
FT                   /product="potassium channel, subfamily K, member 7, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11720.1 transcript_id=mCT169856.0
FT                   protein_id=mCP92950.0 isoform=CRA_a"
FT                   /protein_id="EDL33163.1"
FT                   /translation="MGSLKPWARYLLLLMAHLLAMGLGAVVLQALEGPPARHLQAQVQA
FT                   ELASFQAEHRACLPPEALEELLGAVLRAQAHGVSSLGNGSETSNWDLPSALLFTASILT
FT                   TTGYGHMAPLSSGGKAFCVVYAALGLPASLALVAALRHCLLPVFSRPGDWVAIRWQLAP
FT                   AQAALLQAAGLGLLVACVFMLLPALVLWGVQGDCSLLEAIYFCFGSLSTIGLGDLLPAH
FT                   GRGLHPAIYHLGQFALLGYLLLGLLAMLLAVETFSELPQVRAMVKFFGPSGSRTDEDQD
FT                   GILGQDELALSTVLPDAPVLGPTTPASREAPRSA"
FT   gene            complement(2578102..2596320)
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /note="gene_id=mCG11792.2"
FT   mRNA            complement(join(2578102..2578475,2578606..2578720,
FT                   2578808..2578881,2580255..2580354,2580618..2580741,
FT                   2580837..2580892,2581013..2581082,2585846..2586544,
FT                   2586946..2586994,2587089..2587246,2590737..2590777,
FT                   2590860..2590928,2591493..2591635,2591718..2591896,
FT                   2592007..2592060,2592696..2592791,2593000..2593057,
FT                   2595967..2596320))
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /product="RIKEN cDNA G430002G23, transcript variant
FT                   mCT170142"
FT                   /note="gene_id=mCG11792.2 transcript_id=mCT170142.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(2578102..2578475,2578606..2578720,
FT                   2578808..2578881,2580255..2580354,2580618..2580741,
FT                   2580837..2580892,2581013..2581082,2585846..2586544,
FT                   2586946..2586994,2587089..2587246,2590236..2590458,
FT                   2590615..2590777,2590860..2590928,2591493..2591635,
FT                   2591718..2591896,2592007..2592060,2592696..2592791,
FT                   2593000..2593057,2595967..2596320))
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /product="RIKEN cDNA G430002G23, transcript variant
FT                   mCT170141"
FT                   /note="gene_id=mCG11792.2 transcript_id=mCT170141.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(2578102..2578475,2578606..2578720,
FT                   2578808..2578881,2580255..2580354,2580618..2580741,
FT                   2580837..2580892,2581013..2581082,2585846..2586544,
FT                   2586946..2586994,2587089..2587246,2587713..2590458,
FT                   2590615..2590777,2590860..2590928,2591493..2591635,
FT                   2591718..2591896,2592007..2592060,2592696..2592791,
FT                   2593000..2593057,2595967..2596320))
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /product="RIKEN cDNA G430002G23, transcript variant
FT                   mCT17495"
FT                   /note="gene_id=mCG11792.2 transcript_id=mCT17495.2 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(2578102..2578475,2578606..2578720,
FT                   2578808..2578881,2580255..2580354,2580618..2580741,
FT                   2580837..2580892,2581013..2581082,2585846..2586544,
FT                   2586946..2586994,2587089..2587246,2590737..2590777,
FT                   2590860..2590928,2591023..2591058,2591493..2591635,
FT                   2591718..2591896,2592007..2592060,2592696..2592791,
FT                   2593000..2593057,2595967..2596320))
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /product="RIKEN cDNA G430002G23, transcript variant
FT                   mCT170140"
FT                   /note="gene_id=mCG11792.2 transcript_id=mCT170140.0 created
FT                   on 21-JUN-2002"
FT   CDS             complement(join(2578376..2578475,2578606..2578720,
FT                   2578808..2578881,2580255..2580354,2580618..2580741,
FT                   2580837..2580892,2581013..2581082,2585846..2586544,
FT                   2586946..2586994,2587089..2587246,2590737..2590777,
FT                   2590860..2590928,2591493..2591635,2591718..2591896,
FT                   2592007..2592060,2592696..2592791,2593000..2593057,
FT                   2595967..2596070))
FT                   /codon_start=1
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /product="RIKEN cDNA G430002G23, isoform CRA_c"
FT                   /note="gene_id=mCG11792.2 transcript_id=mCT170142.0
FT                   protein_id=mCP93132.0 isoform=CRA_c"
FT                   /protein_id="EDL33167.1"
FT                   /translation="MTSVWKRLQRVGKRAAKFQFVACYHELVLECTKKWQPDKLVVVWT
FT                   RRNRRICSKAHSWQPGIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYETKEWTFIIEN
FT                   ESKGQRKVLATVDVNLAHHAGPVPAQVPLRLRLKPKSVKVVHAELSLTLSGVLLREGRA
FT                   TDDDMQSLASLMSVKPSDVGNLDDFAESDEEEANGPGAPEVRTRGPQSDLSRELKTLCE
FT                   EEDEGHIRPQQAAARPSSAEDTSPAPAPPTLVSSSQSLLEWCQEVTNGYRGVCITNFTT
FT                   SWRNGLAFCAILHRFYPDKIDYFSLDPLNIKQNNKQAFDGFAALGVSRLLEPADMVLLS
FT                   VPDKLIVMTYLCQIRAFCTGQELQLVQLEGGGGSGTYRVGNAQPSLPDCLDAGDLAQRL
FT                   REHGAEVPTEPKEAVNRGTGAIPKVASRDTDLSCSSKDGEAEVAQEAIPQEAPTDGPRA
FT                   RSSTTPVVPAEGLVNGVGASGGVSGVRLRRSSVNGEAGPVPPPRAHGSFSHVRDADLLK
FT                   KRRSRLRNSNSFSVDDQDSGAAVGAGPAGPGAVEGPNPASSPDANPLPAPAPQQPPGGP
FT                   PPTEESSPSLGEETGLQRFQDTSQYVCAELQALEQEQGQIDGRAAEVEKQLRSLMESGA
FT                   NRLQEEVLIQEWFTLVNKKNALIRRQDQLQLLIEEQDLERRFELLSRELRAMLAIEEWQ
FT                   KTVAQQHREQLLLEELVSLVNQRDELVRDLDQKERIALEEDERLERGLEQRRRKVSRQL
FT                   SRRERCTLS"
FT   CDS             complement(join(2578376..2578475,2578606..2578720,
FT                   2578808..2578881,2580255..2580354,2580618..2580741,
FT                   2580837..2580892,2581013..2581082,2585846..2586544,
FT                   2586946..2586994,2587089..2587246,2590236..2590458,
FT                   2590615..2590777,2590860..2590928,2591493..2591635,
FT                   2591718..2591896,2592007..2592060,2592696..2592791,
FT                   2593000..2593057,2595967..2596070))
FT                   /codon_start=1
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /product="RIKEN cDNA G430002G23, isoform CRA_b"
FT                   /note="gene_id=mCG11792.2 transcript_id=mCT170141.0
FT                   protein_id=mCP93135.0 isoform=CRA_b"
FT                   /protein_id="EDL33166.1"
FT                   /translation="MTSVWKRLQRVGKRAAKFQFVACYHELVLECTKKWQPDKLVVVWT
FT                   RRNRRICSKAHSWQPGIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYETKEWTFIIEN
FT                   ESKGQRKVLATVDVNLAHHAGPVPAQVPLRLRLKPKSVKVVHAELSLTLSGVLLREGRA
FT                   TDDDMQSLASLMSVKPSDVGNLDDFAESDEEEANGPGAPEVRTRGPQSDLSRELKTLCE
FT                   EEDEGHIRPQQAAARPSSAEDTSPAPVSAPAPPVRAFRGQGSEPAAITGGQVGPETPEP
FT                   PPSPPETRSTGQPGQTMVPTPAPRLRKGSDAPSSPVPCSGDEVPNTSEDPPTGMGSSGE
FT                   TQAQISSQEGTEAHEARPEPDIEAPPTLVSSSQSLLEWCQEVTNGYRGVCITNFTTSWR
FT                   NGLAFCAILHRFYPDKIDYFSLDPLNIKQNNKQAFDGFAALGVSRLLEPADMVLLSVPD
FT                   KLIVMTYLCQIRAFCTGQELQLVQLEGGGGSGTYRVGNAQPSLPDCLDAGDLAQRLREH
FT                   GAEVPTEPKEAVNRGTGAIPKVASRDTDLSCSSKDGEAEVAQEAIPQEAPTDGPRARSS
FT                   TTPVVPAEGLVNGVGASGGVSGVRLRRSSVNGEAGPVPPPRAHGSFSHVRDADLLKKRR
FT                   SRLRNSNSFSVDDQDSGAAVGAGPAGPGAVEGPNPASSPDANPLPAPAPQQPPGGPPPT
FT                   EESSPSLGEETGLQRFQDTSQYVCAELQALEQEQGQIDGRAAEVEKQLRSLMESGANRL
FT                   QEEVLIQEWFTLVNKKNALIRRQDQLQLLIEEQDLERRFELLSRELRAMLAIEEWQKTV
FT                   AQQHREQLLLEELVSLVNQRDELVRDLDQKERIALEEDERLERGLEQRRRKVSRQLSRR
FT                   ERCTLS"
FT   CDS             complement(join(2578376..2578475,2578606..2578720,
FT                   2578808..2578881,2580255..2580354,2580618..2580741,
FT                   2580837..2580892,2581013..2581082,2585846..2586544,
FT                   2586946..2586994,2587089..2587246,2587713..2590458,
FT                   2590615..2590777,2590860..2590928,2591493..2591635,
FT                   2591718..2591896,2592007..2592060,2592696..2592791,
FT                   2593000..2593057,2595967..2596070))
FT                   /codon_start=1
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /product="RIKEN cDNA G430002G23, isoform CRA_d"
FT                   /note="gene_id=mCG11792.2 transcript_id=mCT17495.2
FT                   protein_id=mCP12026.2 isoform=CRA_d"
FT                   /protein_id="EDL33168.1"
FT                   /translation="MTSVWKRLQRVGKRAAKFQFVACYHELVLECTKKWQPDKLVVVWT
FT                   RRNRRICSKAHSWQPGIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYETKEWTFIIEN
FT                   ESKGQRKVLATVDVNLAHHAGPVPAQVPLRLRLKPKSVKVVHAELSLTLSGVLLREGRA
FT                   TDDDMQSLASLMSVKPSDVGNLDDFAESDEEEANGPGAPEVRTRGPQSDLSRELKTLCE
FT                   EEDEGHIRPQQAAARPSSAEDTSPAPVSAPAPPVRAFRGQGSEPAAITGGQVGPETPEP
FT                   PPSPPETRSTGQPGQTMVPTPAPRLRKGSDAPSSPVPCSGDEVPNTSEDPPTGMGSSGE
FT                   TQAQISSQEGTEAHEARPEPDIEVRGSKDSLGGERSKVEEEDTGDRPGASGAGNREKNT
FT                   KKSDTTAGEAGESSELHQVDAEHKSKVQHRATEGPEAAGPTPKARLGDTPEAPPRSAQR
FT                   RMGVRTQEEAPSDLNPPPAEPEEHLGDLRDARPAGQEKGSAEVRGKVPAIGRAGPEQGS
FT                   SARAASAGPQVSCVQTVPSDGQGVKSRDQRAQEAEVGESRVLETEAEWVPWEVIGTSKT
FT                   DAGIPESLDTEAGTAESEILEAQESEAARSEGLEPEAAGTAESEVLRTQNNEIVVLGMP
FT                   RTGPEIREPEEFGETEVGGFTVPDTKTVIAETEILETQGVVDGEAAVLKTQAEILETQK
FT                   TEAGEAEAGTLESQKVAAEGLGAPEVGAEMAEAEKLGVQETEVEIWRIPRIETETAGTE
FT                   TLGIHKIGPPQMQPRLVGDQETDVSVMETAEDAILGTREISAGCGVLLIEAKIPESKID
FT                   RSLETEEGDLGVLEVDTGIAEAKILGIPERAPGVQKALGAGTEVARVLEAEASSSEVPE
FT                   TDAEEAETLQAKERSESSVALRVVANLPESELLGTQKKVGGTGISQREVREAETEIPKT
FT                   QEISSEGSGVPDLEAKMEESGRKMEILETPEVEKVNSELFGTQKGSEIPELETKTIKSE
FT                   ILDTQETEVGGLGLRRGEAEKAEAEMLETQKTEAKTARDEEIELVDPGVSSPEAEALRV
FT                   QWAGTVVLESGEVKADILGVQKPGSWGALKYEALDVPVTKQRLSGAKEVVPEVPRAQEP
FT                   ETKVLGIVEAKSWTLGQQEAEMEGFESPENKSNIFEAQEADSGVLGTMKGKEAVESLEE
FT                   AGLSKAQVASEAGAGVPRPSGASSLEEPEEDRRLPGSQAPPTLVSSSQSLLEWCQEVTN
FT                   GYRGVCITNFTTSWRNGLAFCAILHRFYPDKIDYFSLDPLNIKQNNKQAFDGFAALGVS
FT                   RLLEPADMVLLSVPDKLIVMTYLCQIRAFCTGQELQLVQLEGGGGSGTYRVGNAQPSLP
FT                   DCLDAGDLAQRLREHGAEVPTEPKEAVNRGTGAIPKVASRDTDLSCSSKDGEAEVAQEA
FT                   IPQEAPTDGPRARSSTTPVVPAEGLVNGVGASGGVSGVRLRRSSVNGEAGPVPPPRAHG
FT                   SFSHVRDADLLKKRRSRLRNSNSFSVDDQDSGAAVGAGPAGPGAVEGPNPASSPDANPL
FT                   PAPAPQQPPGGPPPTEESSPSLGEETGLQRFQDTSQYVCAELQALEQEQGQIDGRAAEV
FT                   EKQLRSLMESGANRLQEEVLIQEWFTLVNKKNALIRRQDQLQLLIEEQDLERRFELLSR
FT                   ELRAMLAIEEWQKTVAQQHREQLLLEELVSLVNQRDELVRDLDQKERIALEEDERLERG
FT                   LEQRRRKVSRQLSRRERCTLS"
FT   CDS             complement(join(2578376..2578475,2578606..2578720,
FT                   2578808..2578881,2580255..2580354,2580618..2580741,
FT                   2580837..2580892,2581013..2581082,2585846..2586544,
FT                   2586946..2586994,2587089..2587246,2590737..2590777,
FT                   2590860..2590928,2591023..2591058,2591493..2591635,
FT                   2591718..2591896,2592007..2592060,2592696..2592791,
FT                   2593000..2593057,2595967..2596070))
FT                   /codon_start=1
FT                   /gene="G430002G23Rik"
FT                   /locus_tag="mCG_11792"
FT                   /product="RIKEN cDNA G430002G23, isoform CRA_a"
FT                   /note="gene_id=mCG11792.2 transcript_id=mCT170140.0
FT                   protein_id=mCP93131.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR019448"
FT                   /db_xref="InterPro:IPR022735"
FT                   /db_xref="InterPro:IPR029928"
FT                   /db_xref="MGI:MGI:3612340"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8Y6"
FT                   /protein_id="EDL33165.1"
FT                   /translation="MTSVWKRLQRVGKRAAKFQFVACYHELVLECTKKWQPDKLVVVWT
FT                   RRNRRICSKAHSWQPGIQNPYRGTVVWMVPENVDISVTLYRDPHVDQYETKEWTFIIEN
FT                   ESKGQRKVLATVDVNLAHHAGPVPAQVPLRLRLKPKSVKVVHAELSLTLSGVLLREGRA
FT                   TDDDMQSLASLMSVKPSDVGNLDDFAESDEEEANGPGAPEVRTRGPQSGRGCAPRLGRF
FT                   PDLSRELKTLCEEEDEGHIRPQQAAARPSSAEDTSPAPAPPTLVSSSQSLLEWCQEVTN
FT                   GYRGVCITNFTTSWRNGLAFCAILHRFYPDKIDYFSLDPLNIKQNNKQAFDGFAALGVS
FT                   RLLEPADMVLLSVPDKLIVMTYLCQIRAFCTGQELQLVQLEGGGGSGTYRVGNAQPSLP
FT                   DCLDAGDLAQRLREHGAEVPTEPKEAVNRGTGAIPKVASRDTDLSCSSKDGEAEVAQEA
FT                   IPQEAPTDGPRARSSTTPVVPAEGLVNGVGASGGVSGVRLRRSSVNGEAGPVPPPRAHG
FT                   SFSHVRDADLLKKRRSRLRNSNSFSVDDQDSGAAVGAGPAGPGAVEGPNPASSPDANPL
FT                   PAPAPQQPPGGPPPTEESSPSLGEETGLQRFQDTSQYVCAELQALEQEQGQIDGRAAEV
FT                   EKQLRSLMESGANRLQEEVLIQEWFTLVNKKNALIRRQDQLQLLIEEQDLERRFELLSR
FT                   ELRAMLAIEEWQKTVAQQHREQLLLEELVSLVNQRDELVRDLDQKERIALEEDERLERG
FT                   LEQRRRKVSRQLSRRERCTLS"
FT   gene            complement(2598137..>2601771)
FT                   /locus_tag="mCG_19861"
FT                   /note="gene_id=mCG19861.1"
FT   mRNA            complement(join(2598137..2598879,2599287..2599736))
FT                   /locus_tag="mCG_19861"
FT                   /product="mCG19861, transcript variant mCT17500"
FT                   /note="gene_id=mCG19861.1 transcript_id=mCT17500.2 created
FT                   on 06-JUN-2002"
FT   mRNA            complement(join(2598138..2598918,2599287..2600761,
FT                   2601290..2601374,2601493..2601644,2601725..>2601771))
FT                   /locus_tag="mCG_19861"
FT                   /product="mCG19861, transcript variant mCT17499"
FT                   /note="gene_id=mCG19861.1 transcript_id=mCT17499.2 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(2598640..2598879,2599287..2599577))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19861"
FT                   /product="mCG19861, isoform CRA_a"
FT                   /note="gene_id=mCG19861.1 transcript_id=mCT17500.2
FT                   protein_id=mCP12041.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR026654"
FT                   /db_xref="MGI:MGI:106595"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TMI7"
FT                   /protein_id="EDL33169.1"
FT                   /translation="MNGLPATEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVY
FT                   SQRSRIHDELSRAARAPDGPRHAAGSANSGSAAGPRRPVNLDSALAALRKEMLWGLYES
FT                   IQDYKHLCQDLSLCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPPDPPPLTVPQTHNA
FT                   RDQWLQDAFQISL"
FT   CDS             complement(join(2600418..2600761,2601290..2601374,
FT                   2601493..2601644,2601725..>2601770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19861"
FT                   /product="mCG19861, isoform CRA_b"
FT                   /note="gene_id=mCG19861.1 transcript_id=mCT17499.2
FT                   protein_id=mCP12036.2 isoform=CRA_b"
FT                   /protein_id="EDL33170.1"
FT                   /translation="GEPSSDHGNMALNGADVDDFTWEPPTEAETKVLQARRERQDRISR
FT                   LMGDYLLRGYRMLGDTCADCGTILLQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQ
FT                   AREHQLASSTEPASSSRPPSQPPVPRPEHCEGAAAGLKAAQAPPLPAAPPNTDAVASTQ
FT                   TALLQKLTWASVELGSSTSLETSIQLCGLIRACAEALGSLKQLDH"
FT   gene            <2611956..2628571
FT                   /gene="Ltbp3"
FT                   /locus_tag="mCG_11739"
FT                   /note="gene_id=mCG11739.2"
FT   mRNA            join(<2611956..2612606,2615484..2615813,2615962..2616164,
FT                   2616343..2616448,2616687..2616779,2616945..2617067,
FT                   2617457..2617615,2617715..2617900,2618711..2618783,
FT                   2618916..2619014,2620997..2621122,2621220..2621351,
FT                   2621447..2621575,2621802..2621924,2622066..2622188,
FT                   2623679..2623801,2623975..2624094,2625590..2625718,
FT                   2625976..2626143,2626291..2626374,2626628..2626756,
FT                   2626838..2626975,2627357..2627518,2627593..2627673,
FT                   2627757..2627888,2627987..2628571)
FT                   /gene="Ltbp3"
FT                   /locus_tag="mCG_11739"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 3"
FT                   /note="gene_id=mCG11739.2 transcript_id=mCT17372.2 created
FT                   on 07-JUN-2002"
FT   CDS             join(<2617742..2617900,2618711..2618783,2618916..2619014,
FT                   2620997..2621122,2621220..2621351,2621447..2621575,
FT                   2621802..2621924,2622066..2622188,2623679..2623801,
FT                   2623975..2624094,2625590..2625718,2625976..2626143,
FT                   2626291..2626374,2626628..2626756,2626838..2626975,
FT                   2627357..2627518,2627593..2627673,2627757..2627888,
FT                   2627987..2628138)
FT                   /codon_start=1
FT                   /gene="Ltbp3"
FT                   /locus_tag="mCG_11739"
FT                   /product="latent transforming growth factor beta binding
FT                   protein 3"
FT                   /note="gene_id=mCG11739.2 transcript_id=mCT17372.2
FT                   protein_id=mCP12080.1"
FT                   /protein_id="EDL33171.1"
FT                   /translation="GKGTISSPPTRRSPSRGKATSPSSCTPTGHPNPSSFLKAPAEHHP
FT                   SRTQRKREPVSEERSVQQSHPTTTTSPPRPYPELISRPSPPTFHRFLPDLPPSRSAVEI
FT                   APTQVTETDECRLNQNICGHGQCVPGPSDYSCHCNAGYRSHPQHRYCVDVNECEAEPCG
FT                   PGKGICMNTGGSYNCHCNRGYRLHVGAGGRSCVDLNECTKPHLCGDGGFCINFPGHYKC
FT                   NCYPGYRLKASRPPICEDIDECRDPSTCPDGKCENKPGSFKCIACQPGYRSQGGGACRD
FT                   VNECSEGTPCSPGWCENLPGSYRCTCAQGYEPAQDGLSCIDVDECEAGKVCQDGICTNT
FT                   PGSFQCQCLSGYHLSRDRSRCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRLVGGR
FT                   KCQDIDECSQDPGLCLPHGACENLQGSYVCVCDEGFTLTQDQHGCEEVEQPHHKKECYL
FT                   NFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQD
FT                   NNIVNYGIPAHRDIDECILFGAEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDE
FT                   CLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMEHAPERREVCWGQRGED
FT                   GMCMGPLAGPALTFDDCCCRQGRGWGTQCRPCPPRGTGSQCPTSQSESNSFWDTSPLLL
FT                   GKSPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRELNQ
FT                   RGLLCKSERCVNTSGSFRCVCKAGFTRSRPHGACVPQRRR"
FT   gene            complement(2627986..2641447)
FT                   /gene="Scyl1"
FT                   /locus_tag="mCG_11744"
FT