spacer

EBI Dbfetch

ID   CH466607; SV 1; linear; genomic DNA; CON; MUS; 6965496 BP.
XX
AC   CH466607;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009738771 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6965496
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-6965496
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 52794f13dfd1f6167cf632a2730b5775.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000211.
DR   Ensembl-Gn; ENSMUSG00000014599; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027880; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027883; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027884; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027889; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027896; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027900; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040389; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040724; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043529; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045662; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046213; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046793; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047959; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048796; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068739; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068740; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068749; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068762; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000087260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014743; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029478; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029482; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029502; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029504; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029507; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038695; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065664; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090558; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090569; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098680; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098750; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118593; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145735; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179399; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6965496
FT                   /organism="Mus musculus"
FT                   /chromosome="3"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            342..>7441
FT                   /locus_tag="mCG_131794"
FT                   /note="gene_id=mCG131794.1"
FT   mRNA            join(342..466,5759..5882,6101..6286,7099..7218,7300..>7441)
FT                   /locus_tag="mCG_131794"
FT                   /product="mCG131794"
FT                   /note="gene_id=mCG131794.1 transcript_id=mCT133134.1
FT                   created on 23-APR-2002"
FT   CDS             join(345..466,5759..5882,6101..6286,7099..7218,7300..>7441)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131794"
FT                   /product="mCG131794"
FT                   /note="gene_id=mCG131794.1 transcript_id=mCT133134.1
FT                   protein_id=mCP60184.1"
FT                   /protein_id="EDL01867.1"
FT                   /translation="MRKAFEEESTVKHIPRLLLTSTGAGIIDVIKSGYKIPELSQSLDY
FT                   IQVMTYDLHDPKDDNTGENSSLYKSPFDTGKSADLNVDSIISYWKDHGAASEKLIVGFP
FT                   AYGHTFILSDPSKTGIGAPTVSAGPPGTYTHVPGLLAYYEICTFLNEGATEVWDAPQEV
FT                   PYAYQGNEWVGYDNVRSFKLKAQWVKDNNLGGAVVWPLDMDDFSGSFCHQGRFPLTSTL
FT                   KRDLNVHSA"
FT   assembly_gap    20335..20354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    40009..40218
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    60322..60341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    74515..74534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    92134..92153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<98788..>115036)
FT                   /gene="BC051070"
FT                   /locus_tag="mCG_22165"
FT                   /note="gene_id=mCG22165.2"
FT   mRNA            complement(join(<98788..98943,99031..99150,99970..100155,
FT                   100412..100535,101172..101296,104363..104528,
FT                   105212..105268,114265..114466,114988..>115036))
FT                   /gene="BC051070"
FT                   /locus_tag="mCG_22165"
FT                   /product="cDNA sequence BC051070"
FT                   /note="gene_id=mCG22165.2 transcript_id=mCT20428.2 created
FT                   on 23-APR-2002"
FT   CDS             complement(join(98788..98943,99031..99150,99970..100155,
FT                   100412..100535,101172..101296,104363..104528,
FT                   105212..105268,114265..114466,114988..115036))
FT                   /codon_start=1
FT                   /gene="BC051070"
FT                   /locus_tag="mCG_22165"
FT                   /product="cDNA sequence BC051070"
FT                   /note="gene_id=mCG22165.2 transcript_id=mCT20428.2
FT                   protein_id=mCP19766.2"
FT                   /protein_id="EDL01868.1"
FT                   /translation="MYVLFPGLNLLLNAQMGSAYQLMCYFNNWPQHQPDVRDIKHEDID
FT                   PCLCTHLIYSFAGIWENNFTMTKRKELDDYKGFNDLKKRNNKLKTLLSIGCWNFGDGSF
FT                   ITMVSTPENRHSFITSIIKFLRKYGFDGLNLAWQYPGCYGSPPRDKHLFTILMHEIRKA
FT                   FEKEVSKNKKPRLMVTAAVAGVISTIQFGYEIPQLSQSLDYIQVMTYDLHGSWDGYTGE
FT                   NSPLYKSPIETGVKAFHNIKYIMDNWKKKGASPEKLIVGFPAYGHTFILSDSTKTEIGA
FT                   PSNRGGHPGPHTKQTGFWAYYEICTFLKNGAIQVWNAAQQVPYAFHGNEWVGYDNIKSF
FT                   HIKAQWLKRNNYGGAMIWTIDMDDYTGSFCGQGTFPLTSILKKTLKVHSASKLL"
FT   assembly_gap    127449..127468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    143952..144186
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    179680..179814
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   gene            complement(192123..193684)
FT                   /locus_tag="mCG_131812"
FT                   /note="gene_id=mCG131812.1"
FT   mRNA            complement(join(192123..192288,193283..193684))
FT                   /locus_tag="mCG_131812"
FT                   /product="mCG131812"
FT                   /note="gene_id=mCG131812.1 transcript_id=mCT133146.1
FT                   created on 23-APR-2002"
FT   gene            192709..211170
FT                   /gene="Dennd2d"
FT                   /locus_tag="mCG_22169"
FT                   /note="gene_id=mCG22169.2"
FT   mRNA            join(192709..192850,197018..197193,197996..198108,
FT                   198717..198786,200478..200555,201369..201509,
FT                   202572..202720,204974..205151,208936..208977,
FT                   209339..209423,209873..210112,210654..211170)
FT                   /gene="Dennd2d"
FT                   /locus_tag="mCG_22169"
FT                   /product="DENN/MADD domain containing 2D, transcript
FT                   variant mCT20432"
FT                   /note="gene_id=mCG22169.2 transcript_id=mCT20432.2 created
FT                   on 23-APR-2002"
FT   CDS             join(192793..192850,197018..197193,197996..198108,
FT                   198717..198786,200478..200555,201369..201509,
FT                   202572..202720,204974..205151,208936..208977,
FT                   209339..209423,209873..210112,210654..210724)
FT                   /codon_start=1
FT                   /gene="Dennd2d"
FT                   /locus_tag="mCG_22169"
FT                   /product="DENN/MADD domain containing 2D, isoform CRA_b"
FT                   /note="gene_id=mCG22169.2 transcript_id=mCT20432.2
FT                   protein_id=mCP19790.2 isoform=CRA_b"
FT                   /protein_id="EDL01871.1"
FT                   /translation="MDGLGRRLRASLRLKRGQRGQSQNNPGEAVTEPERIQEHSPSSFA
FT                   GGQHFFEYLLVVSLKKKRLGDDYEPTITYQFPKRENLLRGQQEEEDRLLSAIPLFCFPD
FT                   GNEWAPLTEYPRETFSFVLTNVDGSRKIGYCRRLLPAGPGPQLPKVYCIISCIGCFGLF
FT                   SKILDEVEKRHQISMAVIYPFMQGLREAAFPAPGKTVTLKSFIPDSGTEFISLTRPLDS
FT                   HLEHVDFSVLLHCLHLEQIIQIFASAVLERKIIFLAEGLSTLSQCIHAAAALLYPFSWA
FT                   HTYIPVVPESLLATVCCPTPFMVGVQMRFLQEVMDSPMEEVLLVNLCEGTFLLSVGDEK
FT                   DILPPKLQDDILDSLGQGINELKTSEQINEHVSGPFVQFFVKTVGHYASYIKREASGQG
FT                   HFQERSFCKAVTSKTKRRFVKKFVKTQLFSLFIQEAEKSRNPPAGYFQKKILEYEEQKK
FT                   QKKSRERL"
FT   CDS             complement(193536..193616)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131812"
FT                   /product="mCG131812"
FT                   /note="gene_id=mCG131812.1 transcript_id=mCT133146.1
FT                   protein_id=mCP60239.1"
FT                   /protein_id="EDL01869.1"
FT                   /translation="MTLTNWFFFFFFFFPKAWALSEQTRG"
FT   mRNA            join(<196195..196465,197018..197193,197996..198108,
FT                   198717..198786,200478..200555,201369..201509,
FT                   202572..202720,204974..205151,208936..208977,
FT                   209339..209423,209873..210112,210654..211160)
FT                   /gene="Dennd2d"
FT                   /locus_tag="mCG_22169"
FT                   /product="DENN/MADD domain containing 2D, transcript
FT                   variant mCT189454"
FT                   /note="gene_id=mCG22169.2 transcript_id=mCT189454.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<196303..196465,197018..197193,197996..198108,
FT                   198717..198786,200478..200555,201369..201509,
FT                   202572..202720,204974..205151,208936..208977,
FT                   209339..209423,209873..210112,210654..210724)
FT                   /codon_start=1
FT                   /gene="Dennd2d"
FT                   /locus_tag="mCG_22169"
FT                   /product="DENN/MADD domain containing 2D, isoform CRA_a"
FT                   /note="gene_id=mCG22169.2 transcript_id=mCT189454.0
FT                   protein_id=mCP110445.0 isoform=CRA_a"
FT                   /protein_id="EDL01870.1"
FT                   /translation="SCDWRPRQKALSQAFCGQPEGERTSMPPKLRMMEGQGVGRTLRLL
FT                   RNRLPRLRAGQSQNNPGEAVTEPERIQEHSPSSFAGGQHFFEYLLVVSLKKKRLGDDYE
FT                   PTITYQFPKRENLLRGQQEEEDRLLSAIPLFCFPDGNEWAPLTEYPRETFSFVLTNVDG
FT                   SRKIGYCRRLLPAGPGPQLPKVYCIISCIGCFGLFSKILDEVEKRHQISMAVIYPFMQG
FT                   LREAAFPAPGKTVTLKSFIPDSGTEFISLTRPLDSHLEHVDFSVLLHCLHLEQIIQIFA
FT                   SAVLERKIIFLAEGLSTLSQCIHAAAALLYPFSWAHTYIPVVPESLLATVCCPTPFMVG
FT                   VQMRFLQEVMDSPMEEVLLVNLCEGTFLLSVGDEKDILPPKLQDDILDSLGQGINELKT
FT                   SEQINEHVSGPFVQFFVKTVGHYASYIKREASGQGHFQERSFCKAVTSKTKRRFVKKFV
FT                   KTQLFSLFIQEAEKSRNPPAGYFQKKILEYEEQKKQKKSRERL"
FT   gene            complement(213111..257846)
FT                   /gene="Cept1"
FT                   /locus_tag="mCG_22167"
FT                   /note="gene_id=mCG22167.1"
FT   mRNA            complement(join(213111..213871,214653..214778,
FT                   215277..215435,215846..215977,222935..223019,
FT                   241244..241385,243462..243609,249298..249711,
FT                   257781..257846))
FT                   /gene="Cept1"
FT                   /locus_tag="mCG_22167"
FT                   /product="choline/ethanolaminephosphotransferase 1,
FT                   transcript variant mCT20430"
FT                   /note="gene_id=mCG22167.1 transcript_id=mCT20430.2 created
FT                   on 23-APR-2002"
FT   mRNA            complement(join(213116..213871,214653..214778,
FT                   215277..215435,215846..215977,230141..230225,
FT                   241244..241385,243462..243609,249298..249711,
FT                   257781..257831))
FT                   /gene="Cept1"
FT                   /locus_tag="mCG_22167"
FT                   /product="choline/ethanolaminephosphotransferase 1,
FT                   transcript variant mCT168423"
FT                   /note="gene_id=mCG22167.1 transcript_id=mCT168423.0 created
FT                   on 23-APR-2002"
FT   CDS             complement(join(213752..213871,214653..214778,
FT                   215277..215435,215846..215977,222935..223019,
FT                   241244..241385,243462..243609,249298..249636))
FT                   /codon_start=1
FT                   /gene="Cept1"
FT                   /locus_tag="mCG_22167"
FT                   /product="choline/ethanolaminephosphotransferase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22167.1 transcript_id=mCT20430.2
FT                   protein_id=mCP19778.1 isoform=CRA_b"
FT                   /protein_id="EDL01873.1"
FT                   /translation="MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSR
FT                   HQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVGRVPSWIAPNLITIIGLSINICTTILLV
FT                   FYCPTATEQAPLWAYIACACGLFIYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTV
FT                   FVVLGTCIAVQLGTNPDWMFFCCFAGTFMFYCAHWQTYVSGTLRFGIIDVTEVQIFIII
FT                   MHLLAVIGGPPFWQSMIPVLNIQMKLLPALCTVAGTIFSCTNYFRVIFTGGVGKNGSTI
FT                   AGTSVLSPFLHIGSVITLAVMIYKKSAVQLFEKHPCLYILTFGFVSAKITNKLVVAHMT
FT                   KSEMHLHDTAFIGPALLFLDQYFNSFIDEYIVLWIALIFSFFDLIRYCVSVCNQIASHL
FT                   HIHVFRIKASTAHSNHH"
FT   CDS             complement(join(213752..213871,214653..214778,
FT                   215277..215435,215846..215977,230141..230225,
FT                   241244..241385,243462..243609,249298..249636))
FT                   /codon_start=1
FT                   /gene="Cept1"
FT                   /locus_tag="mCG_22167"
FT                   /product="choline/ethanolaminephosphotransferase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22167.1 transcript_id=mCT168423.0
FT                   protein_id=mCP91443.0 isoform=CRA_a"
FT                   /protein_id="EDL01872.1"
FT                   /translation="MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSR
FT                   HQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVGRVPSWIAPNLITIIGLSINICTTILLV
FT                   FYCPTATEQAPLWAYIACACGLFIYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTV
FT                   FVVLGTCIAVQLGTNPDWMFFCCFAGTFMFYCAHWQTYVSGTLRFGIFDVTESQILIIL
FT                   FQLLSGTVGPWFWNFTIPVLNIQMKLLPALCTVAGTIFSCTNYFRVIFTGGVGKNGSTI
FT                   AGTSVLSPFLHIGSVITLAVMIYKKSAVQLFEKHPCLYILTFGFVSAKITNKLVVAHMT
FT                   KSEMHLHDTAFIGPALLFLDQYFNSFIDEYIVLWIALIFSFFDLIRYCVSVCNQIASHL
FT                   HIHVFRIKASTAHSNHH"
FT   assembly_gap    232247..232281
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   gene            257793..284866
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /note="gene_id=mCG22166.2"
FT   mRNA            join(257793..258021,262257..262381,265260..265404,
FT                   271845..271912,276103..276242,282994..283086,
FT                   283596..284865)
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, transcript variant
FT                   mCT20429"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT20429.2 created
FT                   on 25-APR-2002"
FT   mRNA            join(257794..258021,259007..259086,262257..262381,
FT                   265260..265404,271845..271912,276103..276242,
FT                   280744..280921,281652..281734,282994..283086,
FT                   283596..284866)
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, transcript variant
FT                   mCT168422"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT168422.0 created
FT                   on 25-APR-2002"
FT   mRNA            join(257794..258021,260600..260776,262257..262381,
FT                   265260..265404,271845..271912,276103..276242,
FT                   280744..280921,281652..281734,282994..283086,
FT                   283596..284866)
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, transcript variant
FT                   mCT168421"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT168421.0 created
FT                   on 25-APR-2002"
FT   mRNA            join(<257931..258021,262257..262381,265263..265404,
FT                   271845..271912,276103..276242,280744..280921,
FT                   281652..281734,282994..283086,283596..283951)
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, transcript variant
FT                   mCT189464"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT189464.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<257965..258021,265260..265404,271845..271912,
FT                   276103..276242,280744..280921,281652..281734,
FT                   282994..283086,283596..284866)
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, transcript variant
FT                   mCT189463"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT189463.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<257979..258021,262257..262381,265260..265404,
FT                   271845..271912,276103..276242,280744..280921,
FT                   281652..281734,282994..283086,283596..284172)
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, transcript variant
FT                   mCT189462"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT189462.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<257988..258021,265260..265404,271845..271912,
FT                   276103..276242,280744..280921,281652..281734,
FT                   282994..283086,283596..283706)
FT                   /codon_start=1
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, isoform CRA_c"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT189463.0
FT                   protein_id=mCP110442.0 isoform=CRA_c"
FT                   /protein_id="EDL01877.1"
FT                   /translation="GWSWLVGDRKEEDLSEMWWFQQGLSFLPSALVIWTFATFIFSYIT
FT                   AITLHHVDPALPYISDTGTIPPERCLFGVMLNIAAVLGIATMYVRYKQVHALNPEENLI
FT                   IKLNKAGLVLGILSCLGLSLVANFQKSTLFIVHVCGAVLAFSMGSFYMFVQTILSYQMQ
FT                   PKIHSKQVFWVRLLLVIWCGVSALSMMTCSSILYSSDFGPDVVQKLHWNPEDKGYVLHL
FT                   VTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEANLHGLTLYDTVPCPVNNERTPLLSRD
FT                   FQ"
FT   CDS             join(<262366..262381,265260..265404,271845..271912,
FT                   276103..276242,280744..280921,281652..281734,
FT                   282994..283086,283596..283706)
FT                   /codon_start=1
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, isoform CRA_b"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT189462.0
FT                   protein_id=mCP110441.0 isoform=CRA_b"
FT                   /protein_id="EDL01876.1"
FT                   /translation="PEVRPEDLSEMWWFQQGLSFLPSALVIWTFATFIFSYITAITLHH
FT                   VDPALPYISDTGTIPPERCLFGVMLNIAAVLGIATMYVRYKQVHALNPEENLIIKLNKA
FT                   GLVLGILSCLGLSLVANFQKSTLFIVHVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSK
FT                   QVFWVRLLLVIWCGVSALSMMTCSSILYSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAE
FT                   WSMSFSFFGFFLTYIRDFQKITLRVEANLHGLTLYDTVPCPVNNERTPLLSRDFQ"
FT   CDS             join(<262366..262381,265263..265404,271845..271912,
FT                   276103..276242,280744..280921,281652..281734,
FT                   282994..283086,283596..283706)
FT                   /codon_start=1
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, isoform CRA_d"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT189464.0
FT                   protein_id=mCP110443.0 isoform=CRA_d"
FT                   /protein_id="EDL01878.1"
FT                   /translation="PEVRPDLSEMWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHV
FT                   DPALPYISDTGTIPPERCLFGVMLNIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAG
FT                   LVLGILSCLGLSLVANFQKSTLFIVHVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQ
FT                   VFWVRLLLVIWCGVSALSMMTCSSILYSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAEW
FT                   SMSFSFFGFFLTYIRDFQKITLRVEANLHGLTLYDTVPCPVNNERTPLLSRDFQ"
FT   CDS             join(265274..265404,271845..271912,276103..276242,
FT                   280744..280921,281652..281734,282994..283086,
FT                   283596..283706)
FT                   /codon_start=1
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, isoform CRA_a"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT168421.0
FT                   protein_id=mCP91452.0 isoform=CRA_a"
FT                   /protein_id="EDL01874.1"
FT                   /translation="MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISD
FT                   TGTIPPERCLFGVMLNIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAGLVLGILSCL
FT                   GLSLVANFQKSTLFIVHVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLV
FT                   IWCGVSALSMMTCSSILYSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAEWSMSFSFFGF
FT                   FLTYIRDFQKITLRVEANLHGLTLYDTVPCPVNNERTPLLSRDFQ"
FT   CDS             join(265274..265404,271845..271912,276103..276242,
FT                   280744..280921,281652..281734,282994..283086,
FT                   283596..283706)
FT                   /codon_start=1
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, isoform CRA_a"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT168422.0
FT                   protein_id=mCP91455.0 isoform=CRA_a"
FT                   /protein_id="EDL01875.1"
FT                   /translation="MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISD
FT                   TGTIPPERCLFGVMLNIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAGLVLGILSCL
FT                   GLSLVANFQKSTLFIVHVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLV
FT                   IWCGVSALSMMTCSSILYSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAEWSMSFSFFGF
FT                   FLTYIRDFQKITLRVEANLHGLTLYDTVPCPVNNERTPLLSRDFQ"
FT   CDS             join(265274..265404,271845..271912,276103..276242,
FT                   282994..283086,283596..283706)
FT                   /codon_start=1
FT                   /gene="Tmem77"
FT                   /locus_tag="mCG_22166"
FT                   /product="transmembrane protein 77, isoform CRA_e"
FT                   /note="gene_id=mCG22166.2 transcript_id=mCT20429.2
FT                   protein_id=mCP19772.2 isoform=CRA_e"
FT                   /db_xref="GOA:Q9D835"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="MGI:MGI:1914421"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D835"
FT                   /protein_id="EDL01879.1"
FT                   /translation="MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISD
FT                   TGTIPPERCLFGVMLNIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAGLVLGILSCL
FT                   GLSLVANFQGYVLHLVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEANLHGLTLYDTV
FT                   PCPVNNERTPLLSRDFQ"
FT   assembly_gap    272652..272671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    286983..287108
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    312405..313293
FT                   /estimated_length=889
FT                   /gap_type="unknown"
FT   assembly_gap    333074..333256
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    350827..351040
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    360216..360433
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    377059..377095
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    385677..386116
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   gene            392386..444405
FT                   /locus_tag="mCG_22164"
FT                   /note="gene_id=mCG22164.2"
FT   mRNA            join(392386..392531,441727..442008,442774..444405)
FT                   /locus_tag="mCG_22164"
FT                   /product="mCG22164, transcript variant mCT176053"
FT                   /note="gene_id=mCG22164.2 transcript_id=mCT176053.0 created
FT                   on 18-NOV-2002"
FT   CDS             join(392484..392531,441727..442008,442774..443217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22164"
FT                   /product="mCG22164, isoform CRA_a"
FT                   /note="gene_id=mCG22164.2 transcript_id=mCT176053.0
FT                   protein_id=mCP98975.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9P5"
FT                   /db_xref="InterPro:IPR026191"
FT                   /db_xref="MGI:MGI:2445214"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9P5"
FT                   /protein_id="EDL01880.1"
FT                   /translation="MAGGTRARSRANKAKPTQYEMASIVKKEIQEKGNNKKYSQGSHTN
FT                   IKASCLKNDAEFKKLFGLTKDLRVCLTRIPDHLSSGKSFNSFNSLMKSSSYKDANIVVK
FT                   KEEKKQSFSKKRKAETMKMGNTKKIKIENADDTVMSIMNGTDVASSQPLSSILPTSDIS
FT                   QHNIVTSHSTTREDKRTEAEHCSHEKQEKGTLSSSTSFEQSTFLNKNFMEDIFPVTPPE
FT                   LEETIRDEKIRRLKQILREKEAALEELRKKMYQKQ"
FT   assembly_gap    412617..412636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(429094..429475,439032..440511,441727..442008,
FT                   442774..444405)
FT                   /locus_tag="mCG_22164"
FT                   /product="mCG22164, transcript variant mCT20427"
FT                   /note="gene_id=mCG22164.2 transcript_id=mCT20427.1 created
FT                   on 18-NOV-2002"
FT   mRNA            join(429294..429475,441727..442008,442774..444405)
FT                   /locus_tag="mCG_22164"
FT                   /product="mCG22164, transcript variant mCT176052"
FT                   /note="gene_id=mCG22164.2 transcript_id=mCT176052.0 created
FT                   on 18-NOV-2002"
FT   CDS             join(429414..429475,439032..440511,441727..442008,
FT                   442774..443217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22164"
FT                   /product="mCG22164, isoform CRA_c"
FT                   /note="gene_id=mCG22164.2 transcript_id=mCT20427.1
FT                   protein_id=mCP19761.2 isoform=CRA_c"
FT                   /protein_id="EDL01882.1"
FT                   /translation="MSNSLQSVILKTAEEKSGSRCISGCMYQVVPTIGSDGKKLLQLLP
FT                   ISKSSGNLIPVVQSPVMSHGLKANTEKPVQVTFQTQISSSSTSASVQLPVFQPANTTKC
FT                   FFTGAIDTTGKDRVTSVRTGNFTPPVSNIQNHGVKIHKLTRQTFTIPPSTQNDSSHFIF
FT                   NTPSLLPNVNSSILPSGNHLKIPAHAEVKSVLASSLPPLVQQKILGTATTSTSGTVEAS
FT                   QIPTVVYVHPVNSVKFVVTKKTQTIYPKPVTFNTLQIPPNVATETQLKGGQHPQAAPVN
FT                   SIFQEYLQPGIPCIIPVKSSNNVATKVLNTFVGRKNLGDNTIDTPLLNTNSSGRTHSVS
FT                   EPIKDNALIMFNGKVWLNEKGTCGLPSKIDQQNSVSSDIPLKDSSQLVSSSIVTEISRE
FT                   ILNSVLVKSKSFQLKTKSLSNSQLASMANLRAEKNEKVERPSFSVTNPHTMNQSTHCLK
FT                   QSKTVFINPVFPDGFRTGQNAPRKGNLVQNIEKICSSVDAATVTSQQCVFRDQESQTQY
FT                   EMASIVKKEIQEKGNNKKYSQGSHTNIKASCLKNDAEFKKLFGLTKDLRVCLTRIPDHL
FT                   SSGKSFNSFNSLMKSSSYKDANIVVKKEEKKQSFSKKRKAETMKMGNTKKIKIENADDT
FT                   VMSIMNGTDVASSQPLSSILPTSDISQHNIVTSHSTTREDKRTEAEHCSHEKQEKGTLS
FT                   SSTSFEQSTFLNKNFMEDIFPVTPPELEETIRDEKIRRLKQILREKEAALEELRKKMYQ
FT                   KQ"
FT   CDS             join(441739..442008,442774..443217)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22164"
FT                   /product="mCG22164, isoform CRA_b"
FT                   /note="gene_id=mCG22164.2 transcript_id=mCT176052.0
FT                   protein_id=mCP98974.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8M8"
FT                   /db_xref="InterPro:IPR026191"
FT                   /db_xref="MGI:MGI:2445214"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8M8"
FT                   /protein_id="EDL01881.1"
FT                   /translation="MASIVKKEIQEKGNNKKYSQGSHTNIKASCLKNDAEFKKLFGLTK
FT                   DLRVCLTRIPDHLSSGKSFNSFNSLMKSSSYKDANIVVKKEEKKQSFSKKRKAETMKMG
FT                   NTKKIKIENADDTVMSIMNGTDVASSQPLSSILPTSDISQHNIVTSHSTTREDKRTEAE
FT                   HCSHEKQEKGTLSSSTSFEQSTFLNKNFMEDIFPVTPPELEETIRDEKIRRLKQILREK
FT                   EAALEELRKKMYQKQ"
FT   gene            complement(467284..497471)
FT                   /gene="Cd53"
FT                   /locus_tag="mCG_22168"
FT                   /note="gene_id=mCG22168.2"
FT   mRNA            complement(join(467284..468238,469456..469539,
FT                   470575..470655,474690..474785,475289..475363,
FT                   476161..476349,478041..478119,497389..497471))
FT                   /gene="Cd53"
FT                   /locus_tag="mCG_22168"
FT                   /product="CD53 antigen, transcript variant mCT20431"
FT                   /note="gene_id=mCG22168.2 transcript_id=mCT20431.1 created
FT                   on 25-APR-2002"
FT   CDS             complement(join(468167..468238,469456..469539,
FT                   470575..470655,474690..474785,475289..475363,
FT                   476161..476349,478041..478103))
FT                   /codon_start=1
FT                   /gene="Cd53"
FT                   /locus_tag="mCG_22168"
FT                   /product="CD53 antigen, isoform CRA_b"
FT                   /note="gene_id=mCG22168.2 transcript_id=mCT20431.1
FT                   protein_id=mCP19787.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U0W1"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:88341"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U0W1"
FT                   /protein_id="EDL01884.1"
FT                   /translation="MGMSSLKLLKYVLFIFNLLFWVCGCCILGFGIYFLVQNTYGVLFR
FT                   NLPFLTLGNILVIVGSIIMVVAFLGCMGSIKENKCLLMSFFVLLLIILLAEVTIAILLF
FT                   VYEQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPS
FT                   GADVQGCYNKAKSWFHSNFLYIGIITICVCVIQVLGMSFALTLNCQIDKTSQALGL"
FT   mRNA            complement(join(<468182..468238,469456..469539,
FT                   470575..470655,474690..474785,475289..475363,
FT                   476161..476349,478041..478119,497387..>497455))
FT                   /gene="Cd53"
FT                   /locus_tag="mCG_22168"
FT                   /product="CD53 antigen, transcript variant mCT189467"
FT                   /note="gene_id=mCG22168.2 transcript_id=mCT189467.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<468182..468238,469456..469539,
FT                   470575..470655,474690..474785,475289..475363,
FT                   476161..476349,478041..478119,497387..>497424))
FT                   /codon_start=1
FT                   /gene="Cd53"
FT                   /locus_tag="mCG_22168"
FT                   /product="CD53 antigen, isoform CRA_a"
FT                   /note="gene_id=mCG22168.2 transcript_id=mCT189467.0
FT                   protein_id=mCP110444.0 isoform=CRA_a"
FT                   /protein_id="EDL01883.1"
FT                   /translation="ILPEVLRDTAFKRAYYPSMGMSSLKLLKYVLFIFNLLFWVCGCCI
FT                   LGFGIYFLVQNTYGVLFRNLPFLTLGNILVIVGSIIMVVAFLGCMGSIKENKCLLMSFF
FT                   VLLLIILLAEVTIAILLFVYEQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCC
FT                   GVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSNFLYIGIITICVCVIQVLGMSFAL
FT                   TLNCQIDKTSQ"
FT   assembly_gap    479836..479855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(503242..503899)
FT                   /locus_tag="mCG_1026325"
FT                   /note="gene_id=mCG1026325.1"
FT   mRNA            complement(join(503242..503617,503665..503899))
FT                   /locus_tag="mCG_1026325"
FT                   /product="mCG1026325"
FT                   /note="gene_id=mCG1026325.1 transcript_id=mCT144029.1
FT                   created on 21-MAY-2002"
FT   CDS             complement(join(503604..503617,503665..503821))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026325"
FT                   /product="mCG1026325"
FT                   /note="gene_id=mCG1026325.1 transcript_id=mCT144029.1
FT                   protein_id=mCP60227.1"
FT                   /protein_id="EDL01885.1"
FT                   /translation="MTLSPGKPTLYFLNHLQNYYDKNFPNNKISYVYTCVMRGGFWYVV
FT                   KKALIRKIDVK"
FT   gene            complement(<529033..530031)
FT                   /gene="Olfr266"
FT                   /locus_tag="mCG_66693"
FT                   /note="gene_id=mCG66693.2"
FT   mRNA            complement(<529033..530031)
FT                   /gene="Olfr266"
FT                   /locus_tag="mCG_66693"
FT                   /product="olfactory receptor 266"
FT                   /note="gene_id=mCG66693.2 transcript_id=mCT66876.2 created
FT                   on 25-APR-2002"
FT   CDS             complement(529033..529983)
FT                   /codon_start=1
FT                   /gene="Olfr266"
FT                   /locus_tag="mCG_66693"
FT                   /product="olfactory receptor 266"
FT                   /note="gene_id=mCG66693.2 transcript_id=mCT66876.2
FT                   protein_id=mCP39968.2"
FT                   /db_xref="GOA:Q8VFC3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030100"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFC3"
FT                   /protein_id="EDL01886.1"
FT                   /translation="MMTLSWENQTVIVEFVLRGFSSILQLNISLFIMFCIFYILTISGN
FT                   ILIVFLVLCNHALHTPMYFFLVNLSFLEVCYTSNIVPKMLLIIIADQKTISVVGCLAQF
FT                   YFFGSLAATECLLLAVMSYDRYLAICQPLRYPILMTGSLCFRLAIGSWFCCFFLTAITM
FT                   VLLCRQNFCGPNEIDHFFCDFAPLIHLSCMDTSLIETVAFATSSAVTLVPFFLITISYS
FT                   CILIAILRIPSGTGRKKAFSTCSSHLTVVTVFYGTLIATYLVPSANSSQYLRKGFSLLY
FT                   TILTPMFNPIIYSLRNRDIHEALKKCLSKKSDFLI"
FT   assembly_gap    549229..549335
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    562051..562750
FT                   /estimated_length=700
FT                   /gap_type="unknown"
FT   assembly_gap    575117..575715
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    601899..602093
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    616208..616396
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    621354..621605
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    635573..636461
FT                   /estimated_length=889
FT                   /gap_type="unknown"
FT   assembly_gap    640466..640675
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    644492..644511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    656738..656757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(656997..801203)
FT                   /locus_tag="mCG_140173"
FT                   /note="gene_id=mCG140173.0"
FT   mRNA            complement(join(656997..657126,750538..750620,
FT                   762947..763051,798880..799089,801050..801203))
FT                   /locus_tag="mCG_140173"
FT                   /product="mCG140173"
FT                   /note="gene_id=mCG140173.0 transcript_id=mCT168408.0
FT                   created on 25-APR-2002"
FT   assembly_gap    677366..677385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    698078..698097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    710961..710980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    736668..736747
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            <743881..746981
FT                   /gene="Kcna3"
FT                   /locus_tag="mCG_21727"
FT                   /note="gene_id=mCG21727.1"
FT   mRNA            <743881..746981
FT                   /gene="Kcna3"
FT                   /locus_tag="mCG_21727"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, member 3"
FT                   /note="gene_id=mCG21727.1 transcript_id=mCT20515.1 created
FT                   on 25-APR-2002"
FT   CDS             743881..745467
FT                   /codon_start=1
FT                   /gene="Kcna3"
FT                   /locus_tag="mCG_21727"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, member 3"
FT                   /note="gene_id=mCG21727.1 transcript_id=mCT20515.1
FT                   protein_id=mCP19737.0"
FT                   /db_xref="GOA:P16390"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003972"
FT                   /db_xref="InterPro:IPR004050"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:96660"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16390"
FT                   /protein_id="EDL01888.1"
FT                   /translation="MTVVPGDHLLEPEAAGGGGGDPPQGGCGSGGGGGGCDRYEPLPPA
FT                   LPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDR
FT                   NRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERP
FT                   LPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASP
FT                   SQDVFEAANNSTSGAPSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIM
FT                   NLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQIL
FT                   GQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVG
FT                   YGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSC
FT                   QHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNS
FT                   CVNIKKIFTDV"
FT   gene            756178..758880
FT                   /locus_tag="mCG_60109"
FT                   /note="gene_id=mCG60109.2"
FT   mRNA            756178..758880
FT                   /locus_tag="mCG_60109"
FT                   /product="mCG60109"
FT                   /note="gene_id=mCG60109.2 transcript_id=mCT60292.2 created
FT                   on 25-APR-2002"
FT   CDS             756358..756699
FT                   /codon_start=1
FT                   /locus_tag="mCG_60109"
FT                   /product="mCG60109"
FT                   /note="gene_id=mCG60109.2 transcript_id=mCT60292.2
FT                   protein_id=mCP39960.1"
FT                   /protein_id="EDL01889.1"
FT                   /translation="MDAQFQAAWMRVQWQLHTSVSVHIRGYISTDASYDGKNSKLEGTL
FT                   HITSGTNEIEQEIKRNIKIKKIVNVKVSCQPIDILVESNCPKAIISVTDKDSLVCVSSK
FT                   PTTVVVFFH"
FT   gene            complement(761214..761808)
FT                   /locus_tag="mCG_1026328"
FT                   /note="gene_id=mCG1026328.2"
FT   mRNA            complement(761214..761808)
FT                   /locus_tag="mCG_1026328"
FT                   /product="mCG1026328"
FT                   /note="gene_id=mCG1026328.2 transcript_id=mCT144032.2
FT                   created on 12-MAY-2003"
FT   CDS             complement(761672..761788)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026328"
FT                   /product="mCG1026328"
FT                   /note="gene_id=mCG1026328.2 transcript_id=mCT144032.2
FT                   protein_id=mCP60234.1"
FT                   /protein_id="EDL01890.1"
FT                   /translation="MFTGVLLDYVYNICCKHFKSNDKWTCADCKKTSHNPNS"
FT   assembly_gap    777347..777366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    787546..787875
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   gene            798230..805718
FT                   /gene="A930002I21Rik"
FT                   /locus_tag="mCG_1026329"
FT                   /note="gene_id=mCG1026329.0"
FT   mRNA            join(798230..798310,804358..805718)
FT                   /gene="A930002I21Rik"
FT                   /locus_tag="mCG_1026329"
FT                   /product="RIKEN cDNA A930002I21"
FT                   /note="gene_id=mCG1026329.0 transcript_id=mCT144033.0
FT                   created on 25-APR-2002"
FT   CDS             complement(join(799016..799089,801050..801092))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140173"
FT                   /product="mCG140173"
FT                   /note="gene_id=mCG140173.0 transcript_id=mCT168408.0
FT                   protein_id=mCP93035.0"
FT                   /protein_id="EDL01887.1"
FT                   /translation="MDNHFSLSHTLFKIAPAFLSFLCGRGDCALKMRAAIQK"
FT   assembly_gap    800290..800358
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   CDS             804362..804727
FT                   /codon_start=1
FT                   /gene="A930002I21Rik"
FT                   /locus_tag="mCG_1026329"
FT                   /product="RIKEN cDNA A930002I21"
FT                   /note="gene_id=mCG1026329.0 transcript_id=mCT144033.0
FT                   protein_id=mCP60236.1"
FT                   /protein_id="EDL01891.1"
FT                   /translation="MREPSPEQPSLRQKHMLTLCSQSWIGLTFEVQRNRGHRRQLGLGS
FT                   KTPPRTPLEAAAVNLEDCYFLQKPTLTSPVSNRLLMSVGAALYSQRYSPVSDTHPQSIK
FT                   AAAAATIMKLTVDSFHF"
FT   gene            808872..814264
FT                   /gene="Kcna2"
FT                   /locus_tag="mCG_21725"
FT                   /note="gene_id=mCG21725.1"
FT   mRNA            join(808872..808917,809060..809144,810569..810896,
FT                   811330..814264)
FT                   /gene="Kcna2"
FT                   /locus_tag="mCG_21725"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, member 2"
FT                   /note="gene_id=mCG21725.1 transcript_id=mCT20512.1 created
FT                   on 17-JUN-2003"
FT   assembly_gap    808918..809059
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   CDS             811490..812989
FT                   /codon_start=1
FT                   /gene="Kcna2"
FT                   /locus_tag="mCG_21725"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, member 2"
FT                   /note="gene_id=mCG21725.1 transcript_id=mCT20512.1
FT                   protein_id=mCP19736.0"
FT                   /db_xref="GOA:P63141"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003972"
FT                   /db_xref="InterPro:IPR004049"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:96659"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63141"
FT                   /protein_id="EDL01892.1"
FT                   /translation="MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFE
FT                   TQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNV
FT                   PLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPAR
FT                   IIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPF
FT                   FIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDA
FT                   QQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVI
FT                   LFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGV
FT                   LTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDY
FT                   MEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV"
FT   gene            complement(813397..813989)
FT                   /locus_tag="mCG_140175"
FT                   /note="gene_id=mCG140175.0"
FT   mRNA            complement(813397..813989)
FT                   /locus_tag="mCG_140175"
FT                   /product="mCG140175"
FT                   /note="gene_id=mCG140175.0 transcript_id=mCT168410.0
FT                   created on 25-APR-2002"
FT   CDS             complement(813443..813583)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140175"
FT                   /product="mCG140175"
FT                   /note="gene_id=mCG140175.0 transcript_id=mCT168410.0
FT                   protein_id=mCP91445.0"
FT                   /protein_id="EDL01893.1"
FT                   /translation="MQHFSVTKHKPPEHLVGNCNSQTPACDTESSSNTQDCVFFSTQNR
FT                   E"
FT   gene            820063..821888
FT                   /locus_tag="mCG_1026314"
FT                   /note="gene_id=mCG1026314.1"
FT   mRNA            820063..821888
FT                   /locus_tag="mCG_1026314"
FT                   /product="mCG1026314"
FT                   /note="gene_id=mCG1026314.1 transcript_id=mCT144018.1
FT                   created on 25-APR-2002"
FT   CDS             821371..821673
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026314"
FT                   /product="mCG1026314"
FT                   /note="gene_id=mCG1026314.1 transcript_id=mCT144018.1
FT                   protein_id=mCP60166.1"
FT                   /protein_id="EDL01894.1"
FT                   /translation="MLRACPSSAFTWEPATQFPFVVVLGWFLHLKGSGKLERPMIELQP
FT                   AEQTMPQPNWPLPGFLQPCTPLSTEGNLGTARTNGARKQGGFSCFHYRQSCKAHK"
FT   assembly_gap    839750..839769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    840873..840892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    847261..849261
FT                   /estimated_length=2001
FT                   /gap_type="unknown"
FT   assembly_gap    850555..850574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    858835..858854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    862895..863094
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    873397..873416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    874555..874574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    875799..875818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    879322..879341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    898875..898946
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            <899825..>901369
FT                   /locus_tag="mCG_21732"
FT                   /note="gene_id=mCG21732.1"
FT   mRNA            join(<899825..900420,900595..>901369)
FT                   /locus_tag="mCG_21732"
FT                   /product="mCG21732"
FT                   /note="gene_id=mCG21732.1 transcript_id=mCT20680.1 created
FT                   on 26-APR-2002"
FT   CDS             join(899825..900420,900595..901369)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21732"
FT                   /product="mCG21732"
FT                   /note="gene_id=mCG21732.1 transcript_id=mCT20680.1
FT                   protein_id=mCP19750.1"
FT                   /protein_id="EDL01895.1"
FT                   /translation="MEVALVNFDNSDEIHEEPGYATDFDPTSSKGRPGSSPFSNWRVLI
FT                   SDNTNHETAFSKIPGEYVDPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLNQFPETLL
FT                   GDREKRMQFFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEISFYEL
FT                   GSEAMDQFREDEGFIKDPETLLPTNDFHRQFWLLFDINTNKTGLSQTMFTDPFFMGEST
FT                   CIVWFTFELVLRFVVCPSKTDFFKNIMNIIDIISIIPYFATLITELVQETEPSAQQNMS
FT                   LAILRIIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYF
FT                   AEVDEPESHFSSIPDGFWWAVVTMTTVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVP
FT                   VIVSNFNYFYHRETENEEKPNIPGSLDKILNSMGSRMGSTESLNKTNGSCSAEKSRK"
FT   assembly_gap    900426..900588
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    912191..912766
FT                   /estimated_length=576
FT                   /gap_type="unknown"
FT   assembly_gap    921167..921186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(921273..931694)
FT                   /locus_tag="mCG_21729"
FT                   /note="gene_id=mCG21729.1"
FT   mRNA            complement(join(921273..921479,922753..922851,
FT                   923358..923502,924190..924303,925905..926104,
FT                   928097..928215,928594..928711,929604..929754,
FT                   931622..931694))
FT                   /locus_tag="mCG_21729"
FT                   /product="mCG21729"
FT                   /note="gene_id=mCG21729.1 transcript_id=mCT20516.2 created
FT                   on 26-APR-2002"
FT   CDS             complement(join(921348..921479,922753..922851,
FT                   923358..923502,924190..924303,925905..926104,
FT                   928097..928215,928594..928711,929604..929754,
FT                   931622..931683))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21729"
FT                   /product="mCG21729"
FT                   /note="gene_id=mCG21729.1 transcript_id=mCT20516.2
FT                   protein_id=mCP19783.2"
FT                   /db_xref="GOA:B7ZWD6"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR012848"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="MGI:MGI:2684977"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZWD6"
FT                   /protein_id="EDL01896.1"
FT                   /translation="MRRFVLLLAALAISQSHVVTRIPLHKGKSLRNTLKEQGLLEDFLS
FT                   RQQYEFSEKNSRIGVVASEPLINYLDSEYFGTIYIGTPPQEFTVVFDTGSSELWVPSVY
FT                   CNSKVCRNHHRFDPSKSITFQNLSKPLFVQYGTGRMEGFLAYDTVTVSDIVVSHQTVGL
FT                   STQEPGDIFTYSPFDGILGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYMSRNEQGS
FT                   MLTLGAIDQSYFIGSLHWVPVTVQGYWQFTVDRITINGEVVACQGGCPAVLDTGTALLT
FT                   GPGRDILNIQQVIGAVQGHNDQFDIDCWRLDIMPTVVFEIHGREFPLPPYAYTNQVQGF
FT                   CSSGFKQGSHMWILGDVFIREFYSVFDRANNRVGLAKAI"
FT   gene            940607..944014
FT                   /locus_tag="mCG_1026332"
FT                   /note="gene_id=mCG1026332.1"
FT   mRNA            join(940607..940732,942588..942658,943554..944014)
FT                   /locus_tag="mCG_1026332"
FT                   /product="mCG1026332"
FT                   /note="gene_id=mCG1026332.1 transcript_id=mCT144036.1
FT                   created on 26-APR-2002"
FT   CDS             join(940720..940732,942588..942658,943554..943793)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026332"
FT                   /product="mCG1026332"
FT                   /note="gene_id=mCG1026332.1 transcript_id=mCT144036.1
FT                   protein_id=mCP60242.1"
FT                   /db_xref="GOA:J3QQ32"
FT                   /db_xref="MGI:MGI:2442999"
FT                   /db_xref="UniProtKB/TrEMBL:J3QQ32"
FT                   /protein_id="EDL01897.1"
FT                   /translation="MTAAALSDTPCLDIILSSSGMERSFSYQEAGFLTSTVQDLQWSPN
FT                   QEELPRLFLKSCSPLFAFTFLATSTLSTRWRQIPIVEDGSVGPKNSHLSCGWILKECQL
FT                   CLS"
FT   gene            complement(945107..948679)
FT                   /locus_tag="mCG_21718"
FT                   /note="gene_id=mCG21718.1"
FT   mRNA            complement(join(945107..945664,947064..947189,
FT                   948629..948679))
FT                   /locus_tag="mCG_21718"
FT                   /product="mCG21718"
FT                   /note="gene_id=mCG21718.1 transcript_id=mCT20503.1 created
FT                   on 19-MAR-2003"
FT   CDS             complement(join(945545..945664,947064..947189,
FT                   948629..948652))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21718"
FT                   /product="mCG21718"
FT                   /note="gene_id=mCG21718.1 transcript_id=mCT20503.1
FT                   protein_id=mCP19742.2"
FT                   /db_xref="GOA:Q14A28"
FT                   /db_xref="InterPro:IPR009523"
FT                   /db_xref="InterPro:IPR023569"
FT                   /db_xref="MGI:MGI:2180370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14A28"
FT                   /protein_id="EDL01898.1"
FT                   /translation="MKAVVKTKACERDIQCGAGTCCAISLWLRGLRLCTPLGREGEECH
FT                   PGSHKIPFLRKRQHHTCPCSPSLLCSRFPDGRYRCFRDLKNANF"
FT   assembly_gap    947659..947678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    952477..952639
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    972473..972492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    982183..982444
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   gene            988953..994177
FT                   /locus_tag="mCG_21719"
FT                   /note="gene_id=mCG21719.1"
FT   mRNA            join(988953..989209,989966..990027,992005..992122,
FT                   993731..994177)
FT                   /locus_tag="mCG_21719"
FT                   /product="mCG21719"
FT                   /note="gene_id=mCG21719.1 transcript_id=mCT20504.1 created
FT                   on 26-APR-2002"
FT   CDS             join(989013..989209,989966..990027,992005..992122,
FT                   993731..993791)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21719"
FT                   /product="mCG21719"
FT                   /note="gene_id=mCG21719.1 transcript_id=mCT20504.1
FT                   protein_id=mCP19754.1"
FT                   /db_xref="GOA:G3UW70"
FT                   /db_xref="InterPro:IPR024135"
FT                   /db_xref="MGI:MGI:1915826"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW70"
FT                   /protein_id="EDL01899.1"
FT                   /translation="MPFRKERGRGAALNFVPLETPSRRPPRSSHVIEVCGEGGSVLLRG
FT                   PGLGRTACGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQ
FT                   QAARLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS"
FT   gene            1001333..1022208
FT                   /gene="Slc16a4"
FT                   /locus_tag="mCG_21720"
FT                   /note="gene_id=mCG21720.1"
FT   mRNA            join(1001333..1001515,1002508..1002625,1008045..1008177,
FT                   1008937..1009080,1009221..1009382,1010803..1011321,
FT                   1013162..1013373,1014512..1014605,1021537..1022208)
FT                   /gene="Slc16a4"
FT                   /locus_tag="mCG_21720"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 4"
FT                   /note="gene_id=mCG21720.1 transcript_id=mCT20508.1 created
FT                   on 26-APR-2002"
FT   CDS             join(1002539..1002625,1008045..1008177,1008937..1009080,
FT                   1009221..1009382,1010803..1011321,1013162..1013373,
FT                   1014512..1014605,1021537..1021688)
FT                   /codon_start=1
FT                   /gene="Slc16a4"
FT                   /locus_tag="mCG_21720"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 4"
FT                   /note="gene_id=mCG21720.1 transcript_id=mCT20508.1
FT                   protein_id=mCP19755.1"
FT                   /db_xref="GOA:Q8R0M8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:2385183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R0M8"
FT                   /protein_id="EDL01900.1"
FT                   /translation="MVKKEKTPSPYTKPLDGGWGWMVVLHFFLVNVFVMGMTKTFAIFF
FT                   VVFQEEFEGTSEQIGWIGSIMSSLRFSAGPLAAIICDVLGEKATSILGTFLVSGGYVIS
FT                   SWATGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLGLSTAIARSGMGLTFLLAP
FT                   FTKFLIDLYDWTGALILFGAIILNLVPSSMLLRPIHSQSNNNSDIENKGSILSATEPEA
FT                   SYKTETSKCKETQEPFIKDSTMKKSEQPTTTLTVLGNQSEEFSNRPHRNRPLLMSNGKS
FT                   HKKKFVSWNCKQKLLDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDVMD
FT                   ASYLVSVAGITETVSQLISGWIADQNWIKKYQYHKSYLILCGVTNLLAPLATTFPLLMA
FT                   YTILFAIFAGGYLALILPVLVDLSKNSRVHKFLGYASFFAGIAVLSGPPIAGWIYDYTQ
FT                   TYTGSFYFSGTCYILSSVSLFFVPLAERWKRKQSDLLRTTIK"
FT   gene            complement(1036026..1043338)
FT                   /locus_tag="mCG_54810"
FT                   /note="gene_id=mCG54810.2"
FT   mRNA            complement(join(1036026..1036389,1040456..1043338))
FT                   /locus_tag="mCG_54810"
FT                   /product="mCG54810"
FT                   /note="gene_id=mCG54810.2 transcript_id=mCT54993.2 created
FT                   on 26-APR-2002"
FT   assembly_gap    1036698..1036717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1038138..1038157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(1042729..1043190)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54810"
FT                   /product="mCG54810"
FT                   /note="gene_id=mCG54810.2 transcript_id=mCT54993.2
FT                   protein_id=mCP39947.2"
FT                   /protein_id="EDL01901.1"
FT                   /translation="MKGKERSPVKPKRSRGGEDSSSRGERSKKLGGSGGSNGSSSGKTD
FT                   SGGSRRSLHLDKSSSRGGSREYETGGGSSSSRLHSYSSPSTKNSSGGGESRSSSRGGGG
FT                   ESRSSGAASSAPGGGDGVEYKTPEDQRAGVPAERRGGGGRAVSRVQTLR"
FT   gene            1053138..1053939
FT                   /pseudo
FT                   /locus_tag="mCG_21724"
FT                   /note="gene_id=mCG21724.2"
FT   mRNA            1053138..1053939
FT                   /pseudo
FT                   /locus_tag="mCG_21724"
FT                   /note="gene_id=mCG21724.2 transcript_id=mCT20511.2 created
FT                   on 26-APR-2002"
FT   assembly_gap    1064048..1064094
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    1070850..1071403
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    1077366..1077460
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1078911..1078930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1080700..1080719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1106486..>1107105
FT                   /locus_tag="mCG_140177"
FT                   /note="gene_id=mCG140177.0"
FT   mRNA            join(1106486..1106867,1106893..>1107103)
FT                   /locus_tag="mCG_140177"
FT                   /product="mCG140177, transcript variant mCT168414"
FT                   /note="gene_id=mCG140177.0 transcript_id=mCT168414.0
FT                   created on 26-APR-2002"
FT   mRNA            join(1106523..1106842,1106868..>1107105)
FT                   /locus_tag="mCG_140177"
FT                   /product="mCG140177, transcript variant mCT168412"
FT                   /note="gene_id=mCG140177.0 transcript_id=mCT168412.0
FT                   created on 26-APR-2002"
FT   mRNA            join(1106739..1106807,1106838..>1107103)
FT                   /locus_tag="mCG_140177"
FT                   /product="mCG140177, transcript variant mCT168413"
FT                   /note="gene_id=mCG140177.0 transcript_id=mCT168413.0
FT                   created on 26-APR-2002"
FT   CDS             1106943..>1107105
FT                   /codon_start=1
FT                   /locus_tag="mCG_140177"
FT                   /product="mCG140177, isoform CRA_a"
FT                   /note="gene_id=mCG140177.0 transcript_id=mCT168412.0
FT                   protein_id=mCP91448.0 isoform=CRA_a"
FT                   /protein_id="EDL01902.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLNQEAVKTGQKILIEQQ
FT                   ESMSEEKGL"
FT   CDS             1106943..>1107103
FT                   /codon_start=1
FT                   /locus_tag="mCG_140177"
FT                   /product="mCG140177, isoform CRA_b"
FT                   /note="gene_id=mCG140177.0 transcript_id=mCT168413.0
FT                   protein_id=mCP91449.0 isoform=CRA_b"
FT                   /protein_id="EDL01903.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLNQEAVKTGQKILIEQQ
FT                   ESMSEEKG"
FT   CDS             1106943..>1107103
FT                   /codon_start=1
FT                   /locus_tag="mCG_140177"
FT                   /product="mCG140177, isoform CRA_b"
FT                   /note="gene_id=mCG140177.0 transcript_id=mCT168414.0
FT                   protein_id=mCP91451.0 isoform=CRA_b"
FT                   /protein_id="EDL01904.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLNQEAVKTGQKILIEQQ
FT                   ESMSEEKG"
FT   assembly_gap    1107149..1107168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1108522..1109242
FT                   /estimated_length=721
FT                   /gap_type="unknown"
FT   assembly_gap    1148152..1148171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1148233..1169212)
FT                   /gene="Kcnc4"
FT                   /locus_tag="mCG_21714"
FT                   /note="gene_id=mCG21714.3"
FT   mRNA            complement(join(1148233..1149405,1155359..1155562,
FT                   1157433..1158369,1168515..1169212))
FT                   /gene="Kcnc4"
FT                   /locus_tag="mCG_21714"
FT                   /product="potassium voltage gated channel, Shaw-related
FT                   subfamily, member 4"
FT                   /note="gene_id=mCG21714.3 transcript_id=mCT20501.3 created
FT                   on 16-APR-2003"
FT   CDS             complement(join(1149350..1149405,1155359..1155562,
FT                   1157433..1158369,1168515..1169204))
FT                   /codon_start=1
FT                   /gene="Kcnc4"
FT                   /locus_tag="mCG_21714"
FT                   /product="potassium voltage gated channel, Shaw-related
FT                   subfamily, member 4"
FT                   /note="gene_id=mCG21714.3 transcript_id=mCT20501.3
FT                   protein_id=mCP19760.2"
FT                   /protein_id="EDL01905.1"
FT                   /translation="MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGT
FT                   RHETYRSTLRTLPGTRLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCEFFFDRHP
FT                   GVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALD
FT                   IFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFED
FT                   PYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTEIHRVGNITSVRFRREVET
FT                   EPILTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSS
FT                   KAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIF
FT                   ATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGA
FT                   LCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRKKHVPRPPQLESPIYCKSEET
FT                   SPRDSTYSDTSPPAREEGVVERKRADSKQNGDANAVLSDEEGAGLTQPLALAPTPEERR
FT                   ALRRSGTRDRNKKAAACFLLSAGDYACADGSVRKEGNVEPKACVPVSHTCAL"
FT   assembly_gap    1158972..1158991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1169329..1169390
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    1170309..1170376
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            complement(1177962..1228527)
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /note="gene_id=mCG21726.2"
FT   mRNA            complement(join(1177962..1181963,1182450..1182612,
FT                   1183950..1184109,1184685..1184868,1187142..1187334,
FT                   1187591..1187832,1201924..1202034,1203563..1203744,
FT                   1204441..1204567,1206170..1206327,1210872..1211244,
FT                   1228114..1228527))
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 17, transcript variant mCT20513"
FT                   /note="gene_id=mCG21726.2 transcript_id=mCT20513.3 created
FT                   on 21-APR-2003"
FT   mRNA            complement(join(1179571..1181963,1182450..1182612,
FT                   1183950..1184109,1184685..1184877,1187142..1187334,
FT                   1187591..1187832,1201924..1202034,1203563..1203744,
FT                   1204441..1204567,1206170..1206327,1210872..1211244,
FT                   1228114..>1228428))
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 17, transcript variant mCT189456"
FT                   /note="gene_id=mCG21726.2 transcript_id=mCT189456.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(<1181595..1181963,1182450..1182612,
FT                   1183950..1184109,1184685..1184905,1187603..1187832,
FT                   1201924..1202034,1203563..1203744,1204435..1204567,
FT                   1206170..1206327,1210872..1211244))
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 17, transcript variant mCT168420"
FT                   /note="gene_id=mCG21726.2 transcript_id=mCT168420.0 created
FT                   on 21-APR-2003"
FT   mRNA            complement(join(<1181595..1181963,1182450..1182612,
FT                   1183950..1184171,1185380..1185396,1187142..1187334,
FT                   1187591..1187832,1201924..1202034,1203563..1203744,
FT                   1204435..1204567,1206170..1206327,1210872..1211244))
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 17, transcript variant mCT168419"
FT                   /note="gene_id=mCG21726.2 transcript_id=mCT168419.0 created
FT                   on 21-APR-2003"
FT   CDS             complement(join(1181595..1181963,1182450..1182612,
FT                   1183950..1184109,1184685..1184877,1187142..1187334,
FT                   1187591..1187832,1201924..1202034,1203563..1203744,
FT                   1204441..1204567,1206170..1206327,1210872..>1211232))
FT                   /codon_start=1
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 17, isoform CRA_c"
FT                   /note="gene_id=mCG21726.2 transcript_id=mCT189456.0
FT                   protein_id=mCP110458.0 isoform=CRA_c"
FT                   /protein_id="EDL01908.1"
FT                   /translation="EKADRNRAPPSLCAGEQGYTAPVAPMPKNSKVTQREHSNEHVTES
FT                   VADLLALEEPVDYKQSVLNVAGETGGKQKVAEEELDTEDRPAWNSKLQYILAQIGFSVG
FT                   LGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAVGQRIRRGSIGVWHYVCPR
FT                   LGGIGFSSCIVCLFVGLYYNVIIGWSVFYFFKSFQYPLPWSECPVIRNGTVAVVEPECE
FT                   KSSATTYFWYREALDISNSISESGGLNWKMTLCLLVAWSIVGMAVVKGIQSSGKVMYFS
FT                   SLFPYVVLACFLVRGLLLRGAVDGILHMFTPKLDKMLDPQVWREAATQVFFALGLGFGG
FT                   VIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVVFAVLGFKANIMNEKCVVENAEKI
FT                   LGYLNSNVLSRDLIPPHVNFSHLTTKDYSEMYSVIMTVKEKQFPALGLDPCLLEDELDK
FT                   SVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMIGTMAGITTPIIDTFKVP
FT                   KEMFTVGCCVFAFFVGLLFVQRSGNYFVTMFDDYSATLPLTVIVILENIAVAWIYGTKK
FT                   FMQELTEMLGFQPYRFYFYMWKFVSPLCMAVLTTASIIQLGVSPPGYSAWIKEEAAERY
FT                   LYFPNWAMALLITLIAVATLPIPVVFILRHFHLLSDGSNTLSVSYKKGRMMKDISNLEE
FT                   NDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLENSNNPNGRYGSGYLLASTPESEL"
FT   CDS             complement(join(1181595..1181963,1182450..1182612,
FT                   1183950..1184109,1184685..1184868,1187142..1187334,
FT                   1187591..1187832,1201924..1202034,1203563..1203744,
FT                   1204441..1204567,1206170..1206327,1210872..1211157))
FT                   /codon_start=1
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 17, isoform CRA_d"
FT                   /note="gene_id=mCG21726.2 transcript_id=mCT20513.3
FT                   protein_id=mCP19771.3 isoform=CRA_d"
FT                   /protein_id="EDL01909.1"
FT                   /translation="MPKNSKVTQREHSNEHVTESVADLLALEEPVDYKQSVLNVAGETG
FT                   GKQKVAEEELDTEDRPAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLV
FT                   LLIIIGIPLFFLELAVGQRIRRGSIGVWHYVCPRLGGIGFSSCIVCLFVGLYYNVIIGW
FT                   SVFYFFKSFQYPLPWSECPVIRNGTVAVVEPECEKSSATTYFWYREALDISNSISESGG
FT                   LNWKMTLCLLVAWSIVGMAVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVDGI
FT                   LHMFTPKLDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSFIN
FT                   FFTSVLATLVVFAVLGFKANIMNEKCVVENAEKILGYLNSNVLSRDLIPPHVNFSHLTT
FT                   KDYSEMYSVIMTVKEKQFPALGLDPCLLEDELDKGTGLAFIAFTEAMTHFPASPFWSVM
FT                   FFLMLINLGLGSMIGTMAGITTPIIDTFKVPKEMFTVGCCVFAFFVGLLFVQRSGNYFV
FT                   TMFDDYSATLPLTVIVILENIAVAWIYGTKKFMQELTEMLGFQPYRFYFYMWKFVSPLC
FT                   MAVLTTASIIQLGVSPPGYSAWIKEEAAERYLYFPNWAMALLITLIAVATLPIPVVFIL
FT                   RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGP
FT                   GSTSPLENSNNPNGRYGSGYLLASTPESEL"
FT   CDS             complement(join(1181595..1181963,1182450..1182612,
FT                   1183950..1184109,1184685..1184905,1187603..1187832,
FT                   1201924..1202034,1203563..1203744,1204435..1204567,
FT                   1206170..1206327,1210872..1211157))
FT                   /codon_start=1
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 17, isoform CRA_b"
FT                   /note="gene_id=mCG21726.2 transcript_id=mCT168420.0
FT                   protein_id=mCP91440.0 isoform=CRA_b"
FT                   /protein_id="EDL01907.1"
FT                   /translation="MPKNSKVTQREHSNEHVTESVADLLALEEPVDYKQSVLNVAGETG
FT                   GKQKVAEEELDTEDRPAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLV
FT                   LLIIIGIPLFFLELAVGQRIRRGSIGVWHYVCPRLGGIGFSSCIVCLFVGLYYNVIIGW
FT                   SVFYFFKSFQYPLPWSECPVIRNGTVAGKLVEPECEKSSATTYFWYREALDISNSISES
FT                   GGLNWKMTLCLLVAWSIVGMAVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVD
FT                   GILHMFTPKLDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSF
FT                   INFFTSVLATLVVFAVLGFKANIMNENGPDSLPHPQSVQGTGLAFIAFTEAMTHFPASP
FT                   FWSVMFFLMLINLGLGSMIGTMAGITTPIIDTFKVPKEMFTVGCCVFAFFVGLLFVQRS
FT                   GNYFVTMFDDYSATLPLTVIVILENIAVAWIYGTKKFMQELTEMLGFQPYRFYFYMWKF
FT                   VSPLCMAVLTTASIIQLGVSPPGYSAWIKEEAAERYLYFPNWAMALLITLIAVATLPIP
FT                   VVFILRHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHR
FT                   SYLGPGSTSPLENSNNPNGRYGSGYLLASTPESEL"
FT   CDS             complement(join(1181595..1181963,1182450..1182612,
FT                   1183950..1184171,1185380..1185396,1187142..1187334,
FT                   1187591..1187832,1201924..1202034,1203563..1203744,
FT                   1204435..1204567,1206170..1206327,1210872..1211157))
FT                   /codon_start=1
FT                   /gene="Slc6a17"
FT                   /locus_tag="mCG_21726"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter), member 17, isoform CRA_a"
FT                   /note="gene_id=mCG21726.2 transcript_id=mCT168419.0
FT                   protein_id=mCP91453.0 isoform=CRA_a"
FT                   /protein_id="EDL01906.1"
FT                   /translation="MPKNSKVTQREHSNEHVTESVADLLALEEPVDYKQSVLNVAGETG
FT                   GKQKVAEEELDTEDRPAWNSKLQYILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLV
FT                   LLIIIGIPLFFLELAVGQRIRRGSIGVWHYVCPRLGGIGFSSCIVCLFVGLYYNVIIGW
FT                   SVFYFFKSFQYPLPWSECPVIRNGTVAGKLVEPECEKSSATTYFWYREALDISNSISES
FT                   GGLNWKMTLCLLVAWSIVGMAVVKGIQSSGKVMYFSSLFPYVVLACFLVRGLLLRGAVD
FT                   GILHMFTPKLDKMLDPQVWREAATQVFFALGLGFGGVIAFSSYNKQDNNCHFDAALVSF
FT                   INFFTSVLATLVVFAVLGFKANIMNEKCVVENAEKILGYLNSNVLSRDLIPPHVNFSHL
FT                   TTKDYSEMYSVIMTVKEKQFPALGLDPCLLEDELDKKWEWSLVPPTLHLCPPTHTPASR
FT                   LSVVGCCVFAFFVGLLFVQRSGNYFVTMFDDYSATLPLTVIVILENIAVAWIYGTKKFM
FT                   QELTEMLGFQPYRFYFYMWKFVSPLCMAVLTTASIIQLGVSPPGYSAWIKEEAAERYLY
FT                   FPNWAMALLITLIAVATLPIPVVFILRHFHLLSDGSNTLSVSYKKGRMMKDISNLEEND
FT                   ETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLENSNNPNGRYGSGYLLASTPESEL"
FT   assembly_gap    1191199..1191218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1247411..1247476
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    1253779..1253815
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(1264210..>1265587)
FT                   /gene="Ubl4b"
FT                   /locus_tag="mCG_21723"
FT                   /note="gene_id=mCG21723.0"
FT   mRNA            complement(1264210..>1265587)
FT                   /gene="Ubl4b"
FT                   /locus_tag="mCG_21723"
FT                   /product="ubiquitin-like 4B"
FT                   /note="gene_id=mCG21723.0 transcript_id=mCT20509.0 created
FT                   on 26-APR-2002"
FT   CDS             complement(1264888..>1265580)
FT                   /codon_start=1
FT                   /gene="Ubl4b"
FT                   /locus_tag="mCG_21723"
FT                   /product="ubiquitin-like 4B"
FT                   /note="gene_id=mCG21723.0 transcript_id=mCT20509.0
FT                   protein_id=mCP19735.0"
FT                   /protein_id="EDL01910.1"
FT                   /translation="LVAAHVGWALALLGAVTESPIGPYTFRATPRAWIPPDSSLAPMFL
FT                   TVKLLLGRRCSLKVSGKESVATLKKLVSQHLQVPEEQQHLLFRGQLLADDKYLSDYSIG
FT                   PNASINVIMRPPEDAALDKTHQTQPLWLQLGQVLDKHFGAKDAKTVLGFLRQEHEERLQ
FT                   RLSLEALEQLVGQLLAQQQLDELAEEKEAPAVASELEQNNGGGGGGGGTGGEGGGKKEE
FT                   EEGEEADQ"
FT   assembly_gap    1274693..1274754
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    1305914..1305964
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            <1305965..1316300
FT                   /gene="Alx3"
FT                   /locus_tag="mCG_21721"
FT                   /note="gene_id=mCG21721.1"
FT   mRNA            join(<1305965..1305986,1310985..1311301,1314802..1314930,
FT                   1315302..1316300)
FT                   /gene="Alx3"
FT                   /locus_tag="mCG_21721"
FT                   /product="aristaless 3"
FT                   /note="gene_id=mCG21721.1 transcript_id=mCT20505.1 created
FT                   on 26-APR-2002"
FT   CDS             join(<1305965..1305986,1310985..1311301,1314802..1314930,
FT                   1315302..1315610)
FT                   /codon_start=1
FT                   /gene="Alx3"
FT                   /locus_tag="mCG_21721"
FT                   /product="aristaless 3"
FT                   /note="gene_id=mCG21721.1 transcript_id=mCT20505.1
FT                   protein_id=mCP19732.1"
FT                   /protein_id="EDL01911.1"
FT                   /translation="FYEGSAEAEEKASKAASFPQLPVDCRGGPRDGPSNVQASPGPCLA
FT                   SLSVPLSPGLPDSMELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALR
FT                   TDLTEARVQVWFQNRRAKWRKRERYGKMQEGRNPFTTAYDISVLPRTDSHPQLQNSLWP
FT                   SPGSGSPGGPCLMSPEGIPSPCMSPYSHSHGNVAGFMGVPASPAAHPGIYSIHGFPPAL
FT                   GGHSFEPSPDGDYKSPSLVSLRMKPKEPPGLLNWTT"
FT   gene            complement(1323062..1342224)
FT                   /gene="6330569M22Rik"
FT                   /locus_tag="mCG_21730"
FT                   /note="gene_id=mCG21730.1"
FT   mRNA            complement(join(1323062..1323997,1325126..1325330,
FT                   1325846..1325950,1326292..1326358,1327039..1327139,
FT                   1327343..1327469,1328588..1328685,1328846..1328920,
FT                   1329441..1329512,1330570..1330633,1330739..1330804,
FT                   1331857..1332074,1332402..1332584,1334917..1335044,
FT                   1335155..1335261,1336211..1336279,1337266..1337386,
FT                   1337475..1337609,1337918..1337992,1338686..1338755,
FT                   1342031..1342224))
FT                   /gene="6330569M22Rik"
FT                   /locus_tag="mCG_21730"
FT                   /product="RIKEN cDNA 6330569M22"
FT                   /note="gene_id=mCG21730.1 transcript_id=mCT20517.1 created
FT                   on 29-APR-2002"
FT   CDS             complement(join(1323750..1323997,1325126..1325330,
FT                   1325846..1325950,1326292..1326358,1327039..1327139,
FT                   1327343..1327469,1328588..1328685,1328846..1328920,
FT                   1329441..1329512,1330570..1330633,1330739..1330804,
FT                   1331857..1332074,1332402..1332584,1334917..1335044,
FT                   1335155..1335261,1336211..1336279,1337266..1337386,
FT                   1337475..1337609,1337918..1337992,1338686..1338755,
FT                   1342031..1342210))
FT                   /codon_start=1
FT                   /gene="6330569M22Rik"
FT                   /locus_tag="mCG_21730"
FT                   /product="RIKEN cDNA 6330569M22"
FT                   /note="gene_id=mCG21730.1 transcript_id=mCT20517.1
FT                   protein_id=mCP19739.2"
FT                   /protein_id="EDL01912.1"
FT                   /translation="MEPAAAGPGPLIVNNKQPQPPPPPPPATAQPPPGAPRAAGGLLPG
FT                   GKAREFNRNQRKDSEGYSESPDLEFEYADTDKWAAELAELYSYTEGPEFLMNRKCFEED
FT                   FRIHVSDKKWTELDTNQHRTHAMRLLDGLEVTAREKRLKVARAILYVAQGTFGECSSEA
FT                   EVQFWMRYNIFLLLEVGTFNALVELLNMEIDNSAACSSAVRKPAISLADSTDLRVLLNI
FT                   MYLIVETVHQDCDGDKAEWRTMRQTFRAELGSPLYNNEPFAIMLFGMVTKFCSGHAPHF
FT                   PMKKVLLLLWKTVLCTLGGFEELQSMKAEKRTLLGLPPLPEDSIKVIRNMRAASPPASA
FT                   SDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEEEENDDDSSLEGEAFPLE
FT                   RDEVMPPPLQHPQTDRLTCPKGLPWAPKVREKDIEMFLESSRSKFIGYTLGSDTNTVVG
FT                   LPRPIHESIKTLKQHKYTSIAEVQAQMEEEYLRSPLSGGEEEVEQVPAETLYQGLLPSL
FT                   PQYMIALLKILLAAAPTSKAKTDSINILADVLPEEMPTTVLQSMKLGVDVNRHKEVIVK
FT                   AISAVLLLLLKHFKLNHIYQFEYMAQHLVFANCIPLILKFFNQNIMSYITAKNSISVLD
FT                   YPHCVVNELPELTAESLEAGDNNQFCWRNLFSCINLLRILNKLTKWKHSRTMMLVVFKS
FT                   APILKRALKVKQAMMQLYVLKLLKVQTKYLGRQWRKSNMKTMSAIYQKVRHRLNDDWAY
FT                   GNDLDARPWDFQAEECALRANIERFNARRYDRTHSNPDFLPVDNCLQSVLGQRVDLPED
FT                   FQMNYDLWLEREVFSKPISWEELLQ"
FT   gene            complement(1373662..1406890)
FT                   /gene="Ahcyl1"
FT                   /locus_tag="mCG_21716"
FT                   /note="gene_id=mCG21716.1"
FT   mRNA            complement(join(1373662..1375649,1376052..1376172,
FT                   1377678..1377756,1378176..1378244,1378603..1378701,
FT                   1378786..1378880,1379203..1379273,1379629..1379717,
FT                   1380428..1380491,1380740..1380856,1381674..1381780,
FT                   1382578..1382672,1383972..1384074,1384544..1384644,
FT                   1385547..1385690,1388256..1388367,1406694..1406890))
FT                   /gene="Ahcyl1"
FT                   /locus_tag="mCG_21716"
FT                   /product="S-adenosylhomocysteine hydrolase-like 1,
FT                   transcript variant mCT20506"
FT                   /note="gene_id=mCG21716.1 transcript_id=mCT20506.2 created
FT                   on 26-APR-2002"
FT   mRNA            complement(join(1373663..1375649,1376052..1376172,
FT                   1377678..1377756,1378176..1378244,1378603..1378701,
FT                   1378786..1378880,1379203..1379273,1379629..1379717,
FT                   1380428..1380491,1380740..1380856,1381674..1381780,
FT                   1382578..1382672,1383972..1384074,1384544..1384644,
FT                   1385547..1385690,1388256..1388367,1406321..1406440))
FT                   /gene="Ahcyl1"
FT                   /locus_tag="mCG_21716"
FT                   /product="S-adenosylhomocysteine hydrolase-like 1,
FT                   transcript variant mCT168415"
FT                   /note="gene_id=mCG21716.1 transcript_id=mCT168415.0 created
FT                   on 26-APR-2002"
FT   CDS             complement(join(1375643..1375649,1376052..1376172,
FT                   1377678..1377756,1378176..1378244,1378603..1378701,
FT                   1378786..1378880,1379203..1379273,1379629..1379717,
FT                   1380428..1380491,1380740..1380856,1381674..1381780,
FT                   1382578..1382672,1383972..1384074,1384544..1384644,
FT                   1385547..1385690,1388256..1388367,1406694..1406813))
FT                   /codon_start=1
FT                   /gene="Ahcyl1"
FT                   /locus_tag="mCG_21716"
FT                   /product="S-adenosylhomocysteine hydrolase-like 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21716.1 transcript_id=mCT20506.2
FT                   protein_id=mCP19765.2 isoform=CRA_b"
FT                   /protein_id="EDL01914.1"
FT                   /translation="MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFA
FT                   DDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKGSSN
FT                   FCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIE
FT                   TLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMDGWQ
FT                   ANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDS
FT                   VTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYIT
FT                   EIDPICALQACMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGH
FT                   SNTEIDVTSLRTPELTWERVRSQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSIT
FT                   ATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGL
FT                   NKNGPFKPNYYRY"
FT   CDS             complement(join(1375643..1375649,1376052..1376172,
FT                   1377678..1377756,1378176..1378244,1378603..1378701,
FT                   1378786..1378880,1379203..1379273,1379629..1379717,
FT                   1380428..1380491,1380740..1380856,1381674..1381780,
FT                   1382578..1382672,1383972..1384074,1384544..1384644,
FT                   1385547..1385690,1388256..1388346))
FT                   /codon_start=1
FT                   /gene="Ahcyl1"
FT                   /locus_tag="mCG_21716"
FT                   /product="S-adenosylhomocysteine hydrolase-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21716.1 transcript_id=mCT168415.0
FT                   protein_id=mCP91450.0 isoform=CRA_a"
FT                   /protein_id="EDL01913.1"
FT                   /translation="MQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPR
FT                   EKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGC
FT                   THITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWW
FT                   CIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAG
FT                   KLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCA
FT                   ALKALGAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDR
FT                   MKNSCIVCNMGHSNTEIDVTSLRTPELTWERVRSQVDHVIWPDGKRVVLLAEGRLLNLS
FT                   CSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPSFDAHLT
FT                   ELTDDQAKYLGLNKNGPFKPNYYRY"
FT   gene            complement(1451591..1470774)
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /note="gene_id=mCG21717.2"
FT   mRNA            complement(join(1451591..1453679,1457260..1457318,
FT                   1457641..1457693,1458688..1459703,1460845..1460992,
FT                   1464266..1464436,1465965..1466027,1467151..1467273,
FT                   1470559..1470756))
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage),
FT                   transcript variant mCT20507"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT20507.0 created
FT                   on 29-APR-2002"
FT   mRNA            complement(join(1451777..1452126,1467243..1467273,
FT                   1470559..1470763))
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage),
FT                   transcript variant mCT168418"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT168418.0 created
FT                   on 29-APR-2002"
FT   mRNA            complement(join(1451855..1453679,1457260..1457318,
FT                   1457641..1457693,1458688..1458818,1460845..1460992,
FT                   1464266..1464436,1465965..1466027,1467151..1467273,
FT                   1470559..>1470770))
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage),
FT                   transcript variant mCT189455"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT189455.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1451993..1452126,1467243..1467273,
FT                   1470559..1470597))
FT                   /codon_start=1
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT168418.0
FT                   protein_id=mCP91447.0 isoform=CRA_c"
FT                   /protein_id="EDL01917.1"
FT                   /translation="MTARGAAGRCPSSTWLGSRLLLVSLPGYWVNNLSGHESGRRVVCK
FT                   LHQPCPETAGGKDTGDFLVGLT"
FT   mRNA            complement(join(1453184..1453679,1457260..1457318,
FT                   1457641..1457693,1458688..1458818,1460845..1460992,
FT                   1464266..1464436,1465965..1466027,1467151..1467273,
FT                   1467523..1467662,1470559..1470755))
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage),
FT                   transcript variant mCT168416"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT168416.0 created
FT                   on 29-APR-2002"
FT   mRNA            complement(join(1456129..1456374,1457260..1457318,
FT                   1457641..1457693,1458688..1459703,1460845..1460992,
FT                   1464266..1464436,1465965..1466027,1467151..1467273,
FT                   1470559..1470774))
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage),
FT                   transcript variant mCT168417"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT168417.0 created
FT                   on 29-APR-2002"
FT   CDS             complement(join(1457273..1457318,1457641..1457693,
FT                   1458688..1458818,1460845..1460992,1464266..1464436,
FT                   1465965..1466027,1467151..1467273,1470559..>1470753))
FT                   /codon_start=1
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT189455.0
FT                   protein_id=mCP110457.0 isoform=CRA_d"
FT                   /protein_id="EDL01918.1"
FT                   /translation="KFASVLSVSLRLSASQDSGVALDRGAGSSATSEQGSERTRAANTP
FT                   CRDPAARMTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQ
FT                   QLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATER
FT                   LQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKN
FT                   CNNSFAKCSSRGHVEQHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRD
FT                   PQTLDSSVGRPEDSSLTQDEDRQVELPV"
FT   CDS             complement(join(1457273..1457318,1457641..1457693,
FT                   1458688..1459703,1460845..1460992,1464266..1464436,
FT                   1465965..1466027,1467151..1467273,1470559..1470597))
FT                   /codon_start=1
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT168417.0
FT                   protein_id=mCP91441.0 isoform=CRA_b"
FT                   /db_xref="GOA:P07141"
FT                   /db_xref="InterPro:IPR008001"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:1339753"
FT                   /db_xref="PDB:3EJJ"
FT                   /db_xref="PDB:3UF5"
FT                   /db_xref="PDB:4ADQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07141"
FT                   /protein_id="EDL01916.1"
FT                   /translation="MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGN
FT                   GHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTP
FT                   NANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKD
FT                   WNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLA
FT                   WDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLESTEQPNHGDRLTEDSQPHP
FT                   SAGGPVPGVEDILESSLGTNWVLEEASGEASEGFLTQEAKFSPSTPVGGSIQAETDRPR
FT                   ALSASPFPKSTEDQKPVDITDRPLTEVNPMRPIGQTQNNTPEKTDGTSTLREDHQEPGS
FT                   PHIATPNPQRVSNSATPVAQLLLPKSHSWGIVLPLGELEGKRSTRDRRSPAELEGGSAS
FT                   EGAARPVARFNSIPLTDTGHVEQHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKW
FT                   KWRSHRDPQTLDSSVGRPEDSSLTQDEDRQVELPV"
FT   CDS             complement(join(1457273..1457318,1457641..1457693,
FT                   1458688..1459703,1460845..1460992,1464266..1464436,
FT                   1465965..1466027,1467151..1467273,1470559..1470597))
FT                   /codon_start=1
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT20507.0
FT                   protein_id=mCP19729.1 isoform=CRA_b"
FT                   /db_xref="GOA:P07141"
FT                   /db_xref="InterPro:IPR008001"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:1339753"
FT                   /db_xref="PDB:3EJJ"
FT                   /db_xref="PDB:3UF5"
FT                   /db_xref="PDB:4ADQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07141"
FT                   /protein_id="EDL01919.1"
FT                   /translation="MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGN
FT                   GHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTP
FT                   NANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKD
FT                   WNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLA
FT                   WDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLESTEQPNHGDRLTEDSQPHP
FT                   SAGGPVPGVEDILESSLGTNWVLEEASGEASEGFLTQEAKFSPSTPVGGSIQAETDRPR
FT                   ALSASPFPKSTEDQKPVDITDRPLTEVNPMRPIGQTQNNTPEKTDGTSTLREDHQEPGS
FT                   PHIATPNPQRVSNSATPVAQLLLPKSHSWGIVLPLGELEGKRSTRDRRSPAELEGGSAS
FT                   EGAARPVARFNSIPLTDTGHVEQHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKW
FT                   KWRSHRDPQTLDSSVGRPEDSSLTQDEDRQVELPV"
FT   CDS             complement(join(1457273..1457318,1457641..1457693,
FT                   1458688..1458818,1460845..1460992,1464266..1464436,
FT                   1465965..1466027,1467151..1467273,1467523..1467633))
FT                   /codon_start=1
FT                   /gene="Csf1"
FT                   /locus_tag="mCG_21717"
FT                   /product="colony stimulating factor 1 (macrophage), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21717.2 transcript_id=mCT168416.0
FT                   protein_id=mCP91454.0 isoform=CRA_a"
FT                   /protein_id="EDL01915.1"
FT                   /translation="MMVHNHSYLQVQEIPRRKHIECVHASRQNIHKHKTKTTWLGSRLL
FT                   LVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVC
FT                   YLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFH
FT                   ETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRGHVEQHEGSSDPQIPES
FT                   VFHLLVPGIILVLLTVGGLLFYKWKWRSHRDPQTLDSSVGRPEDSSLTQDEDRQVELPV
FT                   "
FT   gene            complement(1481223..1481541)
FT                   /locus_tag="mCG_1026316"
FT                   /note="gene_id=mCG1026316.1"
FT   mRNA            complement(1481223..1481541)
FT                   /locus_tag="mCG_1026316"
FT                   /product="mCG1026316"
FT                   /note="gene_id=mCG1026316.1 transcript_id=mCT144020.1
FT                   created on 29-APR-2002"
FT   CDS             complement(1481226..1481330)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026316"
FT                   /product="mCG1026316"
FT                   /note="gene_id=mCG1026316.1 transcript_id=mCT144020.1
FT                   protein_id=mCP60168.1"
FT                   /protein_id="EDL01920.1"
FT                   /translation="MRSFVQMSSHLQHSTIDWPTELIFPQVTVKNLYM"
FT   assembly_gap    1490379..1490398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1531157..>1544476)
FT                   /locus_tag="mCG_144523"
FT                   /note="gene_id=mCG144523.0"
FT   mRNA            complement(join(1531157..1531855,1532327..1532397,
FT                   1540114..1540332,1543969..>1544476))
FT                   /locus_tag="mCG_144523"
FT                   /product="mCG144523"
FT                   /note="gene_id=mCG144523.0 transcript_id=mCT183947.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1531579..1531855,1532327..>1532334))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144523"
FT                   /product="mCG144523"
FT                   /note="gene_id=mCG144523.0 transcript_id=mCT183947.0
FT                   protein_id=mCP105313.0"
FT                   /protein_id="EDL01921.1"
FT                   /translation="TNIPEHITHVVSCCNEDLERLSKLRVKGFKFGTTAPQWKLEEVDP
FT                   SEKALCHWKVTSKEVLGPQSLSAVRGITVKIALTFKETGTFAGLQRQCE"
FT   gene            complement(1578919..1579620)
FT                   /pseudo
FT                   /locus_tag="mCG_21715"
FT                   /note="gene_id=mCG21715.1"
FT   mRNA            complement(1578919..1579620)
FT                   /pseudo
FT                   /locus_tag="mCG_21715"
FT                   /note="gene_id=mCG21715.1 transcript_id=mCT20502.1 created
FT                   on 29-APR-2002"
FT   gene            1588168..1604311
FT                   /gene="Eps8l3"
FT                   /locus_tag="mCG_21722"
FT                   /note="gene_id=mCG21722.1"
FT   mRNA            join(1588168..1588304,1590285..1590339,1590479..1590543,
FT                   1592033..1592191,1592454..1592603,1593748..1593803,
FT                   1594295..1594452,1594542..1594660,1594824..1594944,
FT                   1595030..1595091,1595305..1595379,1595693..1595841,
FT                   1601342..1601423,1601638..1601672,1601819..1602011,
FT                   1602193..1602321,1602631..1602704,1603172..1603304,
FT                   1603521..1604311)
FT                   /gene="Eps8l3"
FT                   /locus_tag="mCG_21722"
FT                   /product="ESP8-like 3"
FT                   /note="gene_id=mCG21722.1 transcript_id=mCT20510.2 created
FT                   on 29-APR-2002"
FT   CDS             join(1590309..1590339,1590479..1590543,1592033..1592191,
FT                   1592454..1592603,1593748..1593803,1594295..1594452,
FT                   1594542..1594660,1594824..1594944,1595030..1595091,
FT                   1595305..1595379,1595693..1595841,1601342..1601423,
FT                   1601638..1601672,1601819..1602011,1602193..1602321,
FT                   1602631..1602704,1603172..1603304,1603521..1603532)
FT                   /codon_start=1
FT                   /gene="Eps8l3"
FT                   /locus_tag="mCG_21722"
FT                   /product="ESP8-like 3"
FT                   /note="gene_id=mCG21722.1 transcript_id=mCT20510.2
FT                   protein_id=mCP19759.1"
FT                   /protein_id="EDL01922.1"
FT                   /translation="MSRPSSRAIYLHRKEYSQSMASEPTLLQHRVEHLMTCKLGTQRVR
FT                   EPKDALQKLQEMDAQGRVWSQDLFLQVRDGWLHLLDIETKEELDSYRLDNIKAIDVALN
FT                   TCSYNSILSVTVQESGLPGISTLLFQCQEVGAEQLRTSLQKALEEELEERPRFGVHHPS
FT                   QDRWKGPPLERPLPIQQAPPLEQRFSPEHRFPPEQPHNMTSERSISPSSRSLTHYPSAR
FT                   EPNGFTLPPPPRRAPSPEDPERDEEVLNHVLRDIELFAGKLKEVQARNSHKKTKLGRKK
FT                   KKSKNGITQAEYIDCFQKIKLSFNLLGKLALRMQETSAPEFVGLIFQTLKFILSQCPEA
FT                   GLPAKVISPLLTPKAIDLLQSCLSPPEDTLWKSLGTSWTTSWADWTGSEPPPYQPTFYD
FT                   GWQIPQPRSMMPITNQDSISLRGSRMRSSLHFPRDEPYNHNPEYEDSNLPLSSPSPGRA
FT                   ALKMQVLYEFEARNAQELTVAQGEILEVLDQSKRWWLVKNEAGLTGYIPSNILEPLPAG
FT                   APRGHRQPSFRAPMLRLSSKPEEVTAWLQAENFSTVTVRTLGSLMGSQLLHMRPGELQM
FT                   LCPQEAPRIQARLDAVRRMLGMTH"
FT   gene            complement(1603441..1606699)
FT                   /gene="4933431E20Rik"
FT                   /locus_tag="mCG_140178"
FT                   /note="gene_id=mCG140178.0"
FT   mRNA            complement(join(1603441..1604445,1604989..1605166,
FT                   1606581..1606699))
FT                   /gene="4933431E20Rik"
FT                   /locus_tag="mCG_140178"
FT                   /product="RIKEN cDNA 4933431E20, transcript variant
FT                   mCT168424"
FT                   /note="gene_id=mCG140178.0 transcript_id=mCT168424.0
FT                   created on 29-APR-2002"
FT   mRNA            complement(join(1603441..1604445,1604989..1605146,
FT                   1605799..1605930,1606581..1606691))
FT                   /gene="4933431E20Rik"
FT                   /locus_tag="mCG_140178"
FT                   /product="RIKEN cDNA 4933431E20, transcript variant
FT                   mCT168425"
FT                   /note="gene_id=mCG140178.0 transcript_id=mCT168425.0
FT                   created on 29-APR-2002"
FT   CDS             complement(1604159..1604371)
FT                   /codon_start=1
FT                   /gene="4933431E20Rik"
FT                   /locus_tag="mCG_140178"
FT                   /product="RIKEN cDNA 4933431E20, isoform CRA_a"
FT                   /note="gene_id=mCG140178.0 transcript_id=mCT168424.0
FT                   protein_id=mCP91444.0 isoform=CRA_a"
FT                   /protein_id="EDL01923.1"
FT                   /translation="MFLCTATEETGGRELKVDLPNNHCLKDKAPKESTKYLTRDSSASP
FT                   TSVKKACSCQQSILCLGDTLCLQLD"
FT   CDS             complement(1604159..1604371)
FT                   /codon_start=1
FT                   /gene="4933431E20Rik"
FT                   /locus_tag="mCG_140178"
FT                   /product="RIKEN cDNA 4933431E20, isoform CRA_a"
FT                   /note="gene_id=mCG140178.0 transcript_id=mCT168425.0
FT                   protein_id=mCP91446.0 isoform=CRA_a"
FT                   /protein_id="EDL01924.1"
FT                   /translation="MFLCTATEETGGRELKVDLPNNHCLKDKAPKESTKYLTRDSSASP
FT                   TSVKKACSCQQSILCLGDTLCLQLD"
FT   gene            1606757..1609623
FT                   /gene="Gstm5"
FT                   /locus_tag="mCG_21733"
FT                   /note="gene_id=mCG21733.2"
FT   mRNA            join(1606757..1606936,1607236..1607311,1607564..1607628,
FT                   1608226..1608307,1608400..1608500,1608905..1609000,
FT                   1609104..1609214,1609389..1609623)
FT                   /gene="Gstm5"
FT                   /locus_tag="mCG_21733"
FT                   /product="glutathione S-transferase, mu 5, transcript
FT                   variant mCT20681"
FT                   /note="gene_id=mCG21733.2 transcript_id=mCT20681.1 created
FT                   on 22-MAY-2002"
FT   mRNA            join(1606757..1606936,1607236..1607328,1608265..1608307,
FT                   1608400..1608500,1608905..1609000,1609104..1609214,
FT                   1609389..1609603)
FT                   /gene="Gstm5"
FT                   /locus_tag="mCG_21733"
FT                   /product="glutathione S-transferase, mu 5, transcript
FT                   variant mCT169294"
FT                   /note="gene_id=mCG21733.2 transcript_id=mCT169294.0 created
FT                   on 22-MAY-2002"
FT   CDS             join(1606892..1606936,1607236..1607328,1608265..1608307,
FT                   1608400..1608500,1608905..1609000,1609104..1609214,
FT                   1609389..1609487)
FT                   /codon_start=1
FT                   /gene="Gstm5"
FT                   /locus_tag="mCG_21733"
FT                   /product="glutathione S-transferase, mu 5, isoform CRA_a"
FT                   /note="gene_id=mCG21733.2 transcript_id=mCT169294.0
FT                   protein_id=mCP92157.0 isoform=CRA_a"
FT                   /protein_id="EDL01925.1"
FT                   /translation="MSSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKRYICGEGNECL
FT                   WSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRLCYNSNHENLKPQYLEQ
FT                   LPAQLKQFSLFLGKFTWFAGEKLTFVDFLTYDVLDQNRIFEPKCLDEFPNLKAFMCRFE
FT                   ALEKIAAFLQSDRFFKMPINNKMAKWGNKCLC"
FT   CDS             join(1606892..1606936,1607236..1607311,1607564..1607628,
FT                   1608226..1608307,1608400..1608500,1608905..1609000,
FT                   1609104..1609214,1609389..1609487)
FT                   /codon_start=1
FT                   /gene="Gstm5"
FT                   /locus_tag="mCG_21733"
FT                   /product="glutathione S-transferase, mu 5, isoform CRA_b"
FT                   /note="gene_id=mCG21733.2 transcript_id=mCT20681.1
FT                   protein_id=mCP19793.1 isoform=CRA_b"
FT                   /protein_id="EDL01926.1"
FT                   /translation="MSSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKRYICGEAPDYD
FT                   RSQWLDVKFKLDLDFPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIME
FT                   NQIMDFRMQLVRLCYNSNHENLKPQYLEQLPAQLKQFSLFLGKFTWFAGEKLTFVDFLT
FT                   YDVLDQNRIFEPKCLDEFPNLKAFMCRFEALEKIAAFLQSDRFFKMPINNKMAKWGNKC
FT                   LC"
FT   gene            complement(1637275..1642659)
FT                   /locus_tag="mCG_21731"
FT                   /note="gene_id=mCG21731.2"
FT   mRNA            complement(join(1637275..1637920,1639810..1639920,
FT                   1640003..1640098,1641215..1641315,1641414..1641495,
FT                   1641769..1641833,1642256..1642521))
FT                   /locus_tag="mCG_21731"
FT                   /product="mCG21731, transcript variant mCT169293"
FT                   /note="gene_id=mCG21731.2 transcript_id=mCT169293.0 created
FT                   on 22-MAY-2002"
FT   mRNA            complement(join(1637276..1637920,1639810..1639920,
FT                   1640003..1640098,1641215..1641315,1641414..1641495,
FT                   1641769..1641833,1642256..1642331,1642560..1642659))
FT                   /locus_tag="mCG_21731"
FT                   /product="mCG21731, transcript variant mCT20518"
FT                   /note="gene_id=mCG21731.2 transcript_id=mCT20518.0 created
FT                   on 22-MAY-2002"
FT   mRNA            complement(join(1637750..1637920,1639810..1639920,
FT                   1640003..1640098,1641215..1641315,1641414..1641495,
FT                   1641769..1641833,1642256..1642331,1642475..>1642555))
FT                   /locus_tag="mCG_21731"
FT                   /product="mCG21731, transcript variant mCT189453"
FT                   /note="gene_id=mCG21731.2 transcript_id=mCT189453.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1637831..1637920,1639810..1639920,
FT                   1640003..1640098,1641215..1641315,1641414..1641495,
FT                   1641769..1641833,1642256..1642331,1642560..1642595))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21731"
FT                   /product="mCG21731, isoform CRA_c"
FT                   /note="gene_id=mCG21731.2 transcript_id=mCT20518.0
FT                   protein_id=mCP19751.1 isoform=CRA_c"
FT                   /protein_id="EDL01929.1"
FT                   /translation="MPMTLGYWDIRGLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQ
FT                   WLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQL
FT                   MDNRMVLARLCYNADFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDV
FT                   LERNQVFEAKCLDAFPNLKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN"
FT   CDS             complement(join(1637831..1637920,1639810..1639920,
FT                   1640003..1640098,1641215..1641315,1641414..1641495,
FT                   1641769..1641833,1642256..1642331,1642475..>1642531))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21731"
FT                   /product="mCG21731, isoform CRA_b"
FT                   /note="gene_id=mCG21731.2 transcript_id=mCT189453.0
FT                   protein_id=mCP110459.0 isoform=CRA_b"
FT                   /protein_id="EDL01928.1"
FT                   /translation="DLEEGQGSVQSMEACSCSCLAHAIRLFLEYTDSSYEEKRYTMGDA
FT                   PDYDQSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERIRV
FT                   DILENQLMDNRMVLARLCYNADFEKLKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFV
FT                   DFIAYDVLERNQVFEAKCLDAFPNLKDFIARFEGLKKISDYMKTSRFLPRPMFTKMATW
FT                   GSN"
FT   CDS             complement(join(1637831..1637920,1639810..1639920,
FT                   1640003..1640098,1641215..1641315,1641414..1641495,
FT                   1641769..1641833,1642256..1642490))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21731"
FT                   /product="mCG21731, isoform CRA_a"
FT                   /note="gene_id=mCG21731.2 transcript_id=mCT169293.0
FT                   protein_id=mCP92154.0 isoform=CRA_a"
FT                   /protein_id="EDL01927.1"
FT                   /translation="MLLQLCMCVCVCVCVCVCVCVCSGPSMDIVKLGQRMRTRVEGVKN
FT                   FTISCLLQLAHAIRLFLEYTDSSYEEKRYTMGDAPDYDQSQWLNEKFKLGLDFPNLPYL
FT                   IDGSHKITQSNAILRYLGRKHNLCGETEEERIRVDILENQLMDNRMVLARLCYNADFEK
FT                   LKPGYLEQLPGMMRLYSEFLGKRPWFAGDKITFVDFIAYDVLERNQVFEAKCLDAFPNL
FT                   KDFIARFEGLKKISDYMKTSRFLPRPMFTKMATWGSN"
FT   gene            complement(1649789..1654675)
FT                   /locus_tag="mCG_21728"
FT                   /note="gene_id=mCG21728.1"
FT   mRNA            complement(join(1649789..1650257,1651934..1652044,
FT                   1652130..1652225,1653074..1653174,1653274..1653355,
FT                   1653643..1653707,1654186..1654261,1654539..1654675))
FT                   /locus_tag="mCG_21728"
FT                   /product="mCG21728, transcript variant mCT20514"
FT                   /note="gene_id=mCG21728.1 transcript_id=mCT20514.1 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(1649789..1650257,1651934..1652044,
FT                   1652130..1652267,1653074..1653174,1653274..1653355,
FT                   1653643..1653707,1654186..1654261,1654539..1654675))
FT                   /locus_tag="mCG_21728"
FT                   /product="mCG21728, transcript variant mCT169807"
FT                   /note="gene_id=mCG21728.1 transcript_id=mCT169807.0 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(1650168..1650257,1651934..1652044,
FT                   1652130..1652225,1653074..1653174,1653274..1653355,
FT                   1653643..1653707,1654186..1654261,1654539..1654574))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21728"
FT                   /product="mCG21728, isoform CRA_b"
FT                   /note="gene_id=mCG21728.1 transcript_id=mCT20514.1
FT                   protein_id=mCP19745.0 isoform=CRA_b"
FT                   /protein_id="EDL01931.1"
FT                   /translation="MPVTLGYWDIRGLGHAIRLLLEYTETGYEEKRYAMGDAPDYDRSQ
FT                   WLNDKFKLDLDFPNLPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQV
FT                   MDTRIQMGMLCYSADFEKRKPEFLKGLPDQLKLYSEFLGKQPWFAGDKITFADFLVYDV
FT                   LDQHRMFEPTCLDAFPNLKDFMARFEGLRKISAYMKTSRFLPSPVYLKQATWGNE"
FT   CDS             complement(join(1650168..1650257,1651934..1652044,
FT                   1652130..1652267,1653074..1653174,1653274..1653355,
FT                   1653643..1653707,1654186..1654261,1654539..1654574))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21728"
FT                   /product="mCG21728, isoform CRA_c"
FT                   /note="gene_id=mCG21728.1 transcript_id=mCT169807.0
FT                   protein_id=mCP92661.0 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8M7"
FT                   /db_xref="InterPro:IPR003081"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:1309467"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8M7"
FT                   /protein_id="EDL01932.1"
FT                   /translation="MPVTLGYWDIRGLGHAIRLLLEYTETGYEEKRYAMGDAPDYDRSQ
FT                   WLNDKFKLDLDFPNLPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDILEKQV
FT                   MDTRIQMGMLCYSADFGLHEGYDSYYFLLQEKRKPEFLKGLPDQLKLYSEFLGKQPWFA
FT                   GDKITFADFLVYDVLDQHRMFEPTCLDAFPNLKDFMARFEGLRKISAYMKTSRFLPSPV
FT                   YLKQATWGNE"
FT   mRNA            complement(join(1653095..1653707,1654186..1654261,
FT                   1654539..1654675))
FT                   /locus_tag="mCG_21728"
FT                   /product="mCG21728, transcript variant mCT175228"
FT                   /note="gene_id=mCG21728.1 transcript_id=mCT175228.0 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(1653568..1653707,1654186..1654261,
FT                   1654539..1654574))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21728"
FT                   /product="mCG21728, isoform CRA_a"
FT                   /note="gene_id=mCG21728.1 transcript_id=mCT175228.0
FT                   protein_id=mCP98147.0 isoform=CRA_a"
FT                   /protein_id="EDL01930.1"
FT                   /translation="MPVTLGYWDIRGLGHAIRLLLEYTETGYEEKRYAMGDAPDYDRSQ
FT                   WLNDKFKLDLDFPNVGAVKGKFGEDMVISPHLLAWLRV"
FT   assembly_gap    1670787..1670806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1674963..>1680424)
FT                   /locus_tag="mCG_144941"
FT                   /note="gene_id=mCG144941.0"
FT   mRNA            complement(join(1674963..1675562,1677353..1677463,
FT                   1677545..1677640,1678841..1678941,1679032..1679113,
FT                   1679402..1679466,1680029..1680104,1680371..>1680424))
FT                   /locus_tag="mCG_144941"
FT                   /product="mCG144941"
FT                   /note="gene_id=mCG144941.0 transcript_id=mCT184365.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1675473..1675562,1677353..1677463,
FT                   1677545..1677640,1678841..1678941,1679032..1679113,
FT                   1679402..1679466,1680029..1680104,1680371..>1680424))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144941"
FT                   /product="mCG144941"
FT                   /note="gene_id=mCG144941.0 transcript_id=mCT184365.0
FT                   protein_id=mCP105316.0"
FT                   /protein_id="EDL01933.1"
FT                   /translation="DHSISAMPMTLGYWNTRGLTHSIRLLLEYTDSSYEEKRYVMGDAP
FT                   NFDRSQWLSEKFNLGLDFPNLPYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVD
FT                   TLENQVMDTRIQLMIVCCSPDFEKQKPEFLKAIPEKMKLYSEFLGKRPWFAGDKVTYVD
FT                   FLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRFLPRPVFTKIAQWG
FT                   TD"
FT   gene            1690851..1691220
FT                   /locus_tag="mCG_4046"
FT                   /note="gene_id=mCG4046.0"
FT   mRNA            1690851..1691220
FT                   /locus_tag="mCG_4046"
FT                   /product="mCG4046"
FT                   /note="gene_id=mCG4046.0 transcript_id=mCT1666.0 created on
FT                   22-MAY-2002"
FT   CDS             1690898..1691137
FT                   /codon_start=1
FT                   /locus_tag="mCG_4046"
FT                   /product="mCG4046"
FT                   /note="gene_id=mCG4046.0 transcript_id=mCT1666.0
FT                   protein_id=mCP19743.1"
FT                   /protein_id="EDL01934.1"
FT                   /translation="MPVAVGPYRQSQPSCFDCVKMGFVMGCAVGMAAGVLFRTFSCLRI
FT                   GMRGWELMGSIGKTMVQSSSTFGTFMAIGMGIRC"
FT   gene            complement(1692965..>1697663)
FT                   /locus_tag="mCG_4061"
FT                   /note="gene_id=mCG4061.1"
FT   mRNA            complement(join(1692965..1693404,1695202..1695312,
FT                   1695395..1695490,1696315..1696415,1696513..1696594,
FT                   1696884..1696948,1697300..1697375,1697624..>1697663))
FT                   /locus_tag="mCG_4061"
FT                   /product="mCG4061"
FT                   /note="gene_id=mCG4061.1 transcript_id=mCT1646.0 created on
FT                   22-MAY-2002"
FT   CDS             complement(join(1693315..1693404,1695202..1695312,
FT                   1695395..1695490,1696315..1696415,1696513..1696594,
FT                   1696884..1696948,1697300..1697375,1697624..>1697662))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4061"
FT                   /product="mCG4061"
FT                   /note="gene_id=mCG4061.1 transcript_id=mCT1646.0
FT                   protein_id=mCP19768.0"
FT                   /protein_id="EDL01935.1"
FT                   /translation="TMPMTLGYWDIRGLAHAIRLLLEYTDTSYEDKKYTMGDAPDYDRS
FT                   QWLSEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHNLCGETEEERIRVDILENQ
FT                   AMDTRIQLAMVCYSPDFEKKKPEYLEGLPEKMKLYSEFLGKQPWFAGNKVTYVDFLVYD
FT                   VLDQHRIFEPKCLDAFPNLKDFMGRFEGLKKISDYMKSSRFLSKPIFAKMAFWNPK"
FT   assembly_gap    1698943..1703242
FT                   /estimated_length=4300
FT                   /gap_type="unknown"
FT   gene            complement(1724018..>1729736)
FT                   /locus_tag="mCG_131602"
FT                   /note="gene_id=mCG131602.0"
FT   mRNA            complement(join(1724018..1724538,1726514..1726624,
FT                   1726706..1726801,1728089..1728189,1728280..1728361,
FT                   1728645..1728709,1729112..1729187,1729501..>1729736))
FT                   /locus_tag="mCG_131602"
FT                   /product="mCG131602, transcript variant mCT132939"
FT                   /note="gene_id=mCG131602.0 transcript_id=mCT132939.0
FT                   created on 22-MAY-2002"
FT   mRNA            complement(join(1724434..1724538,1726514..1726624,
FT                   1726706..1726801,1728089..1728189,1728280..1728361,
FT                   1728645..1728709,1729118..1729187,1729501..>1729576))
FT                   /locus_tag="mCG_131602"
FT                   /product="mCG131602, transcript variant mCT189460"
FT                   /note="gene_id=mCG131602.0 transcript_id=mCT189460.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(1724446..1724538,1726514..1726624,
FT                   1726706..1726879,1728089..1728189,1728280..1728361,
FT                   1728645..1728709,1729112..1729187,1729501..>1729551))
FT                   /locus_tag="mCG_131602"
FT                   /product="mCG131602, transcript variant mCT189459"
FT                   /note="gene_id=mCG131602.0 transcript_id=mCT189459.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(1724449..1724538,1726514..1726624,
FT                   1726706..1726801,1728089..1728189,1728280..1728361,
FT                   1728645..1728709,1729118..1729187,1729501..>1729557))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131602"
FT                   /product="mCG131602, isoform CRA_b"
FT                   /note="gene_id=mCG131602.0 transcript_id=mCT189460.0
FT                   protein_id=mCP110452.0 isoform=CRA_b"
FT                   /protein_id="EDL01937.1"
FT                   /translation="EDHSTSTMPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMAPD
FT                   FDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADI
FT                   VENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDF
FT                   LAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSN
FT                   K"
FT   CDS             complement(join(1724449..1724538,1726514..1726624,
FT                   1726706..1726801,1728089..1728189,1728280..1728361,
FT                   1728645..1728709,1729112..1729187,1729501..>1729557))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131602"
FT                   /product="mCG131602, isoform CRA_c"
FT                   /note="gene_id=mCG131602.0 transcript_id=mCT132939.0
FT                   protein_id=mCP60204.0 isoform=CRA_c"
FT                   /protein_id="EDL01938.1"
FT                   /translation="EDHSTSTMPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDA
FT                   PDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRA
FT                   DIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYV
FT                   DFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHW
FT                   SNK"
FT   CDS             complement(join(1724449..1724538,1726514..1726624,
FT                   1726706..1726879,1728089..1728189,1728280..1728361,
FT                   1728645..1728709,1729112..1729187,1729501..>1729551))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131602"
FT                   /product="mCG131602, isoform CRA_a"
FT                   /note="gene_id=mCG131602.0 transcript_id=mCT189459.0
FT                   protein_id=mCP110451.0 isoform=CRA_a"
FT                   /protein_id="EDL01936.1"
FT                   /translation="HSTSTMPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPD
FT                   FDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADI
FT                   VENQVMDTRMQLIMLCYNPDFVAVPLPNPLLGSLSLKVVTASCSLPQEKQKPEFLKTIP
FT                   EKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGL
FT                   KKISAYMKSSRYIATPIFSKMAHWSNK"
FT   gene            complement(1730055..>1737023)
FT                   /locus_tag="mCG_144524"
FT                   /note="gene_id=mCG144524.0"
FT   mRNA            complement(join(1730055..1732023,1732834..1732899,
FT                   1733252..1733351,1735976..1736148,1736873..>1737023))
FT                   /locus_tag="mCG_144524"
FT                   /product="mCG144524"
FT                   /note="gene_id=mCG144524.0 transcript_id=mCT183948.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1731697..1732023,1732834..>1732866))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144524"
FT                   /product="mCG144524"
FT                   /note="gene_id=mCG144524.0 transcript_id=mCT183948.0
FT                   protein_id=mCP105314.0"
FT                   /protein_id="EDL01939.1"
FT                   /translation="GPGIPFPGWWQAPQFLQDDFDAVGVLPLCQHCRGSRIHHSIRTAH
FT                   AAHIDSCYKFYRQGCLWVLRPTLYLKAVYSVFIDCSWRPNYHACPSCKCHALVVLQTPA
FT                   NCAIAYSFLSFFQFF"
FT   assembly_gap    1734859..1734878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1752183..>1756633)
FT                   /locus_tag="mCG_144942"
FT                   /note="gene_id=mCG144942.1"
FT   mRNA            complement(join(1752183..1753098,1753909..1754019,
FT                   1754100..1754195,1755097..1755197,1755293..1755374,
FT                   1755668..1755732,1756126..1756201,1756410..>1756561))
FT                   /locus_tag="mCG_144942"
FT                   /product="mCG144942, transcript variant mCT184366"
FT                   /note="gene_id=mCG144942.1 transcript_id=mCT184366.0
FT                   created on 05-JUN-2003"
FT   mRNA            complement(join(1752184..1753098,1753909..1754019,
FT                   1754100..1754195,1755097..1755197,1755293..1755374,
FT                   1755668..1755732,1756126..1756201,1756618..>1756633))
FT                   /locus_tag="mCG_144942"
FT                   /product="mCG144942, transcript variant mCT189465"
FT                   /note="gene_id=mCG144942.1 transcript_id=mCT189465.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(1753009..1753098,1753909..1754019,
FT                   1754100..1754195,1755097..1755197,1755293..1755374,
FT                   1755668..1755732,1756126..1756201,1756618..>1756632))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144942"
FT                   /product="mCG144942, isoform CRA_b"
FT                   /note="gene_id=mCG144942.1 transcript_id=mCT189465.0
FT                   protein_id=mCP110456.0 isoform=CRA_b"
FT                   /protein_id="EDL01941.1"
FT                   /translation="SNLASLAHAIRLLLEYTGSSYEEKRYTMGDAPDYDRSQWLSEKFK
FT                   LGLDFPNLPYLIDGSHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQAMDVSNQL
FT                   ARVCYSPDFEKLKVEYLEQLPGMVKLFSQFLGQRTWFVGEKITFVDFLAYDILDLHLIF
FT                   EPTCLDAFPNLKDFVARFEVLKRISAYMKTSRFLRTPLYTKVATWGNK"
FT   CDS             complement(join(1753009..1753098,1753909..1754019,
FT                   1754100..1754195,1755097..1755197,1755293..1755374,
FT                   1755668..1755732,1756126..1756201,1756410..>1756499))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144942"
FT                   /product="mCG144942, isoform CRA_a"
FT                   /note="gene_id=mCG144942.1 transcript_id=mCT184366.0
FT                   protein_id=mCP105317.0 isoform=CRA_a"
FT                   /protein_id="EDL01940.1"
FT                   /translation="SQSCSHRRPVDSVSGTSIMPMTLGYWDIRGLAHAIRLLLEYTGSS
FT                   YEEKRYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGSHKITQSNAILRYIARKHNL
FT                   CGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKVEYLEQLPGMVKLFSQFLGQR
FT                   TWFVGEKITFVDFLAYDILDLHLIFEPTCLDAFPNLKDFVARFEVLKRISAYMKTSRFL
FT                   RTPLYTKVATWGNK"
FT   assembly_gap    1772427..1772603
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    1778529..1779044
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   gene            complement(1785821..1797329)
FT                   /gene="Ampd2"
FT                   /locus_tag="mCG_4058"
FT                   /note="gene_id=mCG4058.2"
FT   mRNA            complement(join(1785821..1786885,1787013..1787123,
FT                   1787295..1787468,1787735..1787855,1788122..1788285,
FT                   1788377..1788503,1788783..1788946,1789096..1789227,
FT                   1789318..1789512,1790446..1790575,1790753..1790842,
FT                   1790951..1791092,1791353..1791539,1791829..1791940,
FT                   1792033..1792101,1792410..1792540,1792767..1792897,
FT                   1797013..1797329))
FT                   /gene="Ampd2"
FT                   /locus_tag="mCG_4058"
FT                   /product="adenosine monophosphate deaminase 2 (isoform L),
FT                   transcript variant mCT1653"
FT                   /note="gene_id=mCG4058.2 transcript_id=mCT1653.2 created on
FT                   22-MAY-2002"
FT   mRNA            complement(join(1785851..1786885,1787013..1787123,
FT                   1787262..1787468,1787735..1787855,1788122..1788285,
FT                   1788377..1788503,1788783..1788946,1789096..1789227,
FT                   1789318..1789512,1790446..1790575,1790753..1790842,
FT                   1790951..1791092,1791353..1791539,1791829..1791940,
FT                   1792033..1792101,1792410..1792540,1792767..1792897,
FT                   1797013..>1797165))
FT                   /gene="Ampd2"
FT                   /locus_tag="mCG_4058"
FT                   /product="adenosine monophosphate deaminase 2 (isoform L),
FT                   transcript variant mCT189452"
FT                   /note="gene_id=mCG4058.2 transcript_id=mCT189452.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(1786064..1786885,1787013..1787123,
FT                   1787295..1787468,1787735..1787855,1788122..1788285,
FT                   1788377..1788503,1788783..1788946,1789096..1789227,
FT                   1789318..1789512,1790446..1790575,1790753..1790842,
FT                   1790951..1791092,1791353..1791539,1791829..1791940,
FT                   1792033..1792101,1792410..1792540,1792767..1792897,
FT                   1794090..1794155))
FT                   /gene="Ampd2"
FT                   /locus_tag="mCG_4058"
FT                   /product="adenosine monophosphate deaminase 2 (isoform L),
FT                   transcript variant mCT169296"
FT                   /note="gene_id=mCG4058.2 transcript_id=mCT169296.0 created
FT                   on 22-MAY-2002"
FT   CDS             complement(join(1786679..1786885,1787013..1787123,
FT                   1787262..1787468,1787735..1787855,1788122..1788285,
FT                   1788377..1788503,1788783..1788946,1789096..1789227,
FT                   1789318..1789512,1790446..1790575,1790753..1790842,
FT                   1790951..1791092,1791353..1791539,1791829..1791940,
FT                   1792033..1792101,1792410..1792540,1792767..1792897,
FT                   1797013..>1797130))
FT                   /codon_start=1
FT                   /gene="Ampd2"
FT                   /locus_tag="mCG_4058"
FT                   /product="adenosine monophosphate deaminase 2 (isoform L),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG4058.2 transcript_id=mCT189452.0
FT                   protein_id=mCP110447.0 isoform=CRA_c"
FT                   /protein_id="EDL01944.1"
FT                   /translation="GSSAVALAPAMASYPGPGKSKAKYPFKKRAGLQASAAAPEARSGL
FT                   GASPLQSARSLPGNAPCLKHFPLDLRTSMDGKCKEIAEELFSRSLAESELRSAPYEFPE
FT                   ESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRG
FT                   LWERDVVLEREFQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
FT                   RRYLQQLAEKPLETRTYEQSPDTPVSADAPVHPPALEQHPYEHCEPSAMPGDLGLGLRM
FT                   VRGVVHVYTRRDPDEHCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSS
FT                   KFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLE
FT                   EIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVL
FT                   REIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNH
FT                   KVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEH
FT                   VDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGF
FT                   HTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNN
FT                   SLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKVRPRPAGSQGQEPLMEEYSIATQV
FT                   WKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYE
FT                   TLCQELALITQAVQSEMLETIPEEVGIVMSPGP"
FT   CDS             complement(join(1786679..1786885,1787013..1787123,
FT                   1787295..1787468,1787735..1787855,1788122..1788285,
FT                   1788377..1788503,1788783..1788946,1789096..1789227,
FT                   1789318..1789512,1790446..1790575,1790753..1790842,
FT                   1790951..1791092,1791353..1791539,1791829..1791940,
FT                   1792033..1792101,1792410..1792540,1792767..1792897,
FT                   1797013..1797100))
FT                   /codon_start=1
FT                   /gene="Ampd2"
FT                   /locus_tag="mCG_4058"
FT                   /product="adenosine monophosphate deaminase 2 (isoform L),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG4058.2 transcript_id=mCT1653.2
FT                   protein_id=mCP19773.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2AE27"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR029749"
FT                   /db_xref="MGI:MGI:88016"
FT                   /db_xref="UniProtKB/TrEMBL:A2AE27"
FT                   /protein_id="EDL01942.1"
FT                   /translation="MASYPGPGKSKAKYPFKKRAGLQASAAAPEARSGLGASPLQSARS
FT                   LPGNAPCLKHFPLDLRTSMDGKCKEIAEELFSRSLAESELRSAPYEFPEESPIEQLEER
FT                   RQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRGLWERDVVLER
FT                   EFQRVIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEK
FT                   PLETRTYEQSPDTPVSADAPVHPPALEQHPYEHCEPSAMPGDLGLGLRMVRGVVHVYTR
FT                   RDPDEHCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNE
FT                   MKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGRE
FT                   QTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNK
FT                   ISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWL
FT                   VQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDE
FT                   SKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCG
FT                   EAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNP
FT                   LPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGF
FT                   SHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETI
FT                   PEEVGIVMSPGP"
FT   CDS             complement(join(1786679..1786885,1787013..1787123,
FT                   1787295..1787468,1787735..1787855,1788122..1788285,
FT                   1788377..1788503,1788783..1788946,1789096..1789227,
FT                   1789318..1789512,1790446..1790575,1790753..1790842,
FT                   1790951..1791092,1791353..1791539,1791829..1791940,
FT                   1792033..1792101,1792410..1792540,1792767..1792796))
FT                   /codon_start=1
FT                   /gene="Ampd2"
FT                   /locus_tag="mCG_4058"
FT                   /product="adenosine monophosphate deaminase 2 (isoform L),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG4058.2 transcript_id=mCT169296.0
FT                   protein_id=mCP92158.0 isoform=CRA_b"
FT                   /protein_id="EDL01943.1"
FT                   /translation="MDGKCKEIAEELFSRSLAESELRSAPYEFPEESPIEQLEERRQRL
FT                   ERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRGLWERDVVLEREFQR
FT                   VIISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLET
FT                   RTYEQSPDTPVSADAPVHPPALEQHPYEHCEPSAMPGDLGLGLRMVRGVVHVYTRRDPD
FT                   EHCPEVELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKEL
FT                   AAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLR
FT                   EVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGK
FT                   YFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVP
FT                   RLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPE
FT                   NHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGP
FT                   IHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEY
FT                   LSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKV
FT                   KSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELALITQAVQSEMLETIPEEV
FT                   GIVMSPGP"
FT   gene            1797741..1799775
FT                   /locus_tag="mCG_147019"
FT                   /note="gene_id=mCG147019.0"
FT   mRNA            1797741..1799775
FT                   /locus_tag="mCG_147019"
FT                   /product="mCG147019"
FT                   /note="gene_id=mCG147019.0 transcript_id=mCT187282.0
FT                   created on 13-JAN-2004"
FT   CDS             1797992..1798609
FT                   /codon_start=1
FT                   /locus_tag="mCG_147019"
FT                   /product="mCG147019"
FT                   /note="gene_id=mCG147019.0 transcript_id=mCT187282.0
FT                   protein_id=mCP108939.0"
FT                   /db_xref="GOA:Q8BUP2"
FT                   /db_xref="MGI:MGI:3650304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BUP2"
FT                   /protein_id="EDL01945.1"
FT                   /translation="MLPKSRVDQEGSLRKSAQRGSRAEEGRGPPPGRSRATGPCTRTEK
FT                   REGRQGFQNGQLAGGRTPADFSGQTDLRRPRSRDPKPALKRKQATCSPENRTRNSPRVL
FT                   SPLSGNQLGIRLLWPGYGGVTQQVRPRRNLPGCAPISRTPGPAKSAATPRSATPLGLLA
FT                   TPQPFSQFPYATWAASGPGLALAWPFGLGRFLCVSFLISKMG"
FT   assembly_gap    1801114..1801380
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   gene            <1805061..1813271
FT                   /locus_tag="mCG_4057"
FT                   /note="gene_id=mCG4057.2"
FT   mRNA            join(<1805061..1805086,1805187..1805359,1807134..1807176,
FT                   1807432..1807573,1808343..1808500,1809962..1810090,
FT                   1810306..1810435,1811983..1812136,1812608..1813271)
FT                   /locus_tag="mCG_4057"
FT                   /product="mCG4057, transcript variant mCT189468"
FT                   /note="gene_id=mCG4057.2 transcript_id=mCT189468.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<1805112..1805359,1807134..1807176,1807432..1807573,
FT                   1808343..1808500,1809962..1810090,1810306..1810435,
FT                   1811983..1812136,1812608..1813271)
FT                   /locus_tag="mCG_4057"
FT                   /product="mCG4057, transcript variant mCT1655"
FT                   /note="gene_id=mCG4057.2 transcript_id=mCT1655.1 created on
FT                   22-MAY-2002"
FT   CDS             join(<1805191..1805359,1807134..1807176,1807432..1807573,
FT                   1808343..1808500,1809962..1810090,1810306..1810435,
FT                   1811983..1812136,1812608..1812798)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4057"
FT                   /product="mCG4057, isoform CRA_b"
FT                   /note="gene_id=mCG4057.2 transcript_id=mCT189468.0
FT                   protein_id=mCP110446.0 isoform=CRA_b"
FT                   /protein_id="EDL01947.1"
FT                   /translation="EKFKSQRERPFSEETAEMGSGISAEDKELARRSKELEKKLQEDAD
FT                   KEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKSVIYGNVLQSILAIIRA
FT                   MSTLGIDYAEPSCADAGRQLNNLADSTEEGTMPPELVDVIRKLWKDGGVQACFDRAAEF
FT                   QLNDSASYYLNQLDRITDPNYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQR
FT                   SERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSI
FT                   VLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHM
FT                   TCATDTQNVKFVFDAVTDIIIKENLKDCGLF"
FT   CDS             join(<1805239..1805359,1807134..1807176,1807432..1807573,
FT                   1808343..1808500,1809962..1810090,1810306..1810435,
FT                   1811983..1812136,1812608..1812798)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4057"
FT                   /product="mCG4057, isoform CRA_a"
FT                   /note="gene_id=mCG4057.2 transcript_id=mCT1655.1
FT                   protein_id=mCP19764.1 isoform=CRA_a"
FT                   /protein_id="EDL01946.1"
FT                   /translation="EMGSGISAEDKELARRSKELEKKLQEDADKEAKTVKLLLLGAGES
FT                   GKSTIVKQMKIIHQDGYSPEECLEFKSVIYGNVLQSILAIIRAMSTLGIDYAEPSCADA
FT                   GRQLNNLADSTEEGTMPPELVDVIRKLWKDGGVQACFDRAAEFQLNDSASYYLNQLDRI
FT                   TDPNYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCI
FT                   IFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKK
FT                   VHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAV
FT                   TDIIIKENLKDCGLF"
FT   gene            complement(1819275..>1858161)
FT                   /gene="Gnai3"
FT                   /locus_tag="mCG_4069"
FT                   /note="gene_id=mCG4069.1"
FT   mRNA            complement(join(1819275..1821311,1821398..1821607,
FT                   1823930..1824083,1824468..1824597,1827778..1827906,
FT                   1830316..1830473,1835557..1835698,1835810..1835852,
FT                   1857904..>1858161))
FT                   /gene="Gnai3"
FT                   /locus_tag="mCG_4069"
FT                   /product="guanine nucleotide binding protein, alpha
FT                   inhibiting 3, transcript variant mCT1643"
FT                   /note="gene_id=mCG4069.1 transcript_id=mCT1643.1 created on
FT                   22-MAY-2002"
FT   mRNA            complement(join(1819275..1821311,1821398..1821607,
FT                   1823930..1824083,1824468..1824597,1827778..1827906,
FT                   1830316..1830473,1835557..1835698,1835810..1835852,
FT                   1858087..1858125))
FT                   /gene="Gnai3"
FT                   /locus_tag="mCG_4069"
FT                   /product="guanine nucleotide binding protein, alpha
FT                   inhibiting 3, transcript variant mCT169297"
FT                   /note="gene_id=mCG4069.1 transcript_id=mCT169297.0 created
FT                   on 22-MAY-2002"
FT   CDS             complement(join(1821417..1821607,1823930..1824083,
FT                   1824468..1824597,1827778..1827906,1830316..1830473,
FT                   1835557..1835698,1835810..1835852,1857904..>1858057))
FT                   /codon_start=1
FT                   /gene="Gnai3"
FT                   /locus_tag="mCG_4069"
FT                   /product="guanine nucleotide binding protein, alpha
FT                   inhibiting 3, isoform CRA_a"
FT                   /note="gene_id=mCG4069.1 transcript_id=mCT1643.1
FT                   protein_id=mCP19789.1 isoform=CRA_a"
FT                   /protein_id="EDL01948.1"
FT                   /translation="VSPGPVPSPAAAMGCTLSAEDKAAVERSKMIDRNLREDGEKAAKE
FT                   VKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLK
FT                   IDFGESARADDARQLFVLAGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDS
FT                   ASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKK
FT                   WIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLN
FT                   KKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATD
FT                   TKNVQFVFDAVTDVIIKNNLKECGLY"
FT   CDS             complement(join(1821417..1821607,1823930..1824083,
FT                   1824468..1824597,1827778..1827906,1830316..1830473,
FT                   1835557..1835698,1835810..1835814))
FT                   /codon_start=1
FT                   /gene="Gnai3"
FT                   /locus_tag="mCG_4069"
FT                   /product="guanine nucleotide binding protein, alpha
FT                   inhibiting 3, isoform CRA_b"
FT                   /note="gene_id=mCG4069.1 transcript_id=mCT169297.0
FT                   protein_id=mCP92153.0 isoform=CRA_b"
FT                   /protein_id="EDL01949.1"
FT                   /translation="MKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGE
FT                   SARADDARQLFVLAGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYL
FT                   NDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCF
FT                   EGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLF
FT                   EEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQ
FT                   FVFDAVTDVIIKNNLKECGLY"
FT   assembly_gap    1825390..1825409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1860676..1861931)
FT                   /locus_tag="mCG_1026317"
FT                   /note="gene_id=mCG1026317.0"
FT   mRNA            complement(join(1860676..1861188,1861768..1861931))
FT                   /locus_tag="mCG_1026317"
FT                   /product="mCG1026317"
FT                   /note="gene_id=mCG1026317.0 transcript_id=mCT144021.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(join(1861073..1861188,1861768..1861870))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026317"
FT                   /product="mCG1026317"
FT                   /note="gene_id=mCG1026317.0 transcript_id=mCT144021.0
FT                   protein_id=mCP60170.1"
FT                   /protein_id="EDL01950.1"
FT                   /translation="MDMWQKALDLAGIFDYWGREPGYGETLMREKGDKGLASPIYLLMA
FT                   VTHFQPPGHSGTRDSGRAREGWGFHCP"
FT   gene            complement(<1862010..1866900)
FT                   /gene="Gpr61"
FT                   /locus_tag="mCG_55678"
FT                   /note="gene_id=mCG55678.1"
FT   mRNA            complement(join(<1862010..1863959,1866836..1866900))
FT                   /gene="Gpr61"
FT                   /locus_tag="mCG_55678"
FT                   /product="G protein-coupled receptor 61"
FT                   /note="gene_id=mCG55678.1 transcript_id=mCT55861.1 created
FT                   on 23-MAY-2002"
FT   CDS             complement(1862010..1863359)
FT                   /codon_start=1
FT                   /gene="Gpr61"
FT                   /locus_tag="mCG_55678"
FT                   /product="G protein-coupled receptor 61"
FT                   /note="gene_id=mCG55678.1 transcript_id=mCT55861.1
FT                   protein_id=mCP39948.2"
FT                   /db_xref="GOA:Q8C010"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441719"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C010"
FT                   /protein_id="EDL01951.1"
FT                   /translation="MESSPIPQSSGNSSTLGRALQTPGPSTASGVPELGLRDVASESVA
FT                   LFFMLLLDLTAVAGNAAVMAVIAKTPALRKFVFVFHLCLVDLLAALTLMPLAMLSSSAL
FT                   FDHALFGEVACRLYLFLSVCFVSLAILSVSAINVERYYYVVHPMRYEVRMTLGLVASVL
FT                   VGVWVKALAMASVPVLGRVYWEEGAPSVNPGCSLQWSHSAYCQLFVVVFAVLYFLLPLI
FT                   LIFVVYCSMFRVARVAAMQHGPLPTWMETPRQRSESLSSRSTMVTSSGAHQTTPHRTFG
FT                   GGKAAVVLLAVGGQFLLCWLPYFSFHLYVALSAQPISAGQVENVVTWIGYFCFTSNPFF
FT                   YGCLNRQIRGELSKQFVCFFKAAPEEELRLPSREGSIEENFLQFLQGTSENWVSRPLPS
FT                   PKREPPPVVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLRPAPSPRLES"
FT   assembly_gap    1868060..1868306
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    1878556..1878833
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   gene            1878871..1897951
FT                   /locus_tag="mCG_147018"
FT                   /note="gene_id=mCG147018.0"
FT   mRNA            join(1878871..1879035,1896896..1897951)
FT                   /locus_tag="mCG_147018"
FT                   /product="mCG147018"
FT                   /note="gene_id=mCG147018.0 transcript_id=mCT187281.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    1889716..1889735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             1897214..1897375
FT                   /codon_start=1
FT                   /locus_tag="mCG_147018"
FT                   /product="mCG147018"
FT                   /note="gene_id=mCG147018.0 transcript_id=mCT187281.0
FT                   protein_id=mCP108938.0"
FT                   /protein_id="EDL01952.1"
FT                   /translation="MPGLNRKEEKKKSFQIMHKFNVLIPLEEIIQSLKFTVKHGRDLAF
FT                   FFFKLLAS"
FT   assembly_gap    1898621..1898640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1899073..1903749
FT                   /locus_tag="mCG_51791"
FT                   /note="gene_id=mCG51791.1"
FT   mRNA            join(1899073..1900685,1903656..1903749)
FT                   /locus_tag="mCG_51791"
FT                   /product="mCG51791"
FT                   /note="gene_id=mCG51791.1 transcript_id=mCT51974.1 created
FT                   on 23-MAY-2002"
FT   CDS             1899169..1900647
FT                   /codon_start=1
FT                   /locus_tag="mCG_51791"
FT                   /product="mCG51791"
FT                   /note="gene_id=mCG51791.1 transcript_id=mCT51974.1
FT                   protein_id=mCP39954.0"
FT                   /protein_id="EDL01953.1"
FT                   /translation="MQPQRDLRGLWLLLLSVFLLLFEVARAGRSVVSCPANCLCASNIL
FT                   SCSKQQLPNVPQSLPSYTALLDLSHNNLSRLRAEWTPTRLTNLHSLLLSHNHLNFISSE
FT                   AFVPVPNLRYLDLSSNHLHTLDEFLFSDLQALEVLLLYNNHIVVVDRNAFEDMAQLQKL
FT                   YLSQNQISRFPVELIKDGNKLPKLMLLDLSSNKLKKLPLTDLQKLPAWVKNGLYLHNNP
FT                   LECDCKLYQLFSHWQYRQLSSVMDFQEDLYCMHSKKLHNIFSLDFFNCSEYKESAWEAH
FT                   LGDTLTIRCDTKQQGMTKVWVSPSNEQVLSQGSNGSVSVRNGDLFFKKVQVEDGGVYTC
FT                   YAMGETFNETLSVELKVYNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWC
FT                   RGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKP
FT                   GNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV"
FT   assembly_gap    1906286..1906305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1907672..>1913157)
FT                   /locus_tag="mCG_131613"
FT                   /note="gene_id=mCG131613.2"
FT   mRNA            complement(join(1907672..1911660,1912070..1912107,
FT                   1912572..1912677))
FT                   /locus_tag="mCG_131613"
FT                   /product="mCG131613, transcript variant mCT132950"
FT                   /note="gene_id=mCG131613.2 transcript_id=mCT132950.1
FT                   created on 23-MAY-2002"
FT   mRNA            complement(join(1907724..1911660,1912070..1912215,
FT                   1912572..>1913157))
FT                   /locus_tag="mCG_131613"
FT                   /product="mCG131613, transcript variant mCT189470"
FT                   /note="gene_id=mCG131613.2 transcript_id=mCT189470.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(1907724..1911660,1912070..1912107,
FT                   1912705..>1912754))
FT                   /locus_tag="mCG_131613"
FT                   /product="mCG131613, transcript variant mCT189469"
FT                   /note="gene_id=mCG131613.2 transcript_id=mCT189469.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(1911157..1911660,1912070..1912107,
FT                   1912705..>1912753))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131613"
FT                   /product="mCG131613, isoform CRA_b"
FT                   /note="gene_id=mCG131613.2 transcript_id=mCT189469.0
FT                   protein_id=mCP110453.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6PAS2"
FT                   /db_xref="InterPro:IPR004877"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="MGI:MGI:1919273"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PAS2"
FT                   /protein_id="EDL01955.1"
FT                   /translation="VAGLCRPAWHCYAFHGGLFSWHPVFMALAFCLCMAEAILLFSPEH
FT                   SLFFFCSRKTRIRLHWAGQTMAILCAVLGLGFIISSKIRSEMSHLVSWHSWIGALTLLA
FT                   TGGQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVTVLLGMYSVWFQAQIKG
FT                   TAWYLCLGLPLYPALVIMHQISSSYLPRKKVEI"
FT   CDS             complement(join(1911157..1911660,1912070..>1912204))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131613"
FT                   /product="mCG131613, isoform CRA_c"
FT                   /note="gene_id=mCG131613.2 transcript_id=mCT189470.0
FT                   protein_id=mCP110454.0 isoform=CRA_c"
FT                   /protein_id="EDL01956.1"
FT                   /translation="YADLVARSLSFTNHGTVSVKPSRQPILFDSYLGLFSWHPVFMALA
FT                   FCLCMAEAILLFSPEHSLFFFCSRKTRIRLHWAGQTMAILCAVLGLGFIISSKIRSEMS
FT                   HLVSWHSWIGALTLLATGGQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVT
FT                   VLLGMYSVWFQAQIKGTAWYLCLGLPLYPALVIMHQISSSYLPRKKVEI"
FT   CDS             complement(join(1911157..1911660,1912070..1912081))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131613"
FT                   /product="mCG131613, isoform CRA_a"
FT                   /note="gene_id=mCG131613.2 transcript_id=mCT132950.1
FT                   protein_id=mCP60151.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TPE5"
FT                   /db_xref="InterPro:IPR004877"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="MGI:MGI:1919273"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TPE5"
FT                   /protein_id="EDL01954.1"
FT                   /translation="MALAFCLCMAEAILLFSPEHSLFFFCSRKTRIRLHWAGQTMAILC
FT                   AVLGLGFIISSKIRSEMSHLVSWHSWIGALTLLATGGQALCGLCLLCPRAARVSRVARL
FT                   KLYHLTCGLVVYLMATVTVLLGMYSVWFQAQIKGTAWYLCLGLPLYPALVIMHQISSSY
FT                   LPRKKVEI"
FT   gene            complement(1914181..>1922934)
FT                   /gene="Atxn7l2"
FT                   /locus_tag="mCG_140377"
FT                   /note="gene_id=mCG140377.1"
FT   mRNA            complement(join(1914181..1914321,1915196..1915991,
FT                   1916449..1916570,1916664..1916862,1917580..1917833,
FT                   1918174..1918256,1918771..1919057,1919342..1919552,
FT                   1919911..1920015,1920388..1920453,1922344..1922932))
FT                   /gene="Atxn7l2"
FT                   /locus_tag="mCG_140377"
FT                   /product="ataxin 7-like 2, transcript variant mCT169292"
FT                   /note="gene_id=mCG140377.1 transcript_id=mCT169292.0
FT                   created on 23-MAY-2002"
FT   mRNA            complement(join(1914203..1914321,1915196..1915991,
FT                   1916449..1916570,1916664..1916862,1917580..1917833,
FT                   1918174..1918256,1918771..1919057,1919342..1919552,
FT                   1919911..1920015,1920388..1920453,1920865..1921043,
FT                   1922344..>1922934))
FT                   /gene="Atxn7l2"
FT                   /locus_tag="mCG_140377"
FT                   /product="ataxin 7-like 2, transcript variant mCT189457"
FT                   /note="gene_id=mCG140377.1 transcript_id=mCT189457.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(1914307..1914321,1915196..1915991,
FT                   1916449..1916570,1916664..1916862,1917580..1917833,
FT                   1918174..1918256,1918771..1919057,1919342..1919552,
FT                   1919911..1920015,1920388..1920453,1922344..1922470))
FT                   /codon_start=1
FT                   /gene="Atxn7l2"
FT                   /locus_tag="mCG_140377"
FT                   /product="ataxin 7-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG140377.1 transcript_id=mCT169292.0
FT                   protein_id=mCP92152.0 isoform=CRA_a"
FT                   /protein_id="EDL01957.1"
FT                   /translation="MAVRERAVAAMAALERRVPSLDDFAGQSWSSWVERADLPAADGAE
FT                   LEENSKNTKKLDAMTLIKEDMSIFGHCPAHDDFYLVVCNHCSQVVKPQAFQKHCERRHG
FT                   PLSKLYARAPPPPPAPASSQKCHVVNGQGPACRAPGSTKTSSREKGQGSRSRGHQPPEK
FT                   TQKDSLCLFVPVVNLEKISSLPKPDAHGVRVAPPSALLSQPGGLPKDSPGKVPTAPSPK
FT                   EPPGRENIELVPGEGSSHRAEGSPPEKEASGARLPPKTHRKMARKEFDLNRQCGVINPE
FT                   TKKICTRLLTCKIHSVHQRREVPGRAKDFDVLVAELKASSRKGESPKEKSPAHKEPALE
FT                   RPSQEPPTAVQGVAAVAAPNTTFSSLSKQTYPYCALPRSHASSESEVDDEGPCGGDGDP
FT                   GLFPFPLPRGGAQASSEESEEEGISDDLHLSPDCHYATRPPRPQAFCTFGSRLVSPGCY
FT                   VFSRRLDRFCSALSSMLERHLSSHMWKKIPPAAEPPSHLVSPSLSDPLSPSPMGSCPRL
FT                   PGPAPRPACPASIPPVKDSLVPSYPAGSPSVAAACSQAECMGGSQAITSPLPANTPSPS
FT                   FSKLPPSKASKSSKGKEGVEMEAPSRKRKLSPGPTTFKRTCILEPAGKGKPSSCRGLST
FT                   KTKTALNLGLNGTVGPRVKRAGPLDCRGSPHPSPIPVKASQLENRGVAGHPAKVLPTTC
FT                   LSEEEVAKKRKNLATYCRPVKAKHCQAGVPPDGTCSVRRKKPGPALPFEEKCSTLKSKA
FT                   H"
FT   CDS             complement(join(1914307..1914321,1915196..1915991,
FT                   1916449..1916570,1916664..1916862,1917580..1917833,
FT                   1918174..1918256,1918771..1919057,1919342..1919552,
FT                   1919911..1920015,1920388..1920453,1920865..>1920871))
FT                   /codon_start=1
FT                   /gene="Atxn7l2"
FT                   /locus_tag="mCG_140377"
FT                   /product="ataxin 7-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG140377.1 transcript_id=mCT189457.0
FT                   protein_id=mCP110455.0 isoform=CRA_b"
FT                   /protein_id="EDL01958.1"
FT                   /translation="YYGAELEENSKNTKKLDAMTLIKEDMSIFGHCPAHDDFYLVVCNH
FT                   CSQVVKPQAFQKHCERRHGPLSKLYARAPPPPPAPASSQKCHVVNGQGPACRAPGSTKT
FT                   SSREKGQGSRSRGHQPPEKTQKDSLCLFVPVVNLEKISSLPKPDAHGVRVAPPSALLSQ
FT                   PGGLPKDSPGKVPTAPSPKEPPGRENIELVPGEGSSHRAEGSPPEKEASGARLPPKTHR
FT                   KMARKEFDLNRQCGVINPETKKICTRLLTCKIHSVHQRREVPGRAKDFDVLVAELKASS
FT                   RKGESPKEKSPAHKEPALERPSQEPPTAVQGVAAVAAPNTTFSSLSKQTYPYCALPRSH
FT                   ASSESEVDDEGPCGGDGDPGLFPFPLPRGGAQASSEESEEEGISDDLHLSPDCHYATRP
FT                   PRPQAFCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSSHMWKKIPPAAEPPSHLV
FT                   SPSLSDPLSPSPMGSCPRLPGPAPRPACPASIPPVKDSLVPSYPAGSPSVAAACSQAEC
FT                   MGGSQAITSPLPANTPSPSFSKLPPSKASKSSKGKEGVEMEAPSRKRKLSPGPTTFKRT
FT                   CILEPAGKGKPSSCRGLSTKTKTALNLGLNGTVGPRVKRAGPLDCRGSPHPSPIPVKAS
FT                   QLENRGVAGHPAKVLPTTCLSEEEVAKKRKNLATYCRPVKAKHCQAGVPPDGTCSVRRK
FT                   KPGPALPFEEKCSTLKSKAH"
FT   assembly_gap    1921941..1922131
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            complement(1924265..1938594)
FT                   /gene="Sypl2"
FT                   /locus_tag="mCG_4053"
FT                   /note="gene_id=mCG4053.1"
FT   mRNA            complement(join(1924265..1926681,1928576..1928767,
FT                   1929587..1929788,1931040..1931164,1938118..1938192,
FT                   1938359..1938594))
FT                   /gene="Sypl2"
FT                   /locus_tag="mCG_4053"
FT                   /product="synaptophysin-like 2"
FT                   /note="gene_id=mCG4053.1 transcript_id=mCT1658.1 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(1926535..1926681,1928576..1928767,
FT                   1929587..1929788,1931040..1931164,1938118..1938192,
FT                   1938359..1938412))
FT                   /codon_start=1
FT                   /gene="Sypl2"
FT                   /locus_tag="mCG_4053"
FT                   /product="synaptophysin-like 2"
FT                   /note="gene_id=mCG4053.1 transcript_id=mCT1658.1
FT                   protein_id=mCP19763.2"
FT                   /protein_id="EDL01959.1"
FT                   /translation="MSSTESPGRTSDKSPRQQVDRLLLGLRWQRLEEPLGFIKVLQWLF
FT                   AIFAFGSCGSYSGETGALVLCNNEAKDVSSIIVLFGYPFRLYQVQYEMPLCDQDSTSKT
FT                   MNLMGDFSAPAEFFVTLGIFSFFYTMAALVIYLRFHKLYTENKRFPLVDFCVTVSFTFF
FT                   WLVAAAAWGKGLTDVKGATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANLSVLFGFIN
FT                   FFLWAGNCWFVFKETPWHGQGQDQGQGPSQESAAEQGAVEKQ"
FT   assembly_gap    1943667..1943686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1950841..1951504)
FT                   /pseudo
FT                   /locus_tag="mCG_131603"
FT                   /note="gene_id=mCG131603.1"
FT   mRNA            complement(1950841..1951504)
FT                   /pseudo
FT                   /locus_tag="mCG_131603"
FT                   /note="gene_id=mCG131603.1 transcript_id=mCT132940.1
FT                   created on 23-MAY-2002"
FT   assembly_gap    1952215..1952347
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   gene            1968849..1991639
FT                   /locus_tag="mCG_4051"
FT                   /note="gene_id=mCG4051.2"
FT   mRNA            join(1968849..1968999,1973370..1973436,1976750..1976876,
FT                   1978117..1978184,1979477..1979584,1979717..1979775,
FT                   1980512..1980614,1984017..1984103,1991417..1991639)
FT                   /locus_tag="mCG_4051"
FT                   /product="mCG4051"
FT                   /note="gene_id=mCG4051.2 transcript_id=mCT1661.2 created on
FT                   23-MAY-2002"
FT   CDS             join(1968971..1968999,1973370..1973436,1976750..1976876,
FT                   1978117..1978184,1979477..1979584,1979717..1979775,
FT                   1980512..1980614,1984017..1984103,1991417..1991494)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4051"
FT                   /product="mCG4051"
FT                   /note="gene_id=mCG4051.2 transcript_id=mCT1661.2
FT                   protein_id=mCP19757.1"
FT                   /db_xref="GOA:Q3UPK6"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:1347009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPK6"
FT                   /protein_id="EDL01960.1"
FT                   /translation="MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEG
FT                   VCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYN
FT                   ETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFV
FT                   QCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQP
FT                   GQNFHMFTKEELEEVIKDI"
FT   assembly_gap    1971809..1971855
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    1982888..1982993
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    1990254..1990273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1995422..1996413
FT                   /estimated_length=992
FT                   /gap_type="unknown"
FT   gene            <2020161..2069140
FT                   /gene="Sort1"
FT                   /locus_tag="mCG_4048"
FT                   /note="gene_id=mCG4048.2"
FT   mRNA            join(<2020161..2020222,2021830..2021903,2036275..2036377,
FT                   2037328..2037492,2039687..2039760,2043671..2043720,
FT                   2046326..2046456,2049618..2049762,2050638..2050793,
FT                   2052426..2052532,2056681..2056783,2057541..2057709,
FT                   2058484..2058674,2060395..2060584,2063499..2063615,
FT                   2065960..2066068,2068058..2068164,2068404..2068515,
FT                   2069056..2069140)
FT                   /gene="Sort1"
FT                   /locus_tag="mCG_4048"
FT                   /product="sortilin 1"
FT                   /note="gene_id=mCG4048.2 transcript_id=mCT1668.1 created on
FT                   23-MAY-2002"
FT   CDS             join(<2020163..2020222,2021830..2021903,2036275..2036377,
FT                   2037328..2037492,2039687..2039760,2043671..2043720,
FT                   2046326..2046456,2049618..2049762,2050638..2050793,
FT                   2052426..2052532,2056681..2056783,2057541..2057709,
FT                   2058484..2058674,2060395..2060584,2063499..2063615,
FT                   2065960..2066068,2068058..2068164,2068404..2068515,
FT                   2069056..2069070)
FT                   /codon_start=1
FT                   /gene="Sort1"
FT                   /locus_tag="mCG_4048"
FT                   /product="sortilin 1"
FT                   /note="gene_id=mCG4048.2 transcript_id=mCT1668.1
FT                   protein_id=mCP19746.1"
FT                   /protein_id="EDL01961.1"
FT                   /translation="HVFDDLSGSVSLSWVGDSTGVILVLTTFQVPLVIVSFGQSKLYRS
FT                   EDYGKNFKDITNLINNTFIRTEFGMAIGPENSGKVILTAEVSGGSRGGRVFRSSDFAKN
FT                   FVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGEKWEEIHKAVCLAKWGPNN
FT                   IIFFTTHVNGSCKADLGALELWRTSDLGKTFKTIGVKIYSFGLGGRFLFASVMADKDTT
FT                   RRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANEDMVFMHVDEPGDTGFGTIFTSDDRG
FT                   IVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSTLSEDNSIQSMITFDQGGRWEHLRK
FT                   PENSKCDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVM
FT                   VPDVYISDDGGYSWAKMLEGPHYYTILDSGGIIVAIEHSNRPINVIKFSTDEGQCWQSY
FT                   VFTQEPIYFTGLASEPGARSMNISIWGFTESFITRQWVSYTVDFKDILERNCEEDDYTT
FT                   WLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSVCPCSLEDFLCDFG
FT                   YFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDKCQGGMNPAREVKDLK
FT                   KKCTSNFLNPTKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQ
FT                   QHAEADGVEALDSTSHAKSGYHDDSDEDLLE"
FT   assembly_gap    2029865..2029913
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    2041022..2041170
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    2046917..2046986
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            2072101..2074517
FT                   /locus_tag="mCG_1026337"
FT                   /note="gene_id=mCG1026337.1"
FT   mRNA            join(2072101..2073516,2074103..2074517)
FT                   /locus_tag="mCG_1026337"
FT                   /product="mCG1026337"
FT                   /note="gene_id=mCG1026337.1 transcript_id=mCT144041.1
FT                   created on 23-MAY-2002"
FT   CDS             2072649..2072981
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026337"
FT                   /product="mCG1026337"
FT                   /note="gene_id=mCG1026337.1 transcript_id=mCT144041.1
FT                   protein_id=mCP60253.1"
FT                   /protein_id="EDL01962.1"
FT                   /translation="MCTSSHRYILCICLYEITQANLYLYIYVCVHIYMYKLYSVHVNDL
FT                   SVCPEFLVQFSFSACPQLWSGDFLSPGSSAESLCLSLQGEGFGLHSSYPHAQKRSGSPR
FT                   ACCPPL"
FT   assembly_gap    2073593..2073612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2077173..2092455
FT                   /gene="1110037P11Rik"
FT                   /locus_tag="mCG_4062"
FT                   /note="gene_id=mCG4062.1"
FT   mRNA            join(2077173..2077408,2086515..2086603,2087092..2087287,
FT                   2087485..2087624,2087768..2087927,2088030..2088166,
FT                   2089708..2089894,2091085..2091128,2092368..2092455)
FT                   /gene="1110037P11Rik"
FT                   /locus_tag="mCG_4062"
FT                   /product="RIKEN cDNA 1110037P11"
FT                   /note="gene_id=mCG4062.1 transcript_id=mCT1647.2 created on
FT                   23-MAY-2002"
FT   CDS             join(2077261..2077408,2086515..2086603,2087092..2087287,
FT                   2087485..2087624,2087768..2087927,2088030..2088166,
FT                   2089708..2089894,2091085..2091095)
FT                   /codon_start=1
FT                   /gene="1110037P11Rik"
FT                   /locus_tag="mCG_4062"
FT                   /product="RIKEN cDNA 1110037P11"
FT                   /note="gene_id=mCG4062.1 transcript_id=mCT1647.2
FT                   protein_id=mCP19784.1"
FT                   /protein_id="EDL01963.1"
FT                   /translation="METATTLEIASCSQRQVEAAADPADAKGPRTSHQQEAGSPSLQLL
FT                   PSIEEHPKIWLPRALKQTYIRKAGETVNLLIPIQGKPKPQTTWTHNGCALDSSRVSVRN
FT                   GEHDSILFIREAQRTDSGCYQLCVQLGGLQATATINILVIEKPGPPQSIKLVDVWGANA
FT                   TLEWTPPQDTGNTALLGYTVQKADKKSGLWFTVLERYHRTSCVVSNLIVGNSYAFRVFA
FT                   ENQCGLSDTAPVTADLAHIQKAATVYKAKGFAQRDLSEAPKFTQPLADCTTVTGYDTQL
FT                   FCCVRASPRPKIIWLKNKMDLQGNPKYRALSQLGICSLEIRKPSPFDGGIYTCKAINAL
FT                   GEASVDCRVDVKAPH"
FT   assembly_gap    2079017..2079036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2084276..2084419
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            complement(2091676..>2096141)
FT                   /locus_tag="mCG_145866"
FT                   /note="gene_id=mCG145866.0"
FT   mRNA            complement(join(2091676..2093333,2094870..2095195,
FT                   2095686..>2096141))
FT                   /locus_tag="mCG_145866"
FT                   /product="mCG145866"
FT                   /note="gene_id=mCG145866.0 transcript_id=mCT185974.0
FT                   created on 03-JUL-2003"
FT   CDS             complement(2092879..>2093262)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145866"
FT                   /product="mCG145866"
FT                   /note="gene_id=mCG145866.0 transcript_id=mCT185974.0
FT                   protein_id=mCP107355.0"
FT                   /protein_id="EDL01964.1"
FT                   /translation="TKTLHLSSPGLWLLLRRVQWAYRSGRDHQHLYRVREHLLYVTCYK
FT                   MQTNRSKREQHPEVRLGAWGSAFICRMICAACCLLLGLHPVIPIYKGYHSLWEYDKSSS
FT                   SFPNTSCLVELKATLSKVACGKR"
FT   assembly_gap    2094164..2094183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2096242..2100560
FT                   /gene="Psrc1"
FT                   /locus_tag="mCG_4047"
FT                   /note="gene_id=mCG4047.1"
FT   mRNA            join(2096242..2096325,2096635..2096684,2096773..2096830,
FT                   2097369..2097807,2098692..2098806,2098899..2099135,
FT                   2099677..2099794,2099997..2100560)
FT                   /gene="Psrc1"
FT                   /locus_tag="mCG_4047"
FT                   /product="proline/serine-rich coiled-coil 1, transcript
FT                   variant mCT1667"
FT                   /note="gene_id=mCG4047.1 transcript_id=mCT1667.1 created on
FT                   23-MAY-2002"
FT   mRNA            join(2096264..2096294,2096635..2096684,2096773..2096830,
FT                   2097369..2097807,2098692..2098806,2098899..2099135,
FT                   2099677..2099794,2099997..2100560)
FT                   /gene="Psrc1"
FT                   /locus_tag="mCG_4047"
FT                   /product="proline/serine-rich coiled-coil 1, transcript
FT                   variant mCT169295"
FT                   /note="gene_id=mCG4047.1 transcript_id=mCT169295.0 created
FT                   on 23-MAY-2002"
FT   CDS             join(2096666..2096684,2096773..2096830,2097369..2097807,
FT                   2098692..2098806,2098899..2099135,2099677..2099794,
FT                   2099997..2100000)
FT                   /codon_start=1
FT                   /gene="Psrc1"
FT                   /locus_tag="mCG_4047"
FT                   /product="proline/serine-rich coiled-coil 1, isoform CRA_a"
FT                   /note="gene_id=mCG4047.1 transcript_id=mCT1667.1
FT                   protein_id=mCP19744.1 isoform=CRA_a"
FT                   /protein_id="EDL01965.1"
FT                   /translation="MEDLKEDIKFIVDETLDFGGLSPSDSHEEEDITVLVSPEKPLRRG
FT                   LAHRSNPNEVAPALQGVRFSLGPLSPEKLEEILDEANRLAAQLEECALKDRERAGTGPG
FT                   RPSPRGKPSPRRETFVLKDSPVRDLLPTVSSWSTPPPSSLAGLRSSDKKGSARAVRVAS
FT                   GKKPSSIKKESPTCNLFPASKSPGRSPLAQPILPPRRKTGFGARTTASPPIPVRPVPQS
FT                   SASNSQCSSRLQGAAVKSSSRLPVPSAIPKPATRVPLIGRSLPPGKGALAPDSLSTQKG
FT                   HPSAIGHRASVSQKTNLPTTSAARGRTTSAARGRAQPLRKAAVPGPTR"
FT   CDS             join(2096666..2096684,2096773..2096830,2097369..2097807,
FT                   2098692..2098806,2098899..2099135,2099677..2099794,
FT                   2099997..2100000)
FT                   /codon_start=1
FT                   /gene="Psrc1"
FT                   /locus_tag="mCG_4047"
FT                   /product="proline/serine-rich coiled-coil 1, isoform CRA_a"
FT                   /note="gene_id=mCG4047.1 transcript_id=mCT169295.0
FT                   protein_id=mCP92155.0 isoform=CRA_a"
FT                   /protein_id="EDL01966.1"
FT                   /translation="MEDLKEDIKFIVDETLDFGGLSPSDSHEEEDITVLVSPEKPLRRG
FT                   LAHRSNPNEVAPALQGVRFSLGPLSPEKLEEILDEANRLAAQLEECALKDRERAGTGPG
FT                   RPSPRGKPSPRRETFVLKDSPVRDLLPTVSSWSTPPPSSLAGLRSSDKKGSARAVRVAS
FT                   GKKPSSIKKESPTCNLFPASKSPGRSPLAQPILPPRRKTGFGARTTASPPIPVRPVPQS
FT                   SASNSQCSSRLQGAAVKSSSRLPVPSAIPKPATRVPLIGRSLPPGKGALAPDSLSTQKG
FT                   HPSAIGHRASVSQKTNLPTTSAARGRTTSAARGRAQPLRKAAVPGPTR"
FT   gene            complement(2104780..>2127895)
FT                   /gene="Celsr2"
FT                   /locus_tag="mCG_4064"
FT                   /note="gene_id=mCG4064.2"
FT   mRNA            complement(join(2104780..2105058,2105411..2105645,
FT                   2105740..2105910,2106050..2106232,2106336..2106424,
FT                   2106613..2106740,2107285..2107407,2107516..2107642,
FT                   2107728..2107807,2107960..2108072,2108343..2108517,
FT                   2108833..2109033,2109119..2109245,2109347..2109514,
FT                   2109630..2109810,2109902..2110030,2110160..2110343,
FT                   2110869..2111078,2111279..2111373,2112017..2112118,
FT                   2112282..2112465,2112903..2113023,2113178..2113319,
FT                   2113546..2113720,2113800..2114087,2114337..2114503,
FT                   2114848..2114973,2115105..2115268,2115621..2115778,
FT                   2116024..2116112,2116297..2116412,2116749..2116971,
FT                   2119150..2119797,2124586..>2127895))
FT                   /gene="Celsr2"
FT                   /locus_tag="mCG_4064"
FT                   /product="cadherin EGF LAG seven-pass G-type receptor 2"
FT                   /note="gene_id=mCG4064.2 transcript_id=mCT1648.2 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(2105031..2105058,2105411..2105645,
FT                   2105740..2105910,2106050..2106232,2106336..2106424,
FT                   2106613..2106740,2107285..2107407,2107516..2107642,
FT                   2107728..2107807,2107960..2108072,2108343..2108517,
FT                   2108833..2109033,2109119..2109245,2109347..2109514,
FT                   2109630..2109810,2109902..2110030,2110160..2110343,
FT                   2110869..2111078,2111279..2111373,2112017..2112118,
FT                   2112282..2112465,2112903..2113023,2113178..2113319,
FT                   2113546..2113720,2113800..2114087,2114337..2114503,
FT                   2114848..2114973,2115105..2115268,2115621..2115778,
FT                   2116024..2116112,2116297..2116412,2116749..2116971,
FT                   2119150..2119797,2124586..2127895))
FT                   /codon_start=1
FT                   /gene="Celsr2"
FT                   /locus_tag="mCG_4064"
FT                   /product="cadherin EGF LAG seven-pass G-type receptor 2"
FT                   /note="gene_id=mCG4064.2 transcript_id=mCT1648.2
FT                   protein_id=mCP19758.1"
FT                   /db_xref="GOA:A2AEE7"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="InterPro:IPR022624"
FT                   /db_xref="MGI:MGI:1858235"
FT                   /db_xref="UniProtKB/TrEMBL:A2AEE7"
FT                   /protein_id="EDL01967.1"
FT                   /translation="MRSRAASAPLPTPLLPLLLLLLLLPPSPLLGDQVGPCRSLGSGGR
FT                   SSSGACAPVGWLCPASASNLWLYTSRCRESGIELTGHLVPHHDGLRVWCPESGAHIPLP
FT                   PSSEGCPWSCRLLGIGGHLSPQGTLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGEGSP
FT                   EESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTSVASLRAIDPDEGEAGRLEYTMDA
FT                   LFDSRSNHFFSLDPITGVVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTD
FT                   TNDHDPVFEQQEYKESLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGAGGSPSDAF
FT                   EIDPRSGVIRTRGPVDREEVESYKLTVEASDQGRDPGPRSSTAIVFLSVEDDNDNAPQF
FT                   SEKRYVVQVREDVTPGAPVLRVTASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDV
FT                   VSPLDYETTKEYTLRIRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLES
FT                   VPLGYLVLHVQAIDADAGDNARLEYSLAGVGHDFPFTINNGTGWISVAAELDREEVDFY
FT                   SFGVEARDHGTPALTASASVSVTILDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAV
FT                   DRDAHSVITYQITSGNTRNRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQD
FT                   TAQIVVNVTDANTHRPVFQSSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMED
FT                   SIPQFRIDADTGAVTTQAELDYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNA
FT                   PQFLRDSYQGSVYEDVPPFTSVLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSG
FT                   IVRTLRRLDRENVAQYVLRAYAVDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFV
FT                   EENSPIGLAVARVTATDPDEGTNAQIMYQIVEGNIPEVFQLDIFSGELTALVDLDYEDR
FT                   PEYVLVIQATSAPLVSRATVHVRLLDRNDNPPVLGNFEILFNNYVTNRSSSFPGGAIGR
FT                   VPAHDPDISDSLTYSFERGNELSLVLLNASTGELRLSRALDNNRPLEAIMSVLVSDGVH
FT                   SVTAQCSLRVTIITDEMLTHSITLRLEDMSPERFLSPLLGLFIQAVAATLATPPDHVVV
FT                   FNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFLPSEDLQERLYLNRSLLTAISAQRVL
FT                   PFDDNICLREPCENYMRCVSVLRFDSSAPFIASSSVLFRPIHPVGGLRCRCPPGFTGDY
FT                   CETEVDLCYSRPCGPHGRCRSREGGYTCLCLDGYTGEHCEASTHSGRCTPGVCKNGGTC
FT                   VNLLVGGFKCDCPSGDFEKPFCQVTTRSFPARSFITFRGLRQRFHFTLALSFATKERNG
FT                   LLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTTTVSPFVPGGVSDGQWHTVQLKYYN
FT                   KPLLGQTGLPQGPSEQKVAVVSVDGCDTGVALRFGAMLGNYSCAAQGTQGGSKKSLDLT
FT                   GPLLLGGVPDLPESFPVRMRHFVGCMKDLQVDSRHIDMADFIANNGTVPGCPTKKIVCD
FT                   SSICHNGGTCVNQWNAFSCECPLGFGGKSCAQEMANPQRFLGSSLVAWHGLSLPISQPW
FT                   HLSLMFRTRQADGVLLQAVTRGRSTITLQLRAGHVVLSVEGTGLQASSLRLEPGRANDG
FT                   DWHHAQLALGASGGPGHAILSFDYGQQKAEGNLGPRLHGLHLSNITVGGVPGPASGVAR
FT                   GFRGCLQGVRVSETPEGISSLDPSRGESINVEPGCSWPDPCDSNPCPTNSYCSNDWDSY
FT                   SCSCVLGYYGDNCTNVCDLNPCEHQSVCTRKPNTPHGYICECLPNYLGPYCETRIDQPC
FT                   PRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPGSPTCLLCDCYPTGSLS
FT                   RVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCPRAIEAGIWWPRTRFG
FT                   LPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFAERLQRNESGLDSGR
FT                   SQRLALLLRNATQHTSGYFGSDVKVAYQLATRLLAHESAQRGFGLSATQDVHFTENLLR
FT                   VGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVI
FT                   SVVRLDKGNFAGTKLPRYEALRGERPPDLETTVILPESVFREMPSMVRSAGPGEAQETE
FT                   ELARRQRRHPELSQGEAVASVIIYHTLAGLLPHNYDPDKRSLRVPKRPVINTPVVSISV
FT                   HDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSARGCEVVFRNE
FT                   SHVSCQCNHMTSFAVLMDMSRRENGEILPLKTLTYVALGVTLAALMLTFLFLTLLRALR
FT                   SNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWALLEALHL
FT                   YRALTEVRDVNASPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSVYDTLIWSF
FT                   AGPVAFAVSMSVFLYILSARASCAAQRQGFEKKGPVSGLRSSFTVLLLLSATWLLALLS
FT                   VNSDTLLFHYLFAACNCVQGPFIFLSYVVLSKEVRKALKFACSRKPSPDPALTTKSTLT
FT                   SSYNCPSPYADGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQVPPGLG
FT                   DPSGLFLEGQAQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEAAFPGEQGWDS
FT                   LLGPGAERLPLHSTPKDGGPGSGKVPWLGDFGTTTKENSGSGPLEERPRENGDALTREG
FT                   SLGPLPGPSTQPHKGILKKKCLPTISEKSSLLRLPLEQGTGSSRGSSISEGSRHGPPPR
FT                   PPPRQSLQEQLNGVMPVAMSIKAGTVDEDSSGSEFLFFNFLH"
FT   assembly_gap    2133997..2134145
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            complement(2138832..2157672)
FT                   /gene="Sars"
FT                   /locus_tag="mCG_4072"
FT                   /note="gene_id=mCG4072.2"
FT   mRNA            complement(join(2138832..2139388,2139667..2139796,
FT                   2140581..2140738,2141013..2141142,2141649..2141870,
FT                   2143912..2144067,2145465..2145608,2146496..2146654,
FT                   2148333..2148413,2149956..2150026,2157402..>2157671))
FT                   /gene="Sars"
FT                   /locus_tag="mCG_4072"
FT                   /product="seryl-aminoacyl-tRNA synthetase, transcript
FT                   variant mCT1638"
FT                   /note="gene_id=mCG4072.2 transcript_id=mCT1638.1 created on
FT                   23-MAY-2002"
FT   mRNA            complement(join(2139019..2139388,2139667..2139796,
FT                   2140268..2140339,2140581..2140738,2141013..2141142,
FT                   2141649..2141870,2143912..2144067,2145465..2145608,
FT                   2146496..2146654,2148333..2148413,2149956..2150026,
FT                   2157402..2157672))
FT                   /gene="Sars"
FT                   /locus_tag="mCG_4072"
FT                   /product="seryl-aminoacyl-tRNA synthetase, transcript
FT                   variant mCT169298"
FT                   /note="gene_id=mCG4072.2 transcript_id=mCT169298.0 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(2139237..2139388,2139667..2139796,
FT                   2140581..2140738,2141013..2141142,2141649..2141870,
FT                   2143912..2144067,2145465..2145608,2146496..2146654,
FT                   2148333..2148413,2149956..2150026,2157402..>2157546))
FT                   /codon_start=1
FT                   /gene="Sars"
FT                   /locus_tag="mCG_4072"
FT                   /product="seryl-aminoacyl-tRNA synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG4072.2 transcript_id=mCT1638.1
FT                   protein_id=mCP19779.0 isoform=CRA_a"
FT                   /protein_id="EDL01968.1"
FT                   /translation="GRRMVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSE
FT                   WRRCRFRADNLNKLKNLCSKTIGEKMKKKEAVGDDESVPENVLNFDDLTADALAALKVS
FT                   QIKKVRLLIDEAIQKCDGERVKLEAERFENLREIGNLLHPSVPISNDEDADNKVERIWG
FT                   DCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGPLVFLEQALIQYALRTLGSRG
FT                   YTPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAA
FT                   LHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKS
FT                   WEMFDEMIATAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCS
FT                   NCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQAEKGIAVPEK
FT                   LREFMPPGLQELIPFVKPAPIDQEPSKKQKKQHEGSKKKAKEVPLENQLQSMEVTEA"
FT   CDS             complement(join(2139237..2139388,2139667..2139796,
FT                   2140268..2140339,2140581..2140738,2141013..2141142,
FT                   2141649..2141870,2143912..2144067,2145465..2145608,
FT                   2146496..2146654,2148333..2148413,2149956..2150026,
FT                   2157402..2157537))
FT                   /codon_start=1
FT                   /gene="Sars"
FT                   /locus_tag="mCG_4072"
FT                   /product="seryl-aminoacyl-tRNA synthetase, isoform CRA_b"
FT                   /note="gene_id=mCG4072.2 transcript_id=mCT169298.0
FT                   protein_id=mCP92156.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C483"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="MGI:MGI:102809"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C483"
FT                   /protein_id="EDL01969.1"
FT                   /translation="MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRR
FT                   CRFRADNLNKLKNLCSKTIGEKMKKKEAVGDDESVPENVLNFDDLTADALAALKVSQIK
FT                   KVRLLIDEAIQKCDGERVKLEAERFENLREIGNLLHPSVPISNDEDADNKVERIWGDCT
FT                   VRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGPLVFLEQALIQYALRTLGSRGYTP
FT                   IYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHR
FT                   DEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEM
FT                   FDEMIATAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCT
FT                   DYQARRLRIRYGQTKKMMDKKKNNLRFSTQNKLKAMSSLFSPKKVEFVHMLNATMCATT
FT                   RTICAILENYQAEKGIAVPEKLREFMPPGLQELIPFVKPAPIDQEPSKKQKKQHEGSKK
FT                   KAKEVPLENQLQSMEVTEA"
FT   assembly_gap    2143052..2143071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2150507..2150526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2163682..2164059)
FT                   /pseudo
FT                   /locus_tag="mCG_48863"
FT                   /note="gene_id=mCG48863.2"
FT   mRNA            complement(2163682..2164059)
FT                   /pseudo
FT                   /locus_tag="mCG_48863"
FT                   /note="gene_id=mCG48863.2 transcript_id=mCT49046.1 created
FT                   on 23-MAY-2002"
FT   gene            complement(2170470..2249608)
FT                   /locus_tag="mCG_4063"
FT                   /note="gene_id=mCG4063.2"
FT   mRNA            complement(join(2170470..2170872,2172085..2172250,
FT                   2173339..2173517,2173596..2173722,2175290..2175391,
FT                   2175870..2175966,2176655..2176835,2178005..2178178,
FT                   2180156..2180419,2181866..2181979,2182216..2182321,
FT                   2183662..2183752,2184283..2184411,2185037..2185214,
FT                   2187187..2187363,2193270..2193439,2193578..2193683,
FT                   2194096..2194176,2194645..2194792,2201136..2201328,
FT                   2204543..2204663,2249380..2249608))
FT                   /locus_tag="mCG_4063"
FT                   /product="mCG4063"
FT                   /note="gene_id=mCG4063.2 transcript_id=mCT1659.2 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(2170804..2170872,2172085..2172250,
FT                   2173339..2173517,2173596..2173722,2175290..2175391,
FT                   2175870..2175966,2176655..2176835,2178005..2178178,
FT                   2180156..2180419,2181866..2181979,2182216..2182321,
FT                   2183662..2183752,2184283..2184411,2185037..2185214,
FT                   2187187..2187363,2193270..2193439,2193578..2193683,
FT                   2194096..2194176,2194645..2194792,2201136..2201328,
FT                   2204543..2204663,2249380..2249532))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4063"
FT                   /product="mCG4063"
FT                   /note="gene_id=mCG4063.2 transcript_id=mCT1659.2
FT                   protein_id=mCP19794.2"
FT                   /protein_id="EDL01970.1"
FT                   /translation="MAEPGHNPHPSARDGGKTERRTPRLLWLLLWAGTTFQVTLGTGPE
FT                   LHACKESEYHFEYTACDSTGSRWRVAVPHSPGLCTSLPDPVKGTECSFSCNAGEFLDMK
FT                   DQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSANLEVDDSISESTENCTSSKWVPRG
FT                   DYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFFVQNDQCQPSADDSRWMK
FT                   TTEKGWEFHSVELNRGNNVLYWRTTAFSVWSKVSKPVLVRNIAITGVAYTSECFPCKPG
FT                   TYAAKQGSPFCKLCPANYYSNKGETSCHPCDADKYSGDVSEGRKKDLPPAKCAQPAQTR
FT                   TISTPTQPVMLRERWVARSENLFPAPYTQWSVNSLEKPPKTCMTQLMYKWAIPKICGED
FT                   LEGAVKLPASGVKTRCPPCNPGFFKTDNSTCEPCPYGSYSNGSDCTHCPAGTEPAVGFE
FT                   YKWWNTLPSNMETTVLSGINFEYKGLTGWEVAGDHIYTAVGASDNDFMILTLVVPGFRP
FT                   PQSVVADTENKEVARITFVFETICSVNCELYFMVGMNSRTNTPVGDVEGHQRQAVLYLH
FT                   HRRECYCELHMGLGRKYTNDVAKIYSINVTNVMGGVASYCRPCALEASDLGSSCTSCPA
FT                   GHYINRDSGTCHLCPSNTILKAHQPYGAQACVPCGPGTKNNKIHSLCYNDCTFSRNTPS
FT                   RIFNYNFSALAGTVSLAGVPSFTSKGLKYFHHFTLSLCGNQGKKMAVCTDNVTDLRIPD
FT                   GEAGFSKSVTAYVCQVVIIPSEVMGYKAGVSSQPVSLADRLVGVSTDMTLEGIVSPVEL
FT                   FHPETSGIPDIVFFFRSNDVTQSCSSGRSTTIRLRCNPMKAAPGTLRLPSMCSDGTCDG
FT                   CNFHFLWESVAACPLCSASDYHTFVSSCVAGIQKTTYMWREPKLCSGGISLPEQRVTIC
FT                   KTIDFWLKVGISAGTCTAILLTVLTCYFWKKNQKLEYKYSKLVMNATLKDCDLPAADSC
FT                   AIMEGEDVEDDFIFTSKKSLFGKIKSFTSKRTPDGFDSVPLKTSSGGPDMDM"
FT   assembly_gap    2181846..2181865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2202638..2202657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2205552..2205575
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    2218221..2223414
FT                   /estimated_length=5194
FT                   /gap_type="unknown"
FT   assembly_gap    2226980..2227072
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    2235412..2235431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2243352..2243637
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   gene            2247228..2258956
FT                   /locus_tag="mCG_4073"
FT                   /note="gene_id=mCG4073.2"
FT   mRNA            join(2247228..2247331,2250408..2250779,2255568..2255681,
FT                   2256519..2256634,2257116..2257240,2257657..2258956)
FT                   /locus_tag="mCG_4073"
FT                   /product="mCG4073"
FT                   /note="gene_id=mCG4073.2 transcript_id=mCT1639.2 created on
FT                   23-MAY-2002"
FT   CDS             join(2250699..2250779,2255568..2255681,2256519..2256634,
FT                   2257116..2257240,2257657..2257727)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4073"
FT                   /product="mCG4073"
FT                   /note="gene_id=mCG4073.2 transcript_id=mCT1639.2
FT                   protein_id=mCP19740.1"
FT                   /protein_id="EDL01971.1"
FT                   /translation="MLQPQETFSNPALRDEDKHLGNLWASKKSLYKNPAHLAQQQDPWS
FT                   RLSSTPTATSRSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQG
FT                   TKIQFPGECFHAPSAPITSRTTIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDG
FT                   GFFST"
FT   gene            complement(2267411..2267814)
FT                   /locus_tag="mCG_1026318"
FT                   /note="gene_id=mCG1026318.1"
FT   mRNA            complement(2267411..2267814)
FT                   /locus_tag="mCG_1026318"
FT                   /product="mCG1026318"
FT                   /note="gene_id=mCG1026318.1 transcript_id=mCT144022.1
FT                   created on 05-JUN-2002"
FT   CDS             complement(2267469..2267603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026318"
FT                   /product="mCG1026318"
FT                   /note="gene_id=mCG1026318.1 transcript_id=mCT144022.1
FT                   protein_id=mCP60173.1"
FT                   /protein_id="EDL01972.1"
FT                   /translation="MKSSPPAKPPRWGAVQRGPLGGGGVAVPGVPGSVLRARRSEVMN"
FT   gene            complement(2268539..2275451)
FT                   /gene="2010200O16Rik"
FT                   /locus_tag="mCG_4066"
FT                   /note="gene_id=mCG4066.1"
FT   mRNA            complement(join(2268539..2272033,2273260..2273391,
FT                   2275344..2275451))
FT                   /gene="2010200O16Rik"
FT                   /locus_tag="mCG_4066"
FT                   /product="RIKEN cDNA 2010200O16"
FT                   /note="gene_id=mCG4066.1 transcript_id=mCT1645.1 created on
FT                   05-JUN-2002"
FT   CDS             complement(join(2271951..2272033,2273260..2273391,
FT                   2275344..2275353))
FT                   /codon_start=1
FT                   /gene="2010200O16Rik"
FT                   /locus_tag="mCG_4066"
FT                   /product="RIKEN cDNA 2010200O16"
FT                   /note="gene_id=mCG4066.1 transcript_id=mCT1645.1
FT                   protein_id=mCP19788.2"
FT                   /protein_id="EDL01973.1"
FT                   /translation="MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVF
FT                   YKAAVIGTRLHAAVAIACIVMAFYVLFIK"
FT   assembly_gap    2283668..2283713
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            2284686..2295054
FT                   /locus_tag="mCG_4065"
FT                   /note="gene_id=mCG4065.2"
FT   mRNA            join(2284686..2284739,2285871..2285949,2291102..2291199,
FT                   2293993..2295053)
FT                   /locus_tag="mCG_4065"
FT                   /product="mCG4065, transcript variant mCT1649"
FT                   /note="gene_id=mCG4065.2 transcript_id=mCT1649.1 created on
FT                   05-JUN-2002"
FT   mRNA            join(2284687..2284743,2285871..2285949,2291102..2291199,
FT                   2293993..2295054)
FT                   /locus_tag="mCG_4065"
FT                   /product="mCG4065, transcript variant mCT169809"
FT                   /note="gene_id=mCG4065.2 transcript_id=mCT169809.0 created
FT                   on 05-JUN-2002"
FT   mRNA            join(2284689..2285104,2285871..2285949,2291102..2291199,
FT                   2293993..2295051)
FT                   /locus_tag="mCG_4065"
FT                   /product="mCG4065, transcript variant mCT169810"
FT                   /note="gene_id=mCG4065.2 transcript_id=mCT169810.0 created
FT                   on 05-JUN-2002"
FT   CDS             join(2284713..2284739,2285871..2285949,2291102..2291199,
FT                   2293993..2294163)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4065"
FT                   /product="mCG4065, isoform CRA_b"
FT                   /note="gene_id=mCG4065.2 transcript_id=mCT1649.1
FT                   protein_id=mCP19774.2 isoform=CRA_b"
FT                   /protein_id="EDL01976.1"
FT                   /translation="MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGD
FT                   DQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLL
FT                   TMNEELKRARKAFDEANYGS"
FT   CDS             join(2291110..2291199,2293993..2294163)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4065"
FT                   /product="mCG4065, isoform CRA_a"
FT                   /note="gene_id=mCG4065.2 transcript_id=mCT169809.0
FT                   protein_id=mCP92655.0 isoform=CRA_a"
FT                   /protein_id="EDL01974.1"
FT                   /translation="MMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQV
FT                   EDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS"
FT   CDS             join(2291110..2291199,2293993..2294163)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4065"
FT                   /product="mCG4065, isoform CRA_a"
FT                   /note="gene_id=mCG4065.2 transcript_id=mCT169810.0
FT                   protein_id=mCP92667.0 isoform=CRA_a"
FT                   /protein_id="EDL01975.1"
FT                   /translation="MMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQV
FT                   EDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS"
FT   assembly_gap    2297159..2297178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2304422..2358694
FT                   /gene="Wdr47"
FT                   /locus_tag="mCG_4074"
FT                   /note="gene_id=mCG4074.1"
FT   mRNA            join(2304422..2304583,2322909..2323075,2324388..2324471,
FT                   2327365..2327449,2331468..2332270,2336301..2336427,
FT                   2337535..2337713,2340181..2340438,2342670..2342745,
FT                   2346039..2346196,2349969..2350138,2350871..2351041,
FT                   2351604..2351735,2356040..2356258,2357424..2358694)
FT                   /gene="Wdr47"
FT                   /locus_tag="mCG_4074"
FT                   /product="WD repeat domain 47"
FT                   /note="gene_id=mCG4074.1 transcript_id=mCT1636.1 created on
FT                   05-JUN-2002"
FT   assembly_gap    2308938..2308957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2315421..2315826)
FT                   /pseudo
FT                   /locus_tag="mCG_140500"
FT                   /note="gene_id=mCG140500.0"
FT   mRNA            complement(2315421..2315826)
FT                   /pseudo
FT                   /locus_tag="mCG_140500"
FT                   /note="gene_id=mCG140500.0 transcript_id=mCT169811.0
FT                   created on 05-JUN-2002"
FT   CDS             join(2322918..2323075,2324388..2324471,2327365..2327449,
FT                   2331468..2332270,2336301..2336427,2337535..2337713,
FT                   2340181..2340438,2342670..2342745,2346039..2346196,
FT                   2349969..2350138,2350871..2351041,2351604..2351735,
FT                   2356040..2356258,2357424..2357566)
FT                   /codon_start=1
FT                   /gene="Wdr47"
FT                   /locus_tag="mCG_4074"
FT                   /product="WD repeat domain 47"
FT                   /note="gene_id=mCG4074.1 transcript_id=mCT1636.1
FT                   protein_id=mCP19785.1"
FT                   /db_xref="GOA:Q8CGF6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:2139593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGF6"
FT                   /protein_id="EDL01977.1"
FT                   /translation="MTAEETVNVKEVEIIKLILDFLNSKKLHISMLALEKESGVINGLF
FT                   SDDMLFLRQLILDGQWDEVLQFIQPLECMEKFDKKRFRYIILKQKFLEALCVNNAMSAE
FT                   DEPQHLEFTMQEAVQCLHALEEYCPSKDDYSKLCLLLTLPRLTNHAEFKDWNPSTARVH
FT                   CFEEVCVMVAEFIPADRKLSEAGFKASNNRLFQLVMKGLLYECCVEFCQSKATGEEITE
FT                   SEVLLGIDLLCGNGCDDLDLSLLSWLQNLPSSVFSCAFEQKMLNIHVDKLLKPTKAAYA
FT                   DLLTPLISKLSPYPSSPMRRPQSADAYMTRSLNPALDGLTCGLTSHDKRISDLGNKTSP
FT                   MSHSFANFHYPGVQNLSRSLMLENTECHSIYEESPERSDTPVEAQQPVSSEAMCQGSGL
FT                   EKEPANGAQNPVPAKQEKNELRDSTEQFQEYYRQRLRYQQHLEQKEQQRQMYQQMLLEG
FT                   GVNQEDGPDQQQNLTEQFLNRSIQKLGELNIGMDSLGNEVPVLNQQCSGSKNNGSNNSS
FT                   VTSFSTPPQDSSQRLIHDTANIHTSTPRNPGSTNHIPFHEDSPCGSQNSSEHSVIKPSP
FT                   GDSSGNLSRSKGEEDDKSKKQFVCINTLEDTQAVRAVAFHPSGSLYAVGSNSKTLRVCA
FT                   YPEKMDASAHDNPKQPVVRFKRNKHHKGSIYCVAWSPCGQLLATGSNDKYVKVLPFNAE
FT                   TCNATGPDLEFSMHDGTIRDLAFMEGPESGGAILISAGAGDCNIYTTDCQRGQGLHALS
FT                   GHTGHILALYTWSGWMIASGSQDKTVRFWDLRVPSCVRVVGTTFHGTGSAVASVAVDPS
FT                   GRLLATGQEDSSCMLYDIRGGRMVQSYHPHSSDVRSVRFSPGAHYLLTGSYDMKIKVTD
FT                   LQGDLTKQLPLMVVGEHKDKVIQCRWHTQDLSFLSSSADRTVTLWTYSG"
FT   assembly_gap    2360077..2360217
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            <2366823..2392018
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /note="gene_id=mCG4070.4"
FT   mRNA            join(<2366823..2366864,2374243..2374383,2374820..2374921,
FT                   2376412..2376519,2380851..2381072,2381587..2381727,
FT                   2383790..2383883,2385708..2385805,2386169..2386315,
FT                   2387574..2387900,2389622..2389915,2391477..2391776)
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /product="chloride channel CLIC-like 1, transcript variant
FT                   mCT189461"
FT                   /note="gene_id=mCG4070.4 transcript_id=mCT189461.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2366826..2366864,2374243..2374383,2374820..2374921,
FT                   2376412..2376519,2380851..2381072,2381587..2381727,
FT                   2383790..2383883,2385708..2385805,2386169..2386315,
FT                   2387574..2387900,2389622..2389873)
FT                   /codon_start=1
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /product="chloride channel CLIC-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG4070.4 transcript_id=mCT189461.0
FT                   protein_id=mCP110448.0 isoform=CRA_c"
FT                   /protein_id="EDL01980.1"
FT                   /translation="VRSGLQSECTVFEALFRMLCRLLLCECLLLITGYAHDDDWIDPTD
FT                   MLNYDAASGTMRKSQVRSGTSEKKEVSPDSSEAEELSDCLHRLDSLTHKVDSCEKKKMK
FT                   DYESQSNPVFRRYLNKILIEAGKLGLPDENKVEMRYDAEILLSRQTLLEIQKFLSGEEW
FT                   KPGALDDALSDILINFKCHDSEAWKWQFEDYFGVDPYNVFMVLLCLLCLVVLVATELWT
FT                   YVRWYTQMKRIFIISFLLSLAWNWIYLYKMAFAQHQANIAGMEPFDNLCAKKMDWTGSL
FT                   WEWFTSSWTYKDDPCQKYYELLIVNPIWLVPPTKALAITFTNFVTEPLKHIGKGAGEFI
FT                   KALMKEIPVLLQIPVLAILALAVLSFCYGAGRSVPMLRHFGGPDREPPRALEPDDRRRQ
FT                   KGLDYRLHGGAGDADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLRAFD
FT                   LPDTEAQEHPEVVPSHKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSSPT
FT                   VDKAQLKTDSECSPPGGCPPSKEAAVAAHGTEPVSSPCG"
FT   mRNA            join(2366833..2366864,2374243..2374383,2374820..2374921,
FT                   2375397..2375883)
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /product="chloride channel CLIC-like 1, transcript variant
FT                   mCT185573"
FT                   /note="gene_id=mCG4070.4 transcript_id=mCT185573.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(2367131..2367229,2374243..2374383,2374820..2374921,
FT                   2376412..2376519,2380851..2381072,2381587..2381727,
FT                   2383790..2383883,2385708..2385805,2386169..2386315,
FT                   2387574..2387900,2389622..2390946)
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /product="chloride channel CLIC-like 1, transcript variant
FT                   mCT185572"
FT                   /note="gene_id=mCG4070.4 transcript_id=mCT185572.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(2367191..2367229,2374243..2374383,2374820..2374921,
FT                   2376412..2376519,2380851..2381072,2381587..2381727,
FT                   2383790..2383883,2385708..2385805,2386169..2386315,
FT                   2387574..2387900,2389622..2389915,2391477..2392018)
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /product="chloride channel CLIC-like 1, transcript variant
FT                   mCT1642"
FT                   /note="gene_id=mCG4070.4 transcript_id=mCT1642.2 created on
FT                   12-JUN-2003"
FT   CDS             join(2367227..2367229,2374243..2374383,2374820..2374921,
FT                   2376412..2376519,2380851..2381072,2381587..2381727,
FT                   2383790..2383883,2385708..2385805,2386169..2386315,
FT                   2387574..2387900,2389622..2389873)
FT                   /codon_start=1
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /product="chloride channel CLIC-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG4070.4 transcript_id=mCT1642.2
FT                   protein_id=mCP19731.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2AEM2"
FT                   /db_xref="InterPro:IPR009231"
FT                   /db_xref="MGI:MGI:2385186"
FT                   /db_xref="UniProtKB/TrEMBL:A2AEM2"
FT                   /protein_id="EDL01978.1"
FT                   /translation="MALFRMLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMR
FT                   KSQVRSGTSEKKEVSPDSSEAEELSDCLHRLDSLTHKVDSCEKKKMKDYESQSNPVFRR
FT                   YLNKILIEAGKLGLPDENKVEMRYDAEILLSRQTLLEIQKFLSGEEWKPGALDDALSDI
FT                   LINFKCHDSEAWKWQFEDYFGVDPYNVFMVLLCLLCLVVLVATELWTYVRWYTQMKRIF
FT                   IISFLLSLAWNWIYLYKMAFAQHQANIAGMEPFDNLCAKKMDWTGSLWEWFTSSWTYKD
FT                   DPCQKYYELLIVNPIWLVPPTKALAITFTNFVTEPLKHIGKGAGEFIKALMKEIPVLLQ
FT                   IPVLAILALAVLSFCYGAGRSVPMLRHFGGPDREPPRALEPDDRRRQKGLDYRLHGGAG
FT                   DADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLRAFDLPDTEAQEHPEV
FT                   VPSHKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSSPTVDKAQLKTDSEC
FT                   SPPGGCPPSKEAAVAAHGTEPVSSPCG"
FT   CDS             join(2367227..2367229,2374243..2374383,2374820..2374921,
FT                   2376412..2376519,2380851..2381072,2381587..2381727,
FT                   2383790..2383883,2385708..2385805,2386169..2386315,
FT                   2387574..2387900,2389622..2389873)
FT                   /codon_start=1
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /product="chloride channel CLIC-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG4070.4 transcript_id=mCT185572.0
FT                   protein_id=mCP106831.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AEM2"
FT                   /db_xref="InterPro:IPR009231"
FT                   /db_xref="MGI:MGI:2385186"
FT                   /db_xref="UniProtKB/TrEMBL:A2AEM2"
FT                   /protein_id="EDL01981.1"
FT                   /translation="MALFRMLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMR
FT                   KSQVRSGTSEKKEVSPDSSEAEELSDCLHRLDSLTHKVDSCEKKKMKDYESQSNPVFRR
FT                   YLNKILIEAGKLGLPDENKVEMRYDAEILLSRQTLLEIQKFLSGEEWKPGALDDALSDI
FT                   LINFKCHDSEAWKWQFEDYFGVDPYNVFMVLLCLLCLVVLVATELWTYVRWYTQMKRIF
FT                   IISFLLSLAWNWIYLYKMAFAQHQANIAGMEPFDNLCAKKMDWTGSLWEWFTSSWTYKD
FT                   DPCQKYYELLIVNPIWLVPPTKALAITFTNFVTEPLKHIGKGAGEFIKALMKEIPVLLQ
FT                   IPVLAILALAVLSFCYGAGRSVPMLRHFGGPDREPPRALEPDDRRRQKGLDYRLHGGAG
FT                   DADFSYRGPAGSIEQGPYDKMHASKRDALRQRFHSGNKSPEVLRAFDLPDTEAQEHPEV
FT                   VPSHKSPIMNTNLETGELPGESTPTEYSQSAKDVSGQVPSAGKSSPTVDKAQLKTDSEC
FT                   SPPGGCPPSKEAAVAAHGTEPVSSPCG"
FT   CDS             join(2374255..2374383,2374820..2374921,2375397..2375504)
FT                   /codon_start=1
FT                   /gene="Clcc1"
FT                   /locus_tag="mCG_4070"
FT                   /product="chloride channel CLIC-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG4070.4 transcript_id=mCT185573.0
FT                   protein_id=mCP106830.0 isoform=CRA_b"
FT                   /protein_id="EDL01979.1"
FT                   /translation="MLCRLLLCECLLLITGYAHDDDWIDPTDMLNYDAASGTMRKSQVR
FT                   SGTSEKKEVSPDSSEAEELSDCLHRLDSLTHKTGFICIALTILELTLYTRLASNSEIRL
FT                   PLPPECWD"
FT   assembly_gap    2387393..2387455
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   gene            complement(2392027..2435100)
FT                   /gene="Gpsm2"
FT                   /locus_tag="mCG_121182"
FT                   /note="gene_id=mCG121182.0"
FT   mRNA            complement(join(2392027..2392740,2394943..2395160,
FT                   2395609..2395762,2399757..2399936,2402703..2402773,
FT                   2409880..2410009,2410459..2410567,2411849..2412004,
FT                   2413595..2413710,2413818..2413941,2414676..2414818,
FT                   2415330..2415465,2415796..2416017,2424208..2424511,
FT                   2434972..2435100))
FT                   /gene="Gpsm2"
FT                   /locus_tag="mCG_121182"
FT                   /product="G-protein signalling modulator 2 (AGS3-like, C.
FT                   elegans)"
FT                   /note="gene_id=mCG121182.0 transcript_id=mCT122378.1
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(2392516..2392740,2394943..2395160,
FT                   2395609..2395762,2399757..2399936,2402703..2402773,
FT                   2409880..2410009,2410459..2410567,2411849..2412004,
FT                   2413595..2413710,2413818..2413941,2414676..2414818,
FT                   2415330..2415465,2415796..2416017,2424208..2424263))
FT                   /codon_start=1
FT                   /gene="Gpsm2"
FT                   /locus_tag="mCG_121182"
FT                   /product="G-protein signalling modulator 2 (AGS3-like, C.
FT                   elegans)"
FT                   /note="gene_id=mCG121182.0 transcript_id=mCT122378.1
FT                   protein_id=mCP60222.1"
FT                   /db_xref="GOA:Q3UPG3"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1923373"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPG3"
FT                   /protein_id="EDL01982.1"
FT                   /translation="MEGNLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVS
FT                   FFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGDQLGEAKA
FT                   SGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPG
FT                   PQDTGEFPEDVRNALQAAVDLYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAV
FT                   IAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVE
FT                   AQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQ
FT                   AMHFAEKHLEISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSMMSENIEIDGSLHGA
FT                   GAKLGRRHSMENLELMKLTPEKVPNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKSG
FT                   SACTKVLQDASNSVDHRAPRSQKKISSDTIGDEGFFDLLRRFQSNRMDDQRCHLQGNCR
FT                   TTSTAAASATPKLMKAPSVSVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTKG
FT                   NSPSVLERLMTNDKKEPDEDFFDILVKCQGSRLDDQRCAPPSAATKGPTVPDEDFFSLI
FT                   LRSQAKRMDEQRVLLQRDPNRDSEFGLKELLQNNALLEFKHSGK"
FT   assembly_gap    2439133..2439152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2462835..2462854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2464624..>2488432
FT                   /locus_tag="mCG_61546"
FT                   /note="gene_id=mCG61546.2"
FT   mRNA            join(<2464624..2465601,2469408..2469447,2469691..2469836,
FT                   2470191..2470253,2478060..2478187,2478341..2478445,
FT                   2484987..2485084,2488054..2488176,2488263..>2488432)
FT                   /locus_tag="mCG_61546"
FT                   /product="mCG61546"
FT                   /note="gene_id=mCG61546.2 transcript_id=mCT61729.2 created
FT                   on 05-JUN-2002"
FT   CDS             join(2464624..2465601,2469408..2469447,2469691..2469836,
FT                   2470191..2470253,2478060..2478187,2478341..2478445,
FT                   2484987..2485084,2488054..2488176,2488263..2488432)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61546"
FT                   /product="mCG61546"
FT                   /note="gene_id=mCG61546.2 transcript_id=mCT61729.2
FT                   protein_id=mCP39978.2"
FT                   /protein_id="EDL01983.1"
FT                   /translation="MDETDFSEDMTYKQQEDLPYDGDFSQMKMCTSYNFTITNDTSPVS
FT                   AEVVLAGEDPQEVASNCEVRQDTALLATWDKMTELVGNRHDKDKQCALASPVPADKEDT
FT                   SKSHVSDILLHHLSGEQFFRGPGAGYETLPETSNADSLEGSDTLINIISCYAKKYYPKE
FT                   QIPEFTGQPSPQNGSINSSKPCCSPGTEEENASPLEEAVAAGKSTHQEDPSFLTRTKGP
FT                   GDKYKSCLRQTPQRQLPDKANSGDWLRYSQAQVHYQFPDFPKVSPKGKLSSKPLTTANE
FT                   GGHSPRLTNKSTVVQDNLGTTSGSNRVEKQPEQKWKFPEPSQQIQVQPATHTCQEPLTG
FT                   LEPEKCCLNLTPTPQKDPFSNSYIFQKISHGKQMCQKLKEQTDQLKNKVQEFSKRIKQD
FT                   SFCHLQDIRLMNKEHAGSLPGPWGSRGSEVTGLPRGGPQEATSKELSELALKMALTQWC
FT                   LIGGSFHRVRSMDLNSMGLPPAGEGNSELKQKMEKRGHRRTNCGKFSSSIHEKTLPQDS
FT                   ALGTDPGPDFCPDPGTGLQSNKCEAYGSKTQNSQRVCEEDPPKEFYYRYNTPGQDDLNH
FT                   GGGYIFVQPHFLYENKISASCKYISCITLSVSVTAFVGPL"
FT   assembly_gap    2478880..2479140
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    2489731..2490053
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    2491481..2491500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2494185..2495311
FT                   /locus_tag="mCG_140499"
FT                   /note="gene_id=mCG140499.0"
FT   mRNA            join(2494185..2494252,2494919..2495311)
FT                   /locus_tag="mCG_140499"
FT                   /product="mCG140499"
FT                   /note="gene_id=mCG140499.0 transcript_id=mCT169808.0
FT                   created on 05-JUN-2002"
FT   CDS             join(2494232..2494252,2494919..2495053)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140499"
FT                   /product="mCG140499"
FT                   /note="gene_id=mCG140499.0 transcript_id=mCT169808.0
FT                   protein_id=mCP92662.0"
FT                   /protein_id="EDL01984.1"
FT                   /translation="MEEMESKILNSPLEHALRTATILKKNTDQMIRSIAEDLAKAQGWR
FT                   HQLRYY"
FT   gene            complement(2506182..2553298)
FT                   /gene="Stxbp3a"
FT                   /locus_tag="mCG_4060"
FT                   /note="gene_id=mCG4060.1"
FT   mRNA            complement(join(2506182..2506866,2507804..2507955,
FT                   2510366..2510451,2512209..2512301,2513040..2513146,
FT                   2513720..2513858,2515096..2515176,2516532..2516597,
FT                   2518044..2518101,2518224..2518319,2522859..2522987,
FT                   2525864..2525954,2534552..2534652,2535279..2535357,
FT                   2538770..2538846,2539790..2539871,2540337..2540386,
FT                   2553216..2553298))
FT                   /gene="Stxbp3a"
FT                   /locus_tag="mCG_4060"
FT                   /product="syntaxin binding protein 3A"
FT                   /note="gene_id=mCG4060.1 transcript_id=mCT1650.2 created on
FT                   05-JUN-2002"
FT   CDS             complement(join(2506775..2506866,2507804..2507955,
FT                   2510366..2510451,2512209..2512301,2513040..2513146,
FT                   2513720..2513858,2515096..2515176,2516532..2516597,
FT                   2518044..2518101,2518224..2518319,2522859..2522896))
FT                   /codon_start=1
FT                   /gene="Stxbp3a"
FT                   /locus_tag="mCG_4060"
FT                   /product="syntaxin binding protein 3A"
FT                   /note="gene_id=mCG4060.1 transcript_id=mCT1650.2
FT                   protein_id=mCP19749.1"
FT                   /protein_id="EDL01985.1"
FT                   /translation="MIYYQLRMIHTSKYKTDGKEKEAVLEEDDDLWVRVRHRHIAVVLE
FT                   EIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQISKQVVHLNLAEDCMNKFKLN
FT                   IEKLCKTEQDLALGTDAEGQRVKDSMLVLLPVLLNKNHDNCDKIRAVLLYIFGINGTTE
FT                   ENLDRLIHNVKIEDDSDMIRNWSHLGVPIVPPSQQAKPLRKDRSAEETFQLSRWTPFIK
FT                   DIMEDAIDNRLDSKEWPYCSRCPAVWNGSGAVSARQKPRTNYLELDRKNGSRLIIFVIG
FT                   GITYSEMRCAYEVSQAHKSCEVIIGSTHILTPRKLLDDIKMLNKSKDKVSFKDE"
FT   assembly_gap    2509381..2509400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2528787..2530302
FT                   /estimated_length=1516
FT                   /gap_type="unknown"
FT   assembly_gap    2547758..2548022
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    2549127..2549146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2553318..2553377
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            complement(2568108..2602677)
FT                   /gene="Fndc7"
FT                   /locus_tag="mCG_4075"
FT                   /note="gene_id=mCG4075.2"
FT   mRNA            complement(join(2568108..2569052,2569136..2569197,
FT                   2571665..2571694,2575514..2575774,2579847..2580101,
FT                   2581829..2582083,2583259..2583516,2584849..2585103,
FT                   2589195..2589452,2594110..2594370,2596156..2596421,
FT                   2602307..2602677))
FT                   /gene="Fndc7"
FT                   /locus_tag="mCG_4075"
FT                   /product="fibronectin type III domain containing 7,
FT                   transcript variant mCT182005"
FT                   /note="gene_id=mCG4075.2 transcript_id=mCT182005.0 created
FT                   on 15-APR-2003"
FT   mRNA            complement(join(<2569154..2569197,2571665..2571694,
FT                   2575514..2575774,2579847..2580101,2581829..2582083,
FT                   2583259..2583516,2584849..2585103,2589195..2589452,
FT                   2594110..2594370,2596156..2596410,2601760..2601778,
FT                   2602311..>2602373))
FT                   /gene="Fndc7"
FT                   /locus_tag="mCG_4075"
FT                   /product="fibronectin type III domain containing 7,
FT                   transcript variant mCT1640"
FT                   /note="gene_id=mCG4075.2 transcript_id=mCT1640.3 created on
FT                   15-APR-2003"
FT   CDS             complement(join(2569154..2569197,2571665..2571694,
FT                   2575514..2575774,2579847..2580101,2581829..2582083,
FT                   2583259..2583516,2584849..2585103,2589195..2589452,
FT                   2594110..2594370,2596156..2596410,2601760..2601778,
FT                   2602311..2602373))
FT                   /codon_start=1
FT                   /gene="Fndc7"
FT                   /locus_tag="mCG_4075"
FT                   /product="fibronectin type III domain containing 7, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4075.2 transcript_id=mCT1640.3
FT                   protein_id=mCP19741.3 isoform=CRA_a"
FT                   /protein_id="EDL01986.1"
FT                   /translation="MAGRPEKCFSLIRFTLLCLKMVISSKTAPEIPTIDQAYSKISNSI
FT                   TVEWTTVPGATSYLLTAEDGNTIIETTVANSPGTVTGLKAATLYQITIRSISASGQSQA
FT                   SSPKQAKTVLAAPVLEVSSPSPDSILVSWDAVYMAIGFSVSVMRANGLGRIWKENTTNT
FT                   SLTFSSLDAGTLYTIKAYAWNANGIPGDDSTRNQRTSPRAPANIQVFFDSGALKASVSW
FT                   TPTEGAFNYTVVASSDSSQRSCSTTLSSCSISSLQCGTEYLISVSANNDAGSSKSCSAP
FT                   TLKTVACAPGRVMIQEEPPGHLSVAWSNVELGDYYVAFVKSDDGLEVHCNTSLTQCNFL
FT                   SECGFTYFISVFAYNKAGQSPLGDVFNYTTAPCCPNDISPVLVSSDRVEIAWSPVRGAE
FT                   LYETKAIAGYSIVECNDTAPACTLSALDCDTKYNVTVYSFSEVRGSNLSCSSHFITTAP
FT                   CSPEIKNISKDAFSMINVHWRSTNEGATYTVTAQGKKGLFQCSSTGETCRMGGLPCGSM
FT                   FSVTAVAETQAGKSLPSYSVPLETVPCCPAGLTAAQVTQSIINVSWTAGAVAQTYAAVL
FT                   ESYIGQSKCHTHQNHCLLGCITCGINYTVALKAISSTGLTADCAYQSYSSSVCCPLGVK
FT                   LYRLGPNGIRIYWRASRGAANYSTDLYGSKGIFTCAPHAGLSFCDITNIPCGDVYTVMV
FT                   SPVAETGLKLTFCPKKIYSVTCSGSTLGMVIYRGKRNDTASPR"
FT   CDS             complement(join(2569154..2569197,2571665..2571694,
FT                   2575514..2575774,2579847..2580101,2581829..2582083,
FT                   2583259..2583516,2584849..2585103,2589195..2589452,
FT                   2594110..2594296))
FT                   /codon_start=1
FT                   /gene="Fndc7"
FT                   /locus_tag="mCG_4075"
FT                   /product="fibronectin type III domain containing 7, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4075.2 transcript_id=mCT182005.0
FT                   protein_id=mCP104927.0 isoform=CRA_b"
FT                   /protein_id="EDL01987.1"
FT                   /translation="MAIGFSVSVMRANGLGRIWKENTTNTSLTFSSLDAGTLYTIKAYA
FT                   WNANGIPGDDSTRNQRTSPRAPANIQVFFDSGALKASVSWTPTEGAFNYTVVASSDSSQ
FT                   RSCSTTLSSCSISSLQCGTEYLISVSANNDAGSSKSCSAPTLKTVACAPGRVMIQEEPP
FT                   GHLSVAWSNVELGDYYVAFVKSDDGLEVHCNTSLTQCNFLSECGFTYFISVFAYNKAGQ
FT                   SPLGDVFNYTTAPCCPNDISPVLVSSDRVEIAWSPVRGAELYETKAIAGYSIVECNDTA
FT                   PACTLSALDCDTKYNVTVYSFSEVRGSNLSCSSHFITTAPCSPEIKNISKDAFSMINVH
FT                   WRSTNEGATYTVTAQGKKGLFQCSSTGETCRMGGLPCGSMFSVTAVAETQAGKSLPSYS
FT                   VPLETVPCCPAGLTAAQVTQSIINVSWTAGAVAQTYAAVLESYIGQSKCHTHQNHCLLG
FT                   CITCGINYTVALKAISSTGLTADCAYQSYSSSVCCPLGVKLYRLGPNGIRIYWRASRGA
FT                   ANYSTDLYGSKGIFTCAPHAGLSFCDITNIPCGDVYTVMVSPVAETGLKLTFCPKKIYS
FT                   VTCSGSTLGMVIYRGKRNDTASPR"
FT   assembly_gap    2588758..2588867
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    2592864..2592998
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   gene            2594611..2595479
FT                   /pseudo
FT                   /locus_tag="mCG_4056"
FT                   /note="gene_id=mCG4056.0"
FT   mRNA            2594611..2595479
FT                   /pseudo
FT                   /locus_tag="mCG_4056"
FT                   /note="gene_id=mCG4056.0 transcript_id=mCT1657.0 created on
FT                   05-JUN-2002"
FT   assembly_gap    2598861..2598880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2603914..2604023
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    2605030..2610679
FT                   /estimated_length=5650
FT                   /gap_type="unknown"
FT   gene            complement(2615442..2624875)
FT                   /gene="Prpf38b"
FT                   /locus_tag="mCG_4049"
FT                   /note="gene_id=mCG4049.2"
FT   mRNA            complement(join(2615442..2617885,2618234..2618457,
FT                   2620937..2620997,2621082..2621233,2621486..2621554,
FT                   2624314..2624875))
FT                   /gene="Prpf38b"
FT                   /locus_tag="mCG_4049"
FT                   /product="PRP38 pre-mRNA processing factor 38 (yeast)
FT                   domain containing B"
FT                   /note="gene_id=mCG4049.2 transcript_id=mCT1664.2 created on
FT                   19-JUN-2003"
FT   CDS             complement(join(2617042..2617885,2618234..2618457,
FT                   2620937..2620997,2621082..2621233,2621486..2621554,
FT                   2624314..2624592))
FT                   /codon_start=1
FT                   /gene="Prpf38b"
FT                   /locus_tag="mCG_4049"
FT                   /product="PRP38 pre-mRNA processing factor 38 (yeast)
FT                   domain containing B"
FT                   /note="gene_id=mCG4049.2 transcript_id=mCT1664.2
FT                   protein_id=mCP19762.2"
FT                   /protein_id="EDL01988.1"
FT                   /translation="MANNSPALTGNSQPQHQAAAAVTQQQQQCGGGGGATKPAVSGKQG
FT                   NVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEKGS
FT                   RKTAGQTGMCGGVRGVGTGGIVSTAFCLLYKLFTLKLTRKQVMGLITHTDSPYIRALGF
FT                   MYIRYTQPPTDLWDWFESFLDDEEDLDVKAGGGCVMTIGEMLRSFLTKLEWFSTLFPRI
FT                   PVPVQKNIDQQIKTRPRKIKKDGKEGIEEIDRHVERRRSRSPRRSLSPRRSPRRSRSRS
FT                   HHREGHGSSSFDRELEREKERQRLEREAKEREKERRRSRSIDRGLDRRRSRSRERHRSR
FT                   SRSRDRKGDRRDRDREREKENERGRRRDRDYDKERGSDRERDRERSRERSKEQRSRGDG
FT                   EEKKHKEDKEDRRHRDDKKESKKKHSRSRSRERKHRSRSRNAGKRSRSRSKDKSSRHKN
FT                   ESKEKANKRSRSGSQGRTGSVEKRKREHSPSREKSRKRSRSQDRSHKREHNDSKDQSDR
FT                   QDHQSSQSGEPESQEKEHKSKDETV"
FT   assembly_gap    2620213..2620232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2626710..2626729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2638392..2638869
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   gene            2653525..2672669
FT                   /gene="4921515J06Rik"
FT                   /locus_tag="mCG_4054"
FT                   /note="gene_id=mCG4054.2"
FT   mRNA            join(2653525..2653844,2654683..2654830,2656141..2656269,
FT                   2666223..2666335,2667212..2667346,2670963..2671142,
FT                   2671890..2672067,2672405..2672669)
FT                   /gene="4921515J06Rik"
FT                   /locus_tag="mCG_4054"
FT                   /product="RIKEN cDNA 4921515J06"
FT                   /note="gene_id=mCG4054.2 transcript_id=mCT1665.2 created on
FT                   05-JUN-2002"
FT   CDS             join(2654807..2654830,2656141..2656269,2666223..2666335,
FT                   2667212..2667346,2670963..2671142,2671890..2672067,
FT                   2672405..2672434)
FT                   /codon_start=1
FT                   /gene="4921515J06Rik"
FT                   /locus_tag="mCG_4054"
FT                   /product="RIKEN cDNA 4921515J06"
FT                   /note="gene_id=mCG4054.2 transcript_id=mCT1665.2
FT                   protein_id=mCP19767.2"
FT                   /db_xref="GOA:A2AED5"
FT                   /db_xref="InterPro:IPR026610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1913965"
FT                   /db_xref="UniProtKB/TrEMBL:A2AED5"
FT                   /protein_id="EDL01989.1"
FT                   /translation="MEMAESIPCNSVVGGNFKEVSPEKVIRFKPPLYKQRYQFVRDLVD
FT                   RHEPKKVADLGCGDAKLLKLLKIYPCIQLLVGVDINEEKLHSNGHRLSPYLGEFVKPRD
FT                   LDLTVTLYHGSVVERDSRLLGFDLITCIELIEHLDSDDLARFPDVVFGYLSPAMVVIST
FT                   PNAEFNPLFPTVTLRDADHKFEWSRMEFQTWALHVANCYNYRVEFTGVGTPPAGSEHVG
FT                   YCTQIGVFTKNGGKLSKPSVSQQCDQHVYKPGLTLYPQLA"
FT   assembly_gap    2660679..2660698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2667864..2668358
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    2669083..2669122
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    2669695..2669999
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   gene            complement(2687220..>2743503)
FT                   /locus_tag="mCG_54122"
FT                   /note="gene_id=mCG54122.2"
FT   mRNA            complement(join(2687220..2688690,2692170..2692239,
FT                   2693006..2693133,2693400..2693619,2694469..2694564,
FT                   2698633..2698736,2701628..2701674,2705943..2706059,
FT                   2710352..2710381,2719510..2719630,2743415..>2743503))
FT                   /locus_tag="mCG_54122"
FT                   /product="mCG54122"
FT                   /note="gene_id=mCG54122.2 transcript_id=mCT54305.2 created
FT                   on 21-APR-2003"
FT   CDS             complement(join(2688648..2688690,2692170..2692239,
FT                   2693006..2693133,2693400..2693619,2694469..2694564,
FT                   2698633..2698736,2701628..2701674,2705943..2706059,
FT                   2710352..2710381,2719510..2719630,2743415..>2743503))
FT                   /codon_start=1
FT                   /locus_tag="mCG_54122"
FT                   /product="mCG54122"
FT                   /note="gene_id=mCG54122.2 transcript_id=mCT54305.2
FT                   protein_id=mCP39975.2"
FT                   /protein_id="EDL01990.1"
FT                   /translation="ELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVHWRKKFS
FT                   FMCKMSASASTGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLE
FT                   GYDTKNTRQDNSILKVLISMQLMSGDPCFKTPPSTSMSIPIAGESESLEEDRKGGETLK
FT                   VHLGIADLSAKSASVPDELGAWGHSRTSSYASQQSKVSGYSTCHSRSSSFSEFCHRRNT
FT                   SVGSTSTGIESILEPCDETEPITAEPSPDPTAAAATATTTTAKEEEASEKLARCPVKQD
FT                   SVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPN
FT                   RVGSGAYEQVVIKR"
FT   assembly_gap    2689685..2689704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2712851..2715842
FT                   /estimated_length=2992
FT                   /gap_type="unknown"
FT   assembly_gap    2738224..2738243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2743549..2743903
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   gene            complement(2744045..2744590)
FT                   /locus_tag="mCG_140538"
FT                   /note="gene_id=mCG140538.0"
FT   mRNA            complement(2744045..2744590)
FT                   /locus_tag="mCG_140538"
FT                   /product="mCG140538"
FT                   /note="gene_id=mCG140538.0 transcript_id=mCT169956.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(2744366..2744476)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140538"
FT                   /product="mCG140538"
FT                   /note="gene_id=mCG140538.0 transcript_id=mCT169956.0
FT                   protein_id=mCP92664.0"
FT                   /protein_id="EDL01991.1"
FT                   /translation="MTGNTRHSPLLGHLVWPQHILIFSFLLADFHLMFKS"
FT   assembly_gap    2755563..2757108
FT                   /estimated_length=1546
FT                   /gap_type="unknown"
FT   assembly_gap    2775348..2775367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2788446..2788465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2794750..>2796577)
FT                   /locus_tag="mCG_1026341"
FT                   /note="gene_id=mCG1026341.0"
FT   mRNA            complement(join(2794750..2795930,2796320..>2796577))
FT                   /locus_tag="mCG_1026341"
FT                   /product="mCG1026341"
FT                   /note="gene_id=mCG1026341.0 transcript_id=mCT144045.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(2795694..2795930,2796320..>2796406))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026341"
FT                   /product="mCG1026341"
FT                   /note="gene_id=mCG1026341.0 transcript_id=mCT144045.0
FT                   protein_id=mCP60182.0"
FT                   /protein_id="EDL01992.1"
FT                   /translation="GEHISQEVQLALQNLLTSFPRSFPEPLSKNAVSGAGVSLTSGPTL
FT                   STELVPGCQGYTEKPSGVGDRTHYHHHLPTEPPDITKLNKYSKCFDFLTQVFPPSCWPC
FT                   SSS"
FT   gene            2796629..2832728
FT                   /locus_tag="mCG_4550"
FT                   /note="gene_id=mCG4550.1"
FT   mRNA            join(2796629..2796889,2801878..2802004,2810351..2810438,
FT                   2814724..2814835,2818855..2819013,2823266..2823418,
FT                   2827063..2827170,2828051..2828218,2828809..2828956,
FT                   2832379..2832728)
FT                   /locus_tag="mCG_4550"
FT                   /product="mCG4550"
FT                   /note="gene_id=mCG4550.1 transcript_id=mCT3425.2 created on
FT                   05-JUN-2002"
FT   CDS             join(2796707..2796889,2801878..2802004,2810351..2810438,
FT                   2814724..2814835,2818855..2819013,2823266..2823418,
FT                   2827063..2827170,2828051..2828218,2828809..2828956,
FT                   2832379..2832554)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4550"
FT                   /product="mCG4550"
FT                   /note="gene_id=mCG4550.1 transcript_id=mCT3425.2
FT                   protein_id=mCP19769.2"
FT                   /db_xref="GOA:B1AUS6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:1921936"
FT                   /db_xref="UniProtKB/TrEMBL:B1AUS6"
FT                   /protein_id="EDL01993.1"
FT                   /translation="MLRRLQDFLLPSEACQNDYNRLAYEVLFEDLDHNGDGVVDITELR
FT                   DGLKHWNSSFSEDTEKEIFMDADSNADSGLDFEEFVQYLQDHEKKMKLAFKSLDKNDDG
FT                   VIDASEIVAAVRSLGIHISLSQAKDILKSMDFDGSMTVDWDEWRDFFFFHPAKNITDIV
FT                   RFWKHSTIIDIGESISIPDEFTEQEKMSGEWWKRLVAAGIASAITRTCTAPLERLKVTM
FT                   QVQSLKVNKMGLVHMFKQMVKEGGFFSLWRGNGVNILKIAPETAIKIGAYEQYKKLLSF
FT                   DGDHLGVLQRFTAGCMAGATSQTCVYPMEVIKTRLNLSKTGEYSGLVDCVRKLLKREGI
FT                   QAFSKGYVPNLLSIIPYAGLDLTIFELLKNHWLEHYAGNSVNPGIAIVLGCSTVSHTCG
FT                   QLASFPLILVRTRMQAVMLEKETVRMMQLIQEIYTKEGKKGFFRGFTPNVLKLLPAVGI
FT                   GSVAHELVKRLFGLI"
FT   assembly_gap    2821607..2821626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2824596..2824615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2839368..2839387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2839426..2881462
FT                   /gene="Slc25a24"
FT                   /locus_tag="mCG_4551"
FT                   /note="gene_id=mCG4551.1"
FT   mRNA            join(2839426..2839671,2852950..2853076,2862526..2862613,
FT                   2868033..2868144,2869859..2870017,2871510..2871656,
FT                   2872360..2872467,2874229..2874396,2876431..2876581,
FT                   2879338..2881462)
FT                   /gene="Slc25a24"
FT                   /locus_tag="mCG_4551"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   phosphate carrier), member 24"
FT                   /note="gene_id=mCG4551.1 transcript_id=mCT3422.2 created on
FT                   05-JUN-2002"
FT   CDS             join(2839489..2839671,2852950..2853076,2862526..2862613,
FT                   2868033..2868144,2869859..2870017,2871510..2871656,
FT                   2872360..2872467,2874229..2874396,2876431..2876581,
FT                   2879338..2879522)
FT                   /codon_start=1
FT                   /gene="Slc25a24"
FT                   /locus_tag="mCG_4551"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   phosphate carrier), member 24"
FT                   /note="gene_id=mCG4551.1 transcript_id=mCT3422.2
FT                   protein_id=mCP19775.2"
FT                   /protein_id="EDL01994.1"
FT                   /translation="MLRWLRAFVLPTAACHDAEPPTRYETLFRALDRNGDGVVDIGELQ
FT                   QGLQSLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDG
FT                   KIEPSEIVQSLQMLGLHISEKQAELILQSIDSDGTMTVDWNEWRDYFLFNPVTDIEEII
FT                   RFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGVAGAVSRTSTAPLDRLKVMM
FT                   QVHGSKSMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEG
FT                   QKLGTFERFISGSMAGATAQTFIYPMEVLKTRLAVAKTGQYSGIYGCAKKILKHEGFGA
FT                   FYKGYIPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLSCGALSSTCGQL
FT                   ASYPLALVRTRMQAQATVEGAPQLSMVGLFQRIVSKEGVSGLYRGITPNFMKVLPAVGI
FT                   SYVVYENMKQTLGVAQK"
FT   assembly_gap    2848065..2848084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2854928..2855001
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    2856303..2857330
FT                   /estimated_length=1028
FT                   /gap_type="unknown"
FT   assembly_gap    2859647..2859782
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    2868863..2868882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2885849..2885993
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    2886766..2887242
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   assembly_gap    2901318..2901369
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    2952780..2952944
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    2976776..2976916
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    3008009..3008028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3009557..3009576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3018201..3018220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3031276..3032627
FT                   /estimated_length=1352
FT                   /gap_type="unknown"
FT   assembly_gap    3033390..3033832
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    3037229..3037363
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    3051161..3051209
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3054142..3054460
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   gene            <3054568..3395391
FT                   /gene="Vav3"
FT                   /locus_tag="mCG_4549"
FT                   /note="gene_id=mCG4549.1"
FT   mRNA            join(3054568..3054797,3137806..3137922,3208402..3208460,
FT                   3210512..3210577,3215002..3215110,3217033..3217125,
FT                   3220025..3220103,3222427..3222517,3224516..3224615,
FT                   3229635..3229730,3233079..3233147,3235087..3235173,
FT                   3239555..3239640,3241100..3241232,3241961..3242070,
FT                   3276425..3276526,3276786..3276886,3287816..3287841,
FT                   3292029..3292074,3341147..3341283,3360812..3360877,
FT                   3364921..3364955,3370354..3370470,3371034..3371121,
FT                   3377464..3377593,3393884..3394035,3394646..3395391)
FT                   /gene="Vav3"
FT                   /locus_tag="mCG_4549"
FT                   /product="vav 3 oncogene, transcript variant mCT3424"
FT                   /note="gene_id=mCG4549.1 transcript_id=mCT3424.2 created on
FT                   05-JUN-2002"
FT   mRNA            join(<3054568..3054797,3137806..3137922,3208402..3208460,
FT                   3210512..3210577,3215002..3215110,3217033..3217125,
FT                   3220025..3220093,3222413..3222517,3224516..3224615,
FT                   3229635..3229730,3233079..3233147,3235087..3235173,
FT                   3239555..3239640,3241100..3241232,3241961..3242070,
FT                   3276425..3276526,3276786..3276886,3287816..3287841,
FT                   3292029..3292074,3341147..3341283,3360812..3360877,
FT                   3364921..3364955,3370354..3370470,3371034..3371121,
FT                   3377464..3377593,3393884..3394035,3394646..3395391)
FT                   /gene="Vav3"
FT                   /locus_tag="mCG_4549"
FT                   /product="vav 3 oncogene, transcript variant mCT189466"
FT                   /note="gene_id=mCG4549.1 transcript_id=mCT189466.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(3054594..3054797,3137806..3137922,3208402..3208460,
FT                   3210512..3210577,3215002..3215110,3217033..3217125,
FT                   3220025..3220103,3222427..3222517,3224516..3224615,
FT                   3229635..3229730,3233079..3233147,3235087..3235173,
FT                   3239555..3239640,3241100..3241232,3241961..3242070,
FT                   3276425..3276526,3276786..3276886,3287816..3287841,
FT                   3292029..3292074,3341147..3341283,3360812..3360877,
FT                   3364921..3364955,3370354..3370470,3371034..3371121,
FT                   3377464..3377593,3393884..3394035,3394646..3394687)
FT                   /codon_start=1
FT                   /gene="Vav3"
FT                   /locus_tag="mCG_4549"
FT                   /product="vav 3 oncogene, isoform CRA_b"
FT                   /note="gene_id=mCG4549.1 transcript_id=mCT3424.2
FT                   protein_id=mCP19756.2 isoform=CRA_b"
FT                   /protein_id="EDL01996.1"
FT                   /translation="MEPWKQCAQWLIHSKVLPPNHRVTWDSAQVFDLAQTLRDGVLLCQ
FT                   LLNNLRPHSINLKEINLRPQMSQFLCLKNIRTFLAACCDTFGMRKSELFEAFDLFDVRD
FT                   FGKVIETLSRLSRTPIALATGIRPFPTEESINDEDIYKGLPDLIDETRVEDEEDLYDCV
FT                   YGEDEGGEVYEDLMKAEEAQQPKSQENDIRSCCLAEIRQTEEKYTETLESIEKYFMAPL
FT                   KRFLTAAEFDSVFINIPVSKVHRSLMQEIHDSIVNKDDQNLYQVFINYKERLVIYGQYC
FT                   SGVESAISNLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQEL
FT                   VKHTHDPMEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGR
FT                   PQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTD
FT                   KENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKM
FT                   HTFTRVTSCRVCQMLLRGTFYQGYLCFKCGAKAHKECLGRVDNCGRVNSVEQGPFKPPE
FT                   KRTNGLRRASRQVDPGLPKMQVIRNYTGTPAPGLHEGPPLHIQAGDTVELLRGDAHSVF
FT                   WQGRNLASGEVGFFPSDAVKPSPCVPKPVDYSCQPWYAGPMERLQAETELINRVNSTYL
FT                   VRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEG
FT                   FRTLDTTLQFPYKEPEQPAGQRGNRTGNSLLSPKVLGIAIARYDFCARDMRELSLLKGD
FT                   MVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE"
FT   assembly_gap    3085120..3085188
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3086959..3086998
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    3094033..3094554
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    3105299..3105318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3107618..3107694
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    3108359..3108383
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    3123589..3123631
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    3152145..3152164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3158951..3158970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3174471..3174493
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    3179087..3179191
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    3199323..3199446
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   CDS             join(<3220056..3220093,3222413..3222517,3224516..3224615,
FT                   3229635..3229730,3233079..3233147,3235087..3235173,
FT                   3239555..3239640,3241100..3241232,3241961..3242070,
FT                   3276425..3276526,3276786..3276886,3287816..3287841,
FT                   3292029..3292074,3341147..3341283,3360812..3360877,
FT                   3364921..3364955,3370354..3370470,3371034..3371121,
FT                   3377464..3377593,3393884..3394035,3394646..3394687)
FT                   /codon_start=1
FT                   /gene="Vav3"
FT                   /locus_tag="mCG_4549"
FT                   /product="vav 3 oncogene, isoform CRA_a"
FT                   /note="gene_id=mCG4549.1 transcript_id=mCT189466.0
FT                   protein_id=mCP110450.0 isoform=CRA_a"
FT                   /protein_id="EDL01995.1"
FT                   /translation="RRRNLIQYLLTFLTLVKVHRSLMQEIHDSIVNKDDQNLYQVFINY
FT                   KERLVIYGQYCSGVESAISNLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQR
FT                   VLKYHLLLQELVKHTHDPMEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIE
FT                   NLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQ
FT                   QYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPD
FT                   YADSNFHDFKMHTFTRVTSCRVCQMLLRGTFYQGYLCFKCGAKAHKECLGRVDNCGRVN
FT                   SVEQGPFKPPEKRTNGLRRASRQVDPGLPKMQVIRNYTGTPAPGLHEGPPLHIQAGDTV
FT                   ELLRGDAHSVFWQGRNLASGEVGFFPSDAVKPSPCVPKPVDYSCQPWYAGPMERLQAET
FT                   ELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELV
FT                   EYYKHHSLKEGFRTLDTTLQFPYKEPEQPAGQRGNRTGNSLLSPKVLGIAIARYDFCAR
FT                   DMRELSLLKGDMVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE"
FT   assembly_gap    3224944..3224977
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    3239052..3239093
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    3300263..3300282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3310797..3310892
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    3328301..3329645
FT                   /estimated_length=1345
FT                   /gap_type="unknown"
FT   assembly_gap    3358683..3358716
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    3437378..3438229
FT                   /estimated_length=852
FT                   /gap_type="unknown"
FT   assembly_gap    3449345..3449680
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    3486203..3486540
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   gene            complement(3491167..3841121)
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /note="gene_id=mCG4552.3"
FT   mRNA            complement(join(3491167..3494028,3538660..3538794,
FT                   3543503..3543670,3562790..3562816,3583159..3583331,
FT                   3645742..3646382,3833179..3833940,3840793..3841121))
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, transcript variant mCT3426"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT3426.2 created on
FT                   12-JUN-2003"
FT   mRNA            complement(join(3491167..3494028,3562790..3562816,
FT                   3583159..3583331,3645742..3646382,3833179..3833940,
FT                   3840793..3840899))
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, transcript variant mCT169815"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT169815.1 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3491167..3494028,3538660..3538794,
FT                   3562790..3562816,3583159..3583331,3645742..3646382,
FT                   3833179..3833940,3840793..3840899))
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, transcript variant mCT169812"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT169812.1 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3491167..3494028,3552541..3552606,
FT                   3562790..3562816,3583159..3583331,3645742..3646382,
FT                   3833179..3833940,3840793..3840899))
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, transcript variant mCT169814"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT169814.1 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3491167..3494028,3550155..3550214,
FT                   3552541..3552606,3562790..3562816,3583159..3583331,
FT                   3645742..3646382,3833179..3833940,3840793..3840899))
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, transcript variant mCT169813"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT169813.1 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(3493799..3494028,3562790..3562816,
FT                   3583159..3583331,3645742..3646382,3833179..3833424))
FT                   /codon_start=1
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, isoform CRA_f"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT169815.1
FT                   protein_id=mCP92656.1 isoform=CRA_f"
FT                   /protein_id="EDL02002.1"
FT                   /translation="MYLSRFLSIHALWVTVSSVMQPYLFVWGHYDVCKSLIYTEEGKVW
FT                   DYTACQPESTDMTKYLKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPE
FT                   LMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILE
FT                   KSLDYGRTWQPYQYYATDCLHAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIH
FT                   FEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHL
FT                   ARYFYAISDIKVRGRCKCNLHATSCLYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSP
FT                   GSYLPIPKGTANTCIPSISSIGTNVCDNELLHCQNGGTCQNNVRCACPDAYTGILCEKL
FT                   RCEEAGSCGSESGQGAPPRGSPALLLLTMLLGTAGPLVF"
FT   CDS             complement(join(3493799..3494028,3538660..3538794,
FT                   3562790..3562816,3583159..3583331,3645742..3646382,
FT                   3833179..3833424))
FT                   /codon_start=1
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, isoform CRA_e"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT169812.1
FT                   protein_id=mCP92666.1 isoform=CRA_e"
FT                   /protein_id="EDL02001.1"
FT                   /translation="MYLSRFLSIHALWVTVSSVMQPYLFVWGHYDVCKSLIYTEEGKVW
FT                   DYTACQPESTDMTKYLKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPE
FT                   LMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILE
FT                   KSLDYGRTWQPYQYYATDCLHAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIH
FT                   FEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHL
FT                   ARYFYAISDIKVRGRCKCNLHATSCLYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSP
FT                   GSYLPIPKGTANTCIPSISSIGKCYCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPG
FT                   NSWYYGCQPNVCDNELLHCQNGGTCQNNVRCACPDAYTGILCEKLRCEEAGSCGSESGQ
FT                   GAPPRGSPALLLLTMLLGTAGPLVF"
FT   CDS             complement(join(3493799..3494028,3538660..3538794,
FT                   3543503..3543670,3562790..3562816,3583159..3583331,
FT                   3645742..3646382,3833179..3833424))
FT                   /codon_start=1
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, isoform CRA_d"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT3426.2
FT                   protein_id=mCP19776.2 isoform=CRA_d"
FT                   /protein_id="EDL02000.1"
FT                   /translation="MYLSRFLSIHALWVTVSSVMQPYLFVWGHYDVCKSLIYTEEGKVW
FT                   DYTACQPESTDMTKYLKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPE
FT                   LMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILE
FT                   KSLDYGRTWQPYQYYATDCLHAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIH
FT                   FEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHL
FT                   ARYFYAISDIKVRGRCKCNLHATSCLYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSP
FT                   GSYLPIPKGTANTCIPSISSIGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELC
FT                   RLGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSW
FT                   YYGCQPNVCDNELLHCQNGGTCQNNVRCACPDAYTGILCEKLRCEEAGSCGSESGQGAP
FT                   PRGSPALLLLTMLLGTAGPLVF"
FT   CDS             complement(join(3493799..3494028,3552541..3552606,
FT                   3562790..3562816,3583159..3583331,3645742..3646382,
FT                   3833179..3833424))
FT                   /codon_start=1
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, isoform CRA_b"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT169814.1
FT                   protein_id=mCP92663.1 isoform=CRA_b"
FT                   /protein_id="EDL01998.1"
FT                   /translation="MYLSRFLSIHALWVTVSSVMQPYLFVWGHYDVCKSLIYTEEGKVW
FT                   DYTACQPESTDMTKYLKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPE
FT                   LMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILE
FT                   KSLDYGRTWQPYQYYATDCLHAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIH
FT                   FEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHL
FT                   ARYFYAISDIKVRGRCKCNLHATSCLYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSP
FT                   GSYLPIPKGTANTCIPSISSIGTPPKFNRIWPNISSLEVSNPKQANVCDNELLHCQNGG
FT                   TCQNNVRCACPDAYTGILCEKLRCEEAGSCGSESGQGAPPRGSPALLLLTMLLGTAGPL
FT                   VF"
FT   CDS             complement(join(3493799..3494028,3550155..3550214,
FT                   3552541..3552606,3562790..3562816,3583159..3583331,
FT                   3645742..3646382,3833179..3833424))
FT                   /codon_start=1
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, isoform CRA_a"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT169813.1
FT                   protein_id=mCP92654.1 isoform=CRA_a"
FT                   /protein_id="EDL01997.1"
FT                   /translation="MYLSRFLSIHALWVTVSSVMQPYLFVWGHYDVCKSLIYTEEGKVW
FT                   DYTACQPESTDMTKYLKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPE
FT                   LMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILE
FT                   KSLDYGRTWQPYQYYATDCLHAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIH
FT                   FEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHL
FT                   ARYFYAISDIKVRGRCKCNLHATSCLYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSP
FT                   GSYLPIPKGTANTCIPSISSIGTPPKFNRIWPNISSLEVSNPKQVAPKLALSTVSSVQV
FT                   ANHKRANVCDNELLHCQNGGTCQNNVRCACPDAYTGILCEKLRCEEAGSCGSESGQGAP
FT                   PRGSPALLLLTMLLGTAGPLVF"
FT   assembly_gap    3520207..3520226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3531732..3531751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3541993..3543670,3562790..3562816,
FT                   3583159..3583331,3645742..3646382,3833179..3833940,
FT                   3840793..3840899))
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, transcript variant mCT182009"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT182009.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(3543441..3543670,3562790..3562816,
FT                   3583159..3583331,3645742..3646382,3833179..3833424))
FT                   /codon_start=1
FT                   /gene="Ntng1"
FT                   /locus_tag="mCG_4552"
FT                   /product="netrin G1, isoform CRA_c"
FT                   /note="gene_id=mCG4552.3 transcript_id=mCT182009.0
FT                   protein_id=mCP104931.0 isoform=CRA_c"
FT                   /protein_id="EDL01999.1"
FT                   /translation="MYLSRFLSIHALWVTVSSVMQPYLFVWGHYDVCKSLIYTEEGKVW
FT                   DYTACQPESTDMTKYLKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPE
FT                   LMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILE
FT                   KSLDYGRTWQPYQYYATDCLHAFHMDPKSVKDLSQHTVLEIICTEEYSTGYSTNSKIIH
FT                   FEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHL
FT                   ARYFYAISDIKVRGRCKCNLHATSCLYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSP
FT                   GSYLPIPKGTANTCIPSISSIGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELC
FT                   RLGYFRNASAQLDDENVCIGQFHYDFSFCSVPLELWGAG"
FT   assembly_gap    3609568..3609587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3618445..3618896
FT                   /pseudo
FT                   /locus_tag="mCG_4553"
FT                   /note="gene_id=mCG4553.1"
FT   mRNA            3618445..3618896
FT                   /pseudo
FT                   /locus_tag="mCG_4553"
FT                   /note="gene_id=mCG4553.1 transcript_id=mCT3418.1 created on
FT                   06-JUN-2002"
FT   assembly_gap    3622188..3622207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3671666..3671810
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    3687628..3687756
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    3689976..3691258
FT                   /estimated_length=1283
FT                   /gap_type="unknown"
FT   assembly_gap    3700064..3702015
FT                   /estimated_length=1952
FT                   /gap_type="unknown"
FT   assembly_gap    3702890..3703843
FT                   /estimated_length=954
FT                   /gap_type="unknown"
FT   assembly_gap    3753365..3753384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3774063..3774082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3795414..3795435
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            <3800836..>3836212
FT                   /locus_tag="mCG_1026344"
FT                   /note="gene_id=mCG1026344.0"
FT   mRNA            join(<3800836..3800873,3814998..3815087,3827627..3827728,
FT                   3829567..3829742,3830460..3830540,3835941..>3836212)
FT                   /locus_tag="mCG_1026344"
FT                   /product="mCG1026344"
FT                   /note="gene_id=mCG1026344.0 transcript_id=mCT144048.0
FT                   created on 06-JUN-2002"
FT   CDS             join(3800836..3800873,3814998..3815087,3827627..3827728,
FT                   3829567..3829742,3830460..3830540,3835941..3836212)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026344"
FT                   /product="mCG1026344"
FT                   /note="gene_id=mCG1026344.0 transcript_id=mCT144048.0
FT                   protein_id=mCP60190.0"
FT                   /protein_id="EDL02003.1"
FT                   /translation="MHSAPDLQTQPESPMRVILLLPRGVYSSILSVEAFHKPYDNPRYY
FT                   FVSIPFRTTRFENSLQLGLDVILTTTTRVRVRDQMILSALYANDIIVTSRPMSSGRGML
FT                   PEACIEAERAGWKRRGYLCCKSKPSQSCAPSAPASSDVIGHNDSGGAEMEASVSECRTW
FT                   TSSGIFLHENCGQEGNAMEMHVTVIPSRNTAALPKQGILIKVHQSCNEGHYTELWTVSL
FT                   IEVRELTGKNAEGCKIFEYEAVAGPCDRHS"
FT   assembly_gap    3811649..3811668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<3841327..>3935327)
FT                   /locus_tag="mCG_53639"
FT                   /note="gene_id=mCG53639.1"
FT   mRNA            complement(join(<3841327..3841508,3849489..3849563,
FT                   3853961..3853980,3904269..3904328,3928823..3928958,
FT                   3935291..>3935327))
FT                   /locus_tag="mCG_53639"
FT                   /product="mCG53639"
FT                   /note="gene_id=mCG53639.1 transcript_id=mCT53822.1 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(3841327..3841508,3849489..3849563,
FT                   3853961..3853980,3904269..3904328,3928823..3928958,
FT                   3935291..3935327))
FT                   /codon_start=1
FT                   /locus_tag="mCG_53639"
FT                   /product="mCG53639"
FT                   /note="gene_id=mCG53639.1 transcript_id=mCT53822.1
FT                   protein_id=mCP39976.1"
FT                   /protein_id="EDL02004.1"
FT                   /translation="MVIMLPVAYSLSFLIPDISRPSQYSEMVRKDTAVFPVIIKVFDVY
FT                   NNDDDNGIIISDRSFASFIAVHRNLCLESYLQRDAQGNQGPPEAGNLRTAFDSSNPSPY
FT                   FIIERAANRNPEASWGHVYFIKRTLGASRLAAINAMFSDISDLSGGMREENRGEIASRG
FT                   SSWRQG"
FT   assembly_gap    3868438..3868485
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    3879372..3879468
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    3906490..3906736
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    3908824..3909519
FT                   /estimated_length=696
FT                   /gap_type="unknown"
FT   gene            complement(3944301..3949512)
FT                   /gene="Prmt6"
FT                   /locus_tag="mCG_50446"
FT                   /note="gene_id=mCG50446.2"
FT   mRNA            complement(join(3944301..3946044,3947876..3949512))
FT                   /gene="Prmt6"
FT                   /locus_tag="mCG_50446"
FT                   /product="protein arginine N-methyltransferase 6,
FT                   transcript variant mCT185343"
FT                   /note="gene_id=mCG50446.2 transcript_id=mCT185343.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(3946738..3949512)
FT                   /gene="Prmt6"
FT                   /locus_tag="mCG_50446"
FT                   /product="protein arginine N-methyltransferase 6,
FT                   transcript variant mCT50629"
FT                   /note="gene_id=mCG50446.2 transcript_id=mCT50629.2 created
FT                   on 13-JUN-2003"
FT   CDS             complement(3948024..3949328)
FT                   /codon_start=1
FT                   /gene="Prmt6"
FT                   /locus_tag="mCG_50446"
FT                   /product="protein arginine N-methyltransferase 6, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG50446.2 transcript_id=mCT185343.0
FT                   protein_id=mCP106601.0 isoform=CRA_a"
FT                   /protein_id="EDL02005.1"
FT                   /translation="MALEENNGVPRLTLVEPLPSGSGMQEADYESQQAPGTLSLRTAPR
FT                   NECWGSAAGAKMSLSKKRKLESGDSGGAGAGGEGAEEENGGEQEAAPPRPRRTKSERDQ
FT                   LYYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILSIFCAQAG
FT                   ARRVYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPERVDAIVSEWMGYGLLH
FT                   ESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLEWRLGFWSQVKQHYGVDMSCM
FT                   ESFATRCLMGHSEIVVQDLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYG
FT                   SAPLHGFAVWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEPVPVEQDTDISGE
FT                   ITLLPSPDNPRRLRILLRYKVGDHEEKTKDFAMED"
FT   CDS             complement(3948024..3949328)
FT                   /codon_start=1
FT                   /gene="Prmt6"
FT                   /locus_tag="mCG_50446"
FT                   /product="protein arginine N-methyltransferase 6, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG50446.2 transcript_id=mCT50629.2
FT                   protein_id=mCP39945.0 isoform=CRA_a"
FT                   /protein_id="EDL02006.1"
FT                   /translation="MALEENNGVPRLTLVEPLPSGSGMQEADYESQQAPGTLSLRTAPR
FT                   NECWGSAAGAKMSLSKKRKLESGDSGGAGAGGEGAEEENGGEQEAAPPRPRRTKSERDQ
FT                   LYYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILSIFCAQAG
FT                   ARRVYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPERVDAIVSEWMGYGLLH
FT                   ESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQMLEWRLGFWSQVKQHYGVDMSCM
FT                   ESFATRCLMGHSEIVVQDLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYG
FT                   SAPLHGFAVWFQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEPVPVEQDTDISGE
FT                   ITLLPSPDNPRRLRILLRYKVGDHEEKTKDFAMED"
FT   assembly_gap    3954699..3954731
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            complement(<3975333..>3975656)
FT                   /locus_tag="mCG_1026309"
FT                   /note="gene_id=mCG1026309.1"
FT   mRNA            complement(<3975333..>3975656)
FT                   /locus_tag="mCG_1026309"
FT                   /product="mCG1026309"
FT                   /note="gene_id=mCG1026309.1 transcript_id=mCT144013.1
FT                   created on 14-AUG-2002"
FT   CDS             complement(3975333..3975656)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026309"
FT                   /product="mCG1026309"
FT                   /note="gene_id=mCG1026309.1 transcript_id=mCT144013.1
FT                   protein_id=mCP60159.1"
FT                   /protein_id="EDL02007.1"
FT                   /translation="MVQHLTFFLKLSYNTVSNKTRLFLTPGYRIICLYIYVPTSVCGMY
FT                   SSRLQAVHAVRPKVLMRLSKMKNHVSRACGVSTGTNCVHDEIQCEFLTEKQKIIVKVLK
FT                   AQS"
FT   assembly_gap    4015824..4015843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4094450..4094923
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    4096342..4096525
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   gene            4097382..4097957
FT                   /pseudo
FT                   /locus_tag="mCG_53640"
FT                   /note="gene_id=mCG53640.2"
FT   mRNA            4097382..4097957
FT                   /pseudo
FT                   /locus_tag="mCG_53640"
FT                   /note="gene_id=mCG53640.2 transcript_id=mCT53823.2 created
FT                   on 07-JUN-2002"
FT   assembly_gap    4116334..4116353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4117702..4117873
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    4119508..4119990
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    4122298..4122317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4177360..4177379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4187918..4190368
FT                   /estimated_length=2451
FT                   /gap_type="unknown"
FT   assembly_gap    4289500..4289519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4305341..4305360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4321249..4321287
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4322400..4322488
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    4377026..4380423
FT                   /estimated_length=3398
FT                   /gap_type="unknown"
FT   assembly_gap    4419704..4419723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4427392..4427411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4472887..4472906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4507758..4507942
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    4598876..4598925
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    4616338..4616357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4641043..4641102
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    4645249..4645319
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    4658897..4658916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4660051..>4811256
FT                   /locus_tag="mCG_1026321"
FT                   /note="gene_id=mCG1026321.0"
FT   mRNA            join(<4660051..4660057,4666976..4667128,4747281..4747441,
FT                   4785904..4786016,4811100..>4811256)
FT                   /locus_tag="mCG_1026321"
FT                   /product="mCG1026321"
FT                   /note="gene_id=mCG1026321.0 transcript_id=mCT144025.0
FT                   created on 07-JUN-2002"
FT   CDS             join(4660051..4660057,4666976..4667128,4747281..4747441,
FT                   4785904..4786016,4811100..4811256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026321"
FT                   /product="mCG1026321"
FT                   /note="gene_id=mCG1026321.0 transcript_id=mCT144025.0
FT                   protein_id=mCP60186.0"
FT                   /protein_id="EDL02008.1"
FT                   /translation="MTGRKGGFKLLWKERVFSSHLCGGKFVKDYSGGCQKIIEMSEPEK
FT                   GQANVYQEGKKEMIAGSRRVNVFDERNTGPSSQEHIYSSIDRNSHLVVSAGGYLWALIQ
FT                   EQQEVRRMFQSDQPFWLLTTAKWKMITIVCSQSVSGGYLLWQKAEAGKHDKSVKALVTL
FT                   LYENALLSSASVLLYENALLGRFPQTHDTAPTG"
FT   assembly_gap    4673976..4673995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4677375..4677394
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4730271..4730290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4739752..4741425
FT                   /estimated_length=1674
FT                   /gap_type="unknown"
FT   assembly_gap    4790452..4790471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4799919..4799980
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    4804147..4804166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4826072..4826091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4833174..4833193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4861069..4861088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4873726..4873745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4898871..4898890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4900200..4900219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4961425..4961444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4962697..4962876
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    4965910..4965929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5019476..5021009)
FT                   /pseudo
FT                   /locus_tag="mCG_10758"
FT                   /note="gene_id=mCG10758.2"
FT   mRNA            complement(5019476..5021009)
FT                   /pseudo
FT                   /locus_tag="mCG_10758"
FT                   /note="gene_id=mCG10758.2 transcript_id=mCT10708.2 created
FT                   on 07-JUN-2002"
FT   assembly_gap    5026491..5026510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5058197..5058216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5063174..5063193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5092659..5092678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5140718..5141033
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    5157685..5157704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5171078..5171707
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    5201402..5201421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5275279..5275405
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    5277138..5277157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5310178..5310197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5320828..5320847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5329048..5329099
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    5348167..5348186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5350486..5350505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5368651..5368851
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    5385012..5385031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5392045..5392131
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    5406422..5406441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5407449..5407468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5409766..5409785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5420658..5423798
FT                   /estimated_length=3141
FT                   /gap_type="unknown"
FT   assembly_gap    5455638..5457541
FT                   /estimated_length=1904
FT                   /gap_type="unknown"
FT   assembly_gap    5460593..5460612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5472164..5472341
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    5480722..5480741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5485360..5487583
FT                   /estimated_length=2224
FT                   /gap_type="unknown"
FT   assembly_gap    5489606..5492055
FT                   /estimated_length=2450
FT                   /gap_type="unknown"
FT   assembly_gap    5500365..5500514
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    5517132..5517545
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    5526711..5527047
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   gene            <5567248..5763773
FT                   /locus_tag="mCG_144525"
FT                   /note="gene_id=mCG144525.0"
FT   mRNA            join(<5567248..5567632,5632844..5632956,5737253..5737305,
FT                   5762401..5763773)
FT                   /locus_tag="mCG_144525"
FT                   /product="mCG144525"
FT                   /note="gene_id=mCG144525.0 transcript_id=mCT183949.0
FT                   created on 05-JUN-2003"
FT   CDS             <5567305..5567520
FT                   /codon_start=1
FT                   /locus_tag="mCG_144525"
FT                   /product="mCG144525"
FT                   /note="gene_id=mCG144525.0 transcript_id=mCT183949.0
FT                   protein_id=mCP105315.0"
FT                   /protein_id="EDL02009.1"
FT                   /translation="TFQIFLRVHFVNHRKICFWVNQRDSNKEGSQDITQAERIPDLQLK
FT                   RAENISSFCERWLQDLTTHSNELFKV"
FT   assembly_gap    5584138..5584157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5589974..5590968
FT                   /estimated_length=995
FT                   /gap_type="unknown"
FT   assembly_gap    5592995..5593014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5646456..5646475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5668383..5668402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5713364..5713389
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    5783790..5792553
FT                   /estimated_length=8764
FT                   /gap_type="unknown"
FT   assembly_gap    5793830..5793849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5797651..5802642
FT                   /estimated_length=4992
FT                   /gap_type="unknown"
FT   assembly_gap    5809013..5809032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5812107..5812126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5832077..5832096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5833111..5833130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5837331..5837350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5838425..5844499
FT                   /estimated_length=6075
FT                   /gap_type="unknown"
FT   assembly_gap    5854843..5854953
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    5872305..5872324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5877173..5877192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5944157..5945506
FT                   /estimated_length=1350
FT                   /gap_type="unknown"
FT   assembly_gap    5952259..5952278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5958654..5958673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5959561..5959930
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    5962269..5962436
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    5966930..5966949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5972650..5972690
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   gene            5994204..5995088
FT                   /pseudo
FT                   /locus_tag="mCG_21543"
FT                   /note="gene_id=mCG21543.0"
FT   mRNA            5994204..5995088
FT                   /pseudo
FT                   /locus_tag="mCG_21543"
FT                   /note="gene_id=mCG21543.0 transcript_id=mCT22837.1 created
FT                   on 07-JUN-2002"
FT   assembly_gap    5999604..5999623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6023180..6024135)
FT                   /pseudo
FT                   /locus_tag="mCG_21544"
FT                   /note="gene_id=mCG21544.2"
FT   mRNA            complement(6023180..6024135)
FT                   /pseudo
FT                   /locus_tag="mCG_21544"
FT                   /note="gene_id=mCG21544.2 transcript_id=mCT22838.2 created
FT                   on 07-JUN-2002"
FT   assembly_gap    6038149..6038168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6041609..6041628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6048536..6048555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6063428..6063623
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    6066084..6066103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6103226..6110265
FT                   /estimated_length=7040
FT                   /gap_type="unknown"
FT   assembly_gap    6111278..6111297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6112445..6112655
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    6115536..6116284
FT                   /estimated_length=749
FT                   /gap_type="unknown"
FT   assembly_gap    6117861..6118002
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    6153218..6153501
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   gene            complement(6168795..6169302)
FT                   /pseudo
FT                   /locus_tag="mCG_1026310"
FT                   /note="gene_id=mCG1026310.0"
FT   mRNA            complement(join(6168795..6168851,6169042..6169182,
FT                   6169260..6169302))
FT                   /pseudo
FT                   /locus_tag="mCG_1026310"
FT                   /note="gene_id=mCG1026310.0 transcript_id=mCT144014.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    6185098..6187488
FT                   /estimated_length=2391
FT                   /gap_type="unknown"
FT   assembly_gap    6190658..6190677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6192222..6192241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6193496..6193515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6212906..6212925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6215656..6215675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6220436..6220653
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    6239330..6239349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6270845..6271259
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    6272531..6272669
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    6273795..6273814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6291839..6291858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6293638..6293657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6304529..6304694
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    6333791..6333810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6358382..6358999
FT                   /pseudo
FT                   /locus_tag="mCG_1026351"
FT                   /note="gene_id=mCG1026351.1"
FT   mRNA            6358382..6358999
FT                   /pseudo
FT                   /locus_tag="mCG_1026351"
FT                   /note="gene_id=mCG1026351.1 transcript_id=mCT144055.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    6389318..6389346
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    6400519..6402620
FT                   /estimated_length=2102
FT                   /gap_type="unknown"
FT   assembly_gap    6404194..6404213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6413265..6414803
FT                   /estimated_length=1539
FT                   /gap_type="unknown"
FT   assembly_gap    6418716..6418735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6434441..6434460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6483314..6487845
FT                   /estimated_length=4532
FT                   /gap_type="unknown"
FT   assembly_gap    6493563..6493582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6498195..6498952
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   assembly_gap    6511414..6511468
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    6521587..6521606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6533982..6534746
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   assembly_gap    6536856..6537138
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    6542011..6542030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6552290..6552309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6556476..6556495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6562540..6564597
FT                   /estimated_length=2058
FT                   /gap_type="unknown"
FT   assembly_gap    6584377..6584396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6592752..6593066)
FT                   /pseudo
FT                   /locus_tag="mCG_1026323"
FT                   /note="gene_id=mCG1026323.1"
FT   mRNA            complement(6592752..6593066)
FT                   /pseudo
FT                   /locus_tag="mCG_1026323"
FT                   /note="gene_id=mCG1026323.1 transcript_id=mCT144027.1
FT                   created on 07-JUN-2002"
FT   assembly_gap    6593449..6593499
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    6605850..6605875
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    6607646..6608436
FT                   /estimated_length=791
FT                   /gap_type="unknown"
FT   assembly_gap    6611254..6612297
FT                   /estimated_length=1044
FT                   /gap_type="unknown"
FT   assembly_gap    6632874..6633064
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    6640447..6640466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6642049..6642430
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    6648249..6648996
FT                   /estimated_length=748
FT                   /gap_type="unknown"
FT   assembly_gap    6651188..6651207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6652340..6652359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6655797..6655816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6656981..6657000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6658410..6659405
FT                   /estimated_length=996
FT                   /gap_type="unknown"
FT   assembly_gap    6692597..6692616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6702062..6702081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6703609..6703628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6705429..6705449
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    6715702..6715721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6716372..6719008
FT                   /pseudo
FT                   /locus_tag="mCG_52018"
FT                   /note="gene_id=mCG52018.2"
FT   mRNA            6716372..6719008
FT                   /pseudo
FT                   /locus_tag="mCG_52018"
FT                   /note="gene_id=mCG52018.2 transcript_id=mCT52201.2 created
FT                   on 07-JUN-2002"
FT   assembly_gap    6720829..6721072
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    6735108..6735127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6738477..6738968
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   gene            complement(6748885..6750700)
FT                   /locus_tag="mCG_50396"
FT                   /note="gene_id=mCG50396.2"
FT   mRNA            complement(6748885..6750700)
FT                   /locus_tag="mCG_50396"
FT                   /product="mCG50396"
FT                   /note="gene_id=mCG50396.2 transcript_id=mCT50579.2 created
FT                   on 14-AUG-2002"
FT   CDS             complement(6750307..6750681)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50396"
FT                   /product="mCG50396"
FT                   /note="gene_id=mCG50396.2 transcript_id=mCT50579.2
FT                   protein_id=mCP39962.1"
FT                   /protein_id="EDL02010.1"
FT                   /translation="MALSFSGAIGLTFLMLGCALEDYDIYWPLFVLIFYVISPIPYFIA
FT                   KRVTYDSDATSSACPELVYFFTTGIVDSAFGLPVILARVDVIKWGACGLVLASNAVIFL
FT                   TILGFFLVFEGRDDFSWEQW"
FT   assembly_gap    6752142..6752161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6757009..6757028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6763216..6763235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6764807..6764915
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    6766578..6766597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6768429..6768448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6769614..6769633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6771162..6772636
FT                   /estimated_length=1475
FT                   /gap_type="unknown"
FT   gene            6793023..6800163
FT                   /locus_tag="mCG_1026312"
FT                   /note="gene_id=mCG1026312.1"
FT   mRNA            join(6793023..6793220,6798634..6800163)
FT                   /locus_tag="mCG_1026312"
FT                   /product="mCG1026312"
FT                   /note="gene_id=mCG1026312.1 transcript_id=mCT144016.1
FT                   created on 07-JUN-2002"
FT   CDS             6798837..6799049
FT                   /codon_start=1
FT                   /locus_tag="mCG_1026312"
FT                   /product="mCG1026312"
FT                   /note="gene_id=mCG1026312.1 transcript_id=mCT144016.1
FT                   protein_id=mCP60163.1"
FT                   /protein_id="EDL02011.1"
FT                   /translation="MSSLSLFKEKRDFRISAIIVGLVATAAIAASITASALALSATVQT
FT                   TQTINDLSARVTSALDRQAMANSQI"
FT   assembly_gap    6825284..6825670
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    6831480..6831499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6833741..6834534
FT                   /estimated_length=794
FT                   /gap_type="unknown"
FT   assembly_gap    6841763..6841782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6844732..6844751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6846848..6847395
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    6848766..6848785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6849913..6849932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6851483..6854774
FT                   /estimated_length=3292
FT                   /gap_type="unknown"
FT   assembly_gap    6856114..6856133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6857103..6867235)
FT                   /locus_tag="mCG_140527"
FT                   /note="gene_id=mCG140527.0"
FT   mRNA            complement(join(6857103..6857321,6858847..6858972,
FT                   6859082..6859200,6860455..6860554,6860647..6860769,
FT                   6861462..6861595,6862703..6862932,6863668..6863856,
FT                   6866584..6866730,6867063..6867235))
FT                   /locus_tag="mCG_140527"
FT                   /product="mCG140527"
FT                   /note="gene_id=mCG140527.0 transcript_id=mCT169932.0
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(6861535..6861595,6862703..6862932,
FT                   6863668..6863856,6866584..6866730,6867063..6867230))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140527"
FT                   /product="mCG140527"
FT                   /note="gene_id=mCG140527.0 transcript_id=mCT169932.0
FT                   protein_id=mCP92665.0"
FT                   /protein_id="EDL02012.1"
FT                   /translation="MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECER
FT                   YLAPKGFGGVQVSPPNENIVIHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNV
FT                   GVRIYVDAVINHMCGSGNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEISNY
FT                   NDAYQVRNCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAV
FT                   WTNCIISIQNGSPKEADLSFSKRLLIWVVRQLKVVSTLEMAV"
FT   assembly_gap    6865471..6865490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6869354..6869439
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    6879284..6879303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6895477..6895496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6896640..6899485
FT                   /estimated_length=2846
FT                   /gap_type="unknown"
FT   assembly_gap    6952038..6952057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6959669..>6964640)
FT                   /locus_tag="mCG_4474"
FT                   /note="gene_id=mCG4474.1"
FT   mRNA            complement(join(6959669..6959892,6961994..6962119,
FT                   6962228..6962346,6963509..6963608,6963701..6963823,
FT                   6964501..>6964640))
FT                   /locus_tag="mCG_4474"
FT                   /product="mCG4474, transcript variant mCT3969"
FT                   /note="gene_id=mCG4474.1 transcript_id=mCT3969.1 created on
FT                   07-JUN-2002"
FT   mRNA            complement(join(6959670..6959892,6961029..6961083,
FT                   6961994..6962119,6962228..6962346,6963509..6963608,
FT                   6963701..6963823,6964501..>6964571))
FT                   /locus_tag="mCG_4474"
FT                   /product="mCG4474, transcript variant mCT189458"
FT                   /note="gene_id=mCG4474.1 transcript_id=mCT189458.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6959703..6959892,6961994..6962119,
FT                   6962228..6962346,6963509..6963608,6963701..6963823,
FT                   6964501..>6964634))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4474"
FT                   /product="mCG4474, isoform CRA_b"
FT                   /note="gene_id=mCG4474.1 transcript_id=mCT3969.1
FT                   protein_id=mCP5016.1 isoform=CRA_b"
FT                   /protein_id="EDL02014.1"
FT                   /translation="VIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLK
FT                   NWGEGWGLVPSDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTR
FT                   VMSSYRWNRNFQNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVA
FT                   FRNVVNGQPFSNWWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISG
FT                   DKVDGNCTGLRVNVGSDGKAHFSISNSAEDPFIAIHADSKL"
FT   CDS             complement(join(6959842..6959892,6961029..6961083,
FT                   6961994..6962119,6962228..6962346,6963509..6963608,
FT                   6963701..6963823,6964501..>6964571))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4474"
FT                   /product="mCG4474, isoform CRA_a"
FT                   /note="gene_id=mCG4474.1 transcript_id=mCT189458.0
FT                   protein_id=mCP110449.0 isoform=CRA_a"
FT                   /protein_id="EDL02013.1"
FT                   /translation="EFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVPSDRALVFVDNH
FT                   DNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNFQNGKDQNDWI
FT                   GPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSNWWDNNSNQV
FT                   AFSRGNRGFIVFNNDDWLRRLFYNAYLIYYNKMIEGFVSHFTDWSSCWHIL"
XX
CO   join(AAHY01029918.1:1..20334,gap(20),complement(AAHY01029919.1:1..19654),
CO   gap(210),AAHY01029920.1:1..20103,gap(20),
CO   complement(AAHY01029921.1:1..14173),gap(20),
CO   complement(AAHY01029922.1:1..17599),gap(20),AAHY01029923.1:1..35295,
CO   gap(20),AAHY01029924.1:1..16483,gap(235),AAHY01029925.1:1..35493,gap(135),
CO   AAHY01029926.1:1..52432,gap(35),AAHY01029927.1:1..40370,gap(20),
CO   AAHY01029928.1:1..14311,gap(126),complement(AAHY01029929.1:1..25296),
CO   gap(889),AAHY01029930.1:1..19780,gap(183),
CO   complement(AAHY01029931.1:1..17570),gap(214),AAHY01029932.1:1..9175,
CO   gap(218),complement(AAHY01029933.1:1..16625),gap(37),
CO   AAHY01029934.1:1..8581,gap(440),complement(AAHY01029935.1:1..26500),
CO   gap(20),AAHY01029936.1:1..67199,gap(20),AAHY01029937.1:1..69373,gap(107),
CO   AAHY01029938.1:1..12715,gap(700),AAHY01029939.1:1..12366,gap(599),
CO   AAHY01029940.1:1..26183,gap(195),AAHY01029941.1:1..14114,gap(189),
CO   AAHY01029942.1:1..4957,gap(252),AAHY01029943.1:1..13967,gap(889),
CO   complement(AAHY01029944.1:1..4004),gap(210),
CO   complement(AAHY01029945.1:1..3816),gap(20),
CO   complement(AAHY01029946.1:1..12226),gap(20),
CO   complement(AAHY01029947.1:1..20608),gap(20),AAHY01029948.1:1..20692,
CO   gap(20),complement(AAHY01029949.1:1..12863),gap(20),
CO   AAHY01029950.1:1..25687,gap(80),complement(AAHY01029951.1:1..40599),
CO   gap(20),complement(AAHY01029952.1:1..10179),gap(330),
CO   complement(AAHY01029953.1:1..12414),gap(69),
CO   complement(AAHY01029954.1:1..8559),gap(142),AAHY01029955.1:1..30690,
CO   gap(20),AAHY01029956.1:1..1103,gap(20),AAHY01029957.1:1..6368,gap(2001),
CO   complement(AAHY01029958.1:1..1293),gap(20),AAHY01029959.1:1..8260,gap(20),
CO   AAHY01029960.1:1..4040,gap(200),complement(AAHY01029961.1:1..10302),
CO   gap(20),AAHY01029962.1:1..1138,gap(20),AAHY01029963.1:1..1224,gap(20),
CO   AAHY01029964.1:1..3503,gap(20),AAHY01029965.1:1..19533,gap(72),
CO   AAHY01029966.1:1..1479,gap(163),AAHY01029967.1:1..11602,gap(576),
CO   AAHY01029968.1:1..8400,gap(20),AAHY01029969.1:1..26472,gap(20),
CO   AAHY01029970.1:1..4798,gap(163),AAHY01029971.1:1..19833,gap(20),
CO   AAHY01029972.1:1..9690,gap(262),AAHY01029973.1:1..54253,gap(20),
CO   complement(AAHY01029974.1:1..1420),gap(20),AAHY01029975.1:1..25890,gap(47),
CO   complement(AAHY01029976.1:1..6755),gap(554),
CO   complement(AAHY01029977.1:1..5962),gap(95),
CO   complement(AAHY01029978.1:1..1450),gap(20),
CO   complement(AAHY01029979.1:1..1769),gap(20),AAHY01029980.1:1..26429,gap(20),
CO   AAHY01029981.1:1..1353,gap(721),AAHY01029982.1:1..38909,gap(20),
CO   complement(AAHY01029983.1:1..10800),gap(20),AAHY01029984.1:1..10337,
CO   gap(62),complement(AAHY01029985.1:1..918),gap(68),AAHY01029986.1:1..20822,
CO   gap(20),AAHY01029987.1:1..56192,gap(66),AAHY01029988.1:1..6302,gap(37),
CO   AAHY01029989.1:1..20877,gap(62),AAHY01029990.1:1..31159,gap(51),
CO   AAHY01029991.1:1..184414,gap(20),AAHY01029992.1:1..180388,gap(20),
CO   AAHY01029993.1:1..28136,gap(4300),AAHY01029994.1:1..31616,gap(20),
CO   AAHY01029995.1:1..37548,gap(177),complement(AAHY01029996.1:1..5925),
CO   gap(516),AAHY01029997.1:1..22069,gap(267),AAHY01029998.1:1..24009,gap(20),
CO   AAHY01029999.1:1..42650,gap(247),complement(AAHY01030000.1:1..10249),
CO   gap(278),complement(AAHY01030001.1:1..10882),gap(20),
CO   AAHY01030002.1:1..8885,gap(20),AAHY01030003.1:1..7645,gap(20),
CO   AAHY01030004.1:1..15635,gap(191),AAHY01030005.1:1..21535,gap(20),
CO   AAHY01030006.1:1..8528,gap(133),AAHY01030007.1:1..19461,gap(47),
CO   AAHY01030008.1:1..11032,gap(106),complement(AAHY01030009.1:1..7260),
CO   gap(20),AAHY01030010.1:1..5148,gap(992),AAHY01030011.1:1..33451,gap(49),
CO   AAHY01030012.1:1..11108,gap(149),complement(AAHY01030013.1:1..5746),
CO   gap(70),AAHY01030014.1:1..26606,gap(20),AAHY01030015.1:1..5404,gap(20),
CO   AAHY01030016.1:1..5239,gap(144),AAHY01030017.1:1..9744,gap(20),
CO   AAHY01030018.1:1..39813,gap(149),AAHY01030019.1:1..8906,gap(20),
CO   complement(AAHY01030020.1:1..7435),gap(20),AAHY01030021.1:1..31319,gap(20),
CO   AAHY01030022.1:1..20772,gap(20),AAHY01030023.1:1..2894,gap(24),
CO   AAHY01030024.1:1..12645,gap(5194),AAHY01030025.1:1..3565,gap(93),
CO   complement(AAHY01030026.1:1..8339),gap(20),
CO   complement(AAHY01030027.1:1..7920),gap(286),AAHY01030028.1:1..40030,
CO   gap(46),AAHY01030029.1:1..13445,gap(20),AAHY01030030.1:1..11759,gap(20),
CO   AAHY01030031.1:1..51119,gap(141),AAHY01030032.1:1..27175,gap(63),
CO   AAHY01030033.1:1..51677,gap(20),AAHY01030034.1:1..23682,gap(20),
CO   complement(AAHY01030035.1:1..16025),gap(261),AAHY01030036.1:1..10590,
CO   gap(323),AAHY01030037.1:1..1427,gap(20),AAHY01030038.1:1..17880,gap(20),
CO   AAHY01030039.1:1..19386,gap(1516),AAHY01030040.1:1..17455,gap(265),
CO   AAHY01030041.1:1..1104,gap(20),complement(AAHY01030042.1:1..4171),gap(60),
CO   AAHY01030043.1:1..35380,gap(110),complement(AAHY01030044.1:1..3996),
CO   gap(135),AAHY01030045.1:1..5862,gap(20),complement(AAHY01030046.1:1..5033),
CO   gap(110),complement(AAHY01030047.1:1..1006),gap(5650),
CO   complement(AAHY01030048.1:1..9533),gap(20),
CO   complement(AAHY01030049.1:1..6477),gap(20),AAHY01030050.1:1..11662,
CO   gap(478),AAHY01030051.1:1..21809,gap(20),
CO   complement(AAHY01030052.1:1..7165),gap(495),AAHY01030053.1:1..724,gap(40),
CO   complement(AAHY01030054.1:1..572),gap(305),
CO   complement(AAHY01030055.1:1..19685),gap(20),
CO   complement(AAHY01030056.1:1..23146),gap(2992),
CO   complement(AAHY01030057.1:1..22381),gap(20),
CO   complement(AAHY01030058.1:1..5305),gap(355),AAHY01030059.1:1..11659,
CO   gap(1546),AAHY01030060.1:1..18239,gap(20),AAHY01030061.1:1..13078,gap(20),
CO   AAHY01030062.1:1..33141,gap(20),complement(AAHY01030063.1:1..2969),gap(20),
CO   complement(AAHY01030064.1:1..14752),gap(20),
CO   complement(AAHY01030065.1:1..8677),gap(20),
CO   complement(AAHY01030066.1:1..6843),gap(74),
CO   complement(AAHY01030067.1:1..1301),gap(1028),AAHY01030068.1:1..2316,
CO   gap(136),AAHY01030069.1:1..9080,gap(20),AAHY01030070.1:1..16966,gap(145),
CO   AAHY01030071.1:1..772,gap(477),AAHY01030072.1:1..14075,gap(52),
CO   AAHY01030073.1:1..51410,gap(165),AAHY01030074.1:1..23831,gap(141),
CO   AAHY01030075.1:1..31092,gap(20),AAHY01030076.1:1..1528,gap(20),
CO   AAHY01030077.1:1..8624,gap(20),AAHY01030078.1:1..13055,gap(1352),
CO   AAHY01030079.1:1..762,gap(443),complement(AAHY01030080.1:1..3396),gap(135),
CO   AAHY01030081.1:1..13797,gap(49),AAHY01030082.1:1..2932,gap(319),
CO   AAHY01030083.1:1..30659,gap(69),complement(AAHY01030084.1:1..1770),gap(40),
CO   complement(AAHY01030085.1:1..7034),gap(522),
CO   complement(AAHY01030086.1:1..10744),gap(20),AAHY01030087.1:1..2299,gap(77),
CO   AAHY01030088.1:1..664,gap(25),AAHY01030089.1:1..15205,gap(43),
CO   AAHY01030090.1:1..28513,gap(20),AAHY01030091.1:1..6786,gap(20),
CO   AAHY01030092.1:1..15500,gap(23),AAHY01030093.1:1..4593,gap(105),
CO   complement(AAHY01030094.1:1..20131),gap(124),AAHY01030095.1:1..25497,
CO   gap(34),AAHY01030096.1:1..14074,gap(42),AAHY01030097.1:1..61169,gap(20),
CO   complement(AAHY01030098.1:1..10514),gap(96),AAHY01030099.1:1..17408,
CO   gap(1345),AAHY01030100.1:1..29037,gap(34),AAHY01030101.1:1..78661,gap(852),
CO   AAHY01030102.1:1..11115,gap(336),AAHY01030103.1:1..36522,gap(338),
CO   AAHY01030104.1:1..33666,gap(20),AAHY01030105.1:1..11505,gap(20),
CO   AAHY01030106.1:1..77816,gap(20),AAHY01030107.1:1..12600,gap(20),
CO   AAHY01030108.1:1..49458,gap(145),AAHY01030109.1:1..15817,gap(129),
CO   complement(AAHY01030110.1:1..2219),gap(1283),AAHY01030111.1:1..8805,
CO   gap(1952),AAHY01030112.1:1..874,gap(954),AAHY01030113.1:1..49521,gap(20),
CO   AAHY01030114.1:1..20678,gap(20),AAHY01030115.1:1..21331,gap(22),
CO   AAHY01030116.1:1..16213,gap(20),AAHY01030117.1:1..56769,gap(48),
CO   AAHY01030118.1:1..10886,gap(97),complement(AAHY01030119.1:1..27021),
CO   gap(247),AAHY01030120.1:1..2087,gap(696),AAHY01030121.1:1..45179,gap(33),
CO   AAHY01030122.1:1..61092,gap(20),AAHY01030123.1:1..78606,gap(474),
CO   complement(AAHY01030124.1:1..1418),gap(184),AAHY01030125.1:1..19808,
CO   gap(20),AAHY01030126.1:1..1348,gap(172),AAHY01030127.1:1..1634,gap(483),
CO   AAHY01030128.1:1..2307,gap(20),AAHY01030129.1:1..55042,gap(20),
CO   complement(AAHY01030130.1:1..10538),gap(2451),AAHY01030131.1:1..99131,
CO   gap(20),AAHY01030132.1:1..15821,gap(20),AAHY01030133.1:1..15888,gap(39),
CO   AAHY01030134.1:1..1112,gap(89),AAHY01030135.1:1..54537,gap(3398),
CO   AAHY01030136.1:1..39280,gap(20),AAHY01030137.1:1..7668,gap(20),
CO   AAHY01030138.1:1..45475,gap(20),AAHY01030139.1:1..34851,gap(185),
CO   AAHY01030140.1:1..90933,gap(50),AAHY01030141.1:1..17412,gap(20),
CO   AAHY01030142.1:1..24685,gap(60),AAHY01030143.1:1..4146,gap(71),
CO   AAHY01030144.1:1..13577,gap(20),AAHY01030145.1:1..15059,gap(20),
CO   AAHY01030146.1:1..3379,gap(20),AAHY01030147.1:1..52876,gap(20),
CO   AAHY01030148.1:1..9461,gap(1674),AAHY01030149.1:1..49026,gap(20),
CO   AAHY01030150.1:1..9447,gap(62),AAHY01030151.1:1..4166,gap(20),
CO   AAHY01030152.1:1..21905,gap(20),AAHY01030153.1:1..7082,gap(20),
CO   AAHY01030154.1:1..27875,gap(20),AAHY01030155.1:1..12637,gap(20),
CO   AAHY01030156.1:1..25125,gap(20),AAHY01030157.1:1..1309,gap(20),
CO   AAHY01030158.1:1..61205,gap(20),AAHY01030159.1:1..1252,gap(180),
CO   AAHY01030160.1:1..3033,gap(20),AAHY01030161.1:1..60561,gap(20),
CO   AAHY01030162.1:1..31686,gap(20),complement(AAHY01030163.1:1..4957),gap(20),
CO   complement(AAHY01030164.1:1..29465),gap(20),AAHY01030165.1:1..48039,
CO   gap(316),complement(AAHY01030166.1:1..16651),gap(20),
CO   AAHY01030167.1:1..13373,gap(630),AAHY01030168.1:1..29694,gap(20),
CO   AAHY01030169.1:1..73857,gap(127),AAHY01030170.1:1..1732,gap(20),
CO   AAHY01030171.1:1..33020,gap(20),AAHY01030172.1:1..10630,gap(20),
CO   AAHY01030173.1:1..8200,gap(52),AAHY01030174.1:1..19067,gap(20),
CO   AAHY01030175.1:1..2299,gap(20),AAHY01030176.1:1..18145,gap(201),
CO   AAHY01030177.1:1..16160,gap(20),AAHY01030178.1:1..7013,gap(87),
CO   AAHY01030179.1:1..14290,gap(20),complement(AAHY01030180.1:1..1007),gap(20),
CO   AAHY01030181.1:1..2297,gap(20),AAHY01030182.1:1..10872,gap(3141),
CO   AAHY01030183.1:1..31839,gap(1904),AAHY01030184.1:1..3051,gap(20),
CO   AAHY01030185.1:1..11551,gap(178),AAHY01030186.1:1..8380,gap(20),
CO   AAHY01030187.1:1..4618,gap(2224),AAHY01030188.1:1..2022,gap(2450),
CO   AAHY01030189.1:1..8309,gap(150),AAHY01030190.1:1..16617,gap(414),
CO   AAHY01030191.1:1..9165,gap(337),AAHY01030192.1:1..57090,gap(20),
CO   AAHY01030193.1:1..5816,gap(995),AAHY01030194.1:1..2026,gap(20),
CO   AAHY01030195.1:1..53441,gap(20),AAHY01030196.1:1..21907,gap(20),
CO   AAHY01030197.1:1..44961,gap(26),AAHY01030198.1:1..70400,gap(8764),
CO   complement(AAHY01030199.1:1..1276),gap(20),AAHY01030200.1:1..3801,
CO   gap(4992),AAHY01030201.1:1..6370,gap(20),AAHY01030202.1:1..3074,gap(20),
CO   AAHY01030203.1:1..19950,gap(20),complement(AAHY01030204.1:1..1014),gap(20),
CO   complement(AAHY01030205.1:1..4200),gap(20),AAHY01030206.1:1..1074,
CO   gap(6075),AAHY01030207.1:1..10343,gap(111),AAHY01030208.1:1..17351,gap(20),
CO   complement(AAHY01030209.1:1..4848),gap(20),AAHY01030210.1:1..66964,
CO   gap(1350),AAHY01030211.1:1..6752,gap(20),AAHY01030212.1:1..6375,gap(20),
CO   AAHY01030213.1:1..887,gap(370),complement(AAHY01030214.1:1..2338),gap(168),
CO   complement(AAHY01030215.1:1..4493),gap(20),AAHY01030216.1:1..5700,gap(41),
CO   AAHY01030217.1:1..26913,gap(20),AAHY01030218.1:1..38525,gap(20),
CO   complement(AAHY01030219.1:1..3440),gap(20),AAHY01030220.1:1..6907,gap(20),
CO   AAHY01030221.1:1..14872,gap(196),complement(AAHY01030222.1:1..2460),
CO   gap(20),AAHY01030223.1:1..37122,gap(7040),
CO   complement(AAHY01030224.1:1..1012),gap(20),
CO   complement(AAHY01030225.1:1..1147),gap(211),AAHY01030226.1:1..2880,
CO   gap(749),AAHY01030227.1:1..1576,gap(142),AAHY01030228.1:1..35215,gap(284),
CO   AAHY01030229.1:1..31596,gap(2391),AAHY01030230.1:1..3169,gap(20),
CO   complement(AAHY01030231.1:1..1544),gap(20),AAHY01030232.1:1..1254,gap(20),
CO   AAHY01030233.1:1..19390,gap(20),AAHY01030234.1:1..2730,gap(20),
CO   AAHY01030235.1:1..4760,gap(218),AAHY01030236.1:1..18676,gap(20),
CO   AAHY01030237.1:1..31495,gap(415),AAHY01030238.1:1..1271,gap(139),
CO   AAHY01030239.1:1..1125,gap(20),AAHY01030240.1:1..18024,gap(20),
CO   complement(AAHY01030241.1:1..1779),gap(20),AAHY01030242.1:1..10871,
CO   gap(166),AAHY01030243.1:1..29096,gap(20),AAHY01030244.1:1..55507,gap(29),
CO   AAHY01030245.1:1..11172,gap(2102),AAHY01030246.1:1..1573,gap(20),
CO   AAHY01030247.1:1..9051,gap(1539),AAHY01030248.1:1..3912,gap(20),
CO   AAHY01030249.1:1..15705,gap(20),AAHY01030250.1:1..48853,gap(4532),
CO   AAHY01030251.1:1..5717,gap(20),AAHY01030252.1:1..4612,gap(758),
CO   AAHY01030253.1:1..12461,gap(55),AAHY01030254.1:1..10118,gap(20),
CO   AAHY01030255.1:1..12375,gap(765),AAHY01030256.1:1..2109,gap(283),
CO   AAHY01030257.1:1..4872,gap(20),AAHY01030258.1:1..10259,gap(20),
CO   AAHY01030259.1:1..4166,gap(20),AAHY01030260.1:1..6044,gap(2058),
CO   complement(AAHY01030261.1:1..19779),gap(20),
CO   complement(AAHY01030262.1:1..9052),gap(51),AAHY01030263.1:1..12350,gap(26),
CO   AAHY01030264.1:1..1770,gap(791),AAHY01030265.1:1..2817,gap(1044),
CO   complement(AAHY01030266.1:1..20576),gap(191),
CO   complement(AAHY01030267.1:1..7382),gap(20),AAHY01030268.1:1..1582,gap(382),
CO   complement(AAHY01030269.1:1..5818),gap(748),
CO   complement(AAHY01030270.1:1..2191),gap(20),AAHY01030271.1:1..1132,gap(20),
CO   AAHY01030272.1:1..3437,gap(20),AAHY01030273.1:1..1164,gap(20),
CO   AAHY01030274.1:1..1409,gap(996),AAHY01030275.1:1..33191,gap(20),
CO   AAHY01030276.1:1..9445,gap(20),complement(AAHY01030277.1:1..1527),gap(20),
CO   AAHY01030278.1:1..1800,gap(21),AAHY01030279.1:1..10252,gap(20),
CO   complement(AAHY01030280.1:1..5107),gap(244),AAHY01030281.1:1..14035,
CO   gap(20),AAHY01030282.1:1..3349,gap(492),AAHY01030283.1:1..13173,gap(20),
CO   complement(AAHY01030284.1:1..4847),gap(20),AAHY01030285.1:1..6187,gap(20),
CO   AAHY01030286.1:1..1571,gap(109),AAHY01030287.1:1..1662,gap(20),
CO   AAHY01030288.1:1..1831,gap(20),complement(AAHY01030289.1:1..1165),gap(20),
CO   AAHY01030290.1:1..1528,gap(1475),AAHY01030291.1:1..52647,gap(387),
CO   AAHY01030292.1:1..5809,gap(20),AAHY01030293.1:1..2241,gap(794),
CO   complement(AAHY01030294.1:1..7228),gap(20),
CO   complement(AAHY01030295.1:1..2949),gap(20),
CO   complement(AAHY01030296.1:1..2096),gap(548),
CO   complement(AAHY01030297.1:1..1370),gap(20),
CO   complement(AAHY01030298.1:1..1127),gap(20),
CO   complement(AAHY01030299.1:1..1550),gap(3292),
CO   complement(AAHY01030300.1:1..1339),gap(20),AAHY01030301.1:1..9337,gap(20),
CO   AAHY01030302.1:1..3863,gap(86),AAHY01030303.1:1..9844,gap(20),
CO   complement(AAHY01030304.1:1..16173),gap(20),
CO   complement(AAHY01030305.1:1..1143),gap(2846),AAHY01030306.1:1..52552,
CO   gap(20),AAHY01030307.1:1..13439)
//


spacer
spacer