Dbfetch

ID   CH466606; SV 1; linear; genomic DNA; CON; MUS; 7316878 BP.
XX
AC   CH466606;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009790952 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7316878
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-7316878
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 1fb3b1dd93e5ba5ba68fa0851205ac4b.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000225.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002274; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002500; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004864; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015579; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019214; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023902; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023906; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024116; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024121; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024128; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024132; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024158; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024163; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024165; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024186; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024188; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024190; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024222; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025728; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025731; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025738; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033200; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036473; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036636; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036775; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037805; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039628; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040888; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042203; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044533; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045027; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046711; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048731; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052146; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056692; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061046; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063239; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066720; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071172; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073433; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079657; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023253; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023258; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023264; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023265; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023277; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023281; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023284; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023298; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023306; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023314; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023318; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023320; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023322; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023325; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023330; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023333; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023340; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023354; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023358; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023361; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023366; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023369; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023370; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023379; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023381; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023382; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023388; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023394; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023397; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023401; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023403; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023407; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023414; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023420; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023424; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023427; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023428; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023437; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023438; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023441; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023448; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023449; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023457; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023460; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023467; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023468; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023215; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023218; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023224; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023225; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023237; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023241; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023244; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023252; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023258; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023266; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023274; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023278; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023280; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023282; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023285; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023290; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023293; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023299; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023313; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023317; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023320; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023325; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023328; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023329; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023338; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023340; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023341; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023347; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023353; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023356; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023360; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023362; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023366; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023371; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023377; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023382; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023385; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023386; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023395; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023396; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023399; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023406; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023407; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023415; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023418; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023425; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023426; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023188; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023194; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023195; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023208; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023211; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023219; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023225; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023233; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023241; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023245; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023247; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023249; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023252; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023257; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023265; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023279; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023283; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023286; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023291; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023294; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023295; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023304; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023306; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023307; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023313; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023319; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023326; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023328; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023332; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023337; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023343; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023347; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023350; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023360; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023361; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023364; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023371; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023372; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023380; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023383; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023390; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023391; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023217; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023223; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023229; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023230; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023242; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023249; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023257; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023263; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023271; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023279; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023283; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023285; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023287; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023290; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023298; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023304; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023318; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023322; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023325; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023330; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023333; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023334; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023343; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023345; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023346; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023352; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023358; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023361; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023365; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023367; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023371; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023376; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023382; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023387; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023390; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023400; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023401; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023404; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023411; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023412; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023420; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023423; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023430; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023431; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022983; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022989; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022990; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023002; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023006; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023009; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023017; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023031; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023039; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023045; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023047; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023050; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023055; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023058; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023064; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023078; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023082; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023085; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023090; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023093; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023094; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023103; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023105; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023106; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023112; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023118; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023121; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023125; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023127; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023131; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023137; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023143; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023148; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023151; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023152; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023161; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023162; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023165; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023172; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023173; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023181; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023184; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023191; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023192; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023666; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023672; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023673; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023685; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023689; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023692; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023700; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023707; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023715; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023726; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023728; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023733; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023738; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023741; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023747; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023760; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023764; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023767; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023772; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023775; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023776; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023785; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023787; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023788; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023794; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023800; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023803; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023805; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023807; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023811; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023819; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023825; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023829; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023832; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023842; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023843; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023846; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023853; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023854; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023862; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023872; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023873; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022484; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022489; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022495; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022496; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022508; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022511; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022525; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022533; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022541; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022547; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022549; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022552; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022557; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022560; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022566; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022580; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022584; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022587; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022592; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022595; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022596; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022605; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022607; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022608; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022614; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022620; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022623; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022627; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022628; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022638; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022644; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022649; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022652; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022653; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022662; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022666; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022673; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022674; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022682; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022685; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022692; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022693; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022959; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022965; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022966; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022978; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022982; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022985; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022993; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022999; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023007; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023015; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023019; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023021; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023023; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023026; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023031; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023039; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023053; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023057; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023060; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023065; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023068; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023069; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023078; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023080; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023081; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023087; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023093; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023096; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023100; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023102; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023106; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023111; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023117; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023122; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023125; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023126; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023135; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023136; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023139; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023146; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023147; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023156; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023159; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023166; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023167; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023087; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023091; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023097; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023098; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023110; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023114; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023121; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023122; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023128; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023136; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023144; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023148; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023152; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023155; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023160; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023163; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023169; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023183; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023187; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023190; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023195; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023198; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023199; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023208; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023210; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023211; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023217; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023223; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023226; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023232; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023236; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023243; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023249; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023253; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023256; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023257; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023266; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023267; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023270; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023277; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023278; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023286; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023289; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023296; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023297; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023058; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023064; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023065; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023077; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023084; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023092; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023098; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023106; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023114; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023120; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023122; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023125; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023130; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023133; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023139; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023153; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023157; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023160; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023165; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023168; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023169; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023178; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023187; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023193; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023196; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023200; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023202; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023206; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023212; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023218; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023223; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023226; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023227; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023236; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023240; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023247; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023248; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023256; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023266; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0023267; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023165; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023171; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023172; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023184; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023191; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023205; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023213; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023221; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023227; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023229; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023232; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023237; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023240; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023246; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023260; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023264; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023267; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023272; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023275; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023276; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023285; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023287; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023288; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023294; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023300; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023303; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023307; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023309; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023313; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023320; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023326; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023331; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023334; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023335; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023344; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023348; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023355; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023356; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023364; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023367; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023374; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0023375; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023072; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023077; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023083; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023084; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023096; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023101; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023103; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023111; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023117; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023125; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023133; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023137; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023139; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023141; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023144; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023149; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023152; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023158; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023172; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023176; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023179; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023184; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023187; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023188; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023197; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023199; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023200; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023206; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023212; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023215; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023219; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023221; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023225; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023230; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023236; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023241; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023244; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023254; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023255; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023258; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023265; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023266; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023274; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023277; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023284; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023285; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023700; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023705; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023711; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023712; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023724; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023728; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023730; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023738; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023744; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023752; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023760; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023764; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023766; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023768; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023771; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023776; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023779; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023786; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023800; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023804; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023807; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023812; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023815; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023816; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023825; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023827; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023828; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023834; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023840; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023843; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023847; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023849; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023853; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023860; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023866; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023874; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023884; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023885; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023888; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023895; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023896; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023904; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023907; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023914; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022234; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022237; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022243; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022244; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022256; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022260; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022267; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022268; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022274; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022282; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022290; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022294; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022296; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022298; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022301; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022306; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022309; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022315; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022329; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022333; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022336; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022341; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022344; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022345; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022354; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022356; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022363; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022369; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022372; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022376; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022377; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022381; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022388; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022394; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022399; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022402; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022403; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022412; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022413; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022416; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022423; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022424; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022432; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022435; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022442; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022443; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022549; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022552; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022558; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022559; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022571; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022574; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022582; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022588; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022596; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022604; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022610; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022612; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022615; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022620; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022623; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022629; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022643; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022647; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022650; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022655; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022658; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022659; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022668; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022670; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022671; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022677; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022683; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022686; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022690; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022691; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022695; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022701; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022707; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022711; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022714; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022715; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022724; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022728; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022735; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022736; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022744; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022747; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022754; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022755; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000002344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004990; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023829; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024802; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024931; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024940; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024946; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025003; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025023; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025025; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035797; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037776; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040729; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046839; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048054; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053683; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071006; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085989; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088345; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095595; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098862; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114683; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114863; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114881; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114882; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114888; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115509; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118788; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120967; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138759; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146923; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165838; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167662; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168339; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169308; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181985; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000208043; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045785; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045794; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045821; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045822; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045858; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045863; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045876; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045903; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045938; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045979; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045995; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046010; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046023; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046029; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046032; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046048; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046083; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046109; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046161; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046180; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046195; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046211; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046225; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046227; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046274; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046281; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046290; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046317; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046336; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046359; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046375; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046379; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046402; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046421; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046438; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046456; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046474; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046477; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046515; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046529; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046553; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046573; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046579; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046623; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046633; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046662; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046664; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045771; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045778; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045805; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045806; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045842; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045846; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045854; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045881; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045916; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045957; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045973; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0045989; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046002; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046008; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046011; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046027; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046062; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046086; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046138; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046157; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046172; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046188; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046198; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046200; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046247; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046254; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046263; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046290; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046309; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046332; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046348; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046352; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046375; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046391; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046408; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046430; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046448; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046451; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046490; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046504; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046528; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046549; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046555; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046599; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046609; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046638; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046640; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045729; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045756; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045757; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045793; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045794; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045807; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045834; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045869; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045910; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045926; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045942; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045955; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045961; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045964; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0045980; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046038; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046090; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046108; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046123; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046139; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046149; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046151; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046198; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046205; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046214; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046241; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046260; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046283; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046299; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046303; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046326; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046342; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046359; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046378; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046396; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046399; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046438; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046452; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046476; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046499; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046505; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046551; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046562; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046593; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046595; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045727; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045737; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045764; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045765; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045801; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045806; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045819; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045846; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045881; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045922; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045938; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045954; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045962; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045968; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045971; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045987; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046022; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046048; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046100; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046119; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046134; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046150; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046160; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046162; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046209; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046216; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046225; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046250; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046269; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046291; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046307; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046311; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046334; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046350; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046367; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046391; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046409; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046451; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046465; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046489; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046510; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046516; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046562; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046572; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046601; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046603; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045474; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045501; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045502; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045538; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045543; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045551; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045577; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045612; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045653; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045669; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045698; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045704; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045707; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045723; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045758; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045783; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045831; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045850; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045865; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045881; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045891; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045893; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045940; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045947; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045956; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045983; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046002; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046024; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046040; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046044; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046067; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046084; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046101; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046125; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046141; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046144; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046184; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046198; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046222; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046244; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046250; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046293; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046303; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046333; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046335; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046224; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046251; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046252; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046288; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046292; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046304; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046327; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046361; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046401; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046432; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046441; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046447; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046450; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046468; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046503; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046527; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046572; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046590; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046605; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046621; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046632; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046634; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046681; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046688; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046697; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046724; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046743; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046765; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046778; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046782; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046805; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046836; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046853; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046875; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046893; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046936; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046950; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046973; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046993; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046999; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0047044; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0047054; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0047083; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0047085; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045576; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045585; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045612; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045613; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045650; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045657; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045681; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045716; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045758; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045776; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045800; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045806; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045809; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045825; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045861; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045885; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045935; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045954; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045969; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045985; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045996; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045998; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046045; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046052; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046061; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046086; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046106; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046128; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046145; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046148; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046189; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046206; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046230; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046239; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046242; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046281; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046321; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046342; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046347; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046393; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046404; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046433; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0046435; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045400; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045427; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045428; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045464; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045469; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045482; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045509; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045545; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045586; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045618; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045626; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045632; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045635; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045651; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045712; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045764; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045783; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045798; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045814; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045824; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045826; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045874; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045881; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045890; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045917; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045936; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045958; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045974; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0045978; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046001; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046017; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046034; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046059; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046076; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046079; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046118; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046132; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046156; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046177; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046229; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046239; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046270; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046272; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045524; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045532; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045559; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045560; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045596; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045604; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045625; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045629; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045665; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045706; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045722; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045738; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045746; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045752; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045755; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045771; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045806; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045830; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045877; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045896; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045911; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045928; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045938; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045940; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045987; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0045994; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046003; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046030; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046049; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046071; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046087; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046091; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046114; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046137; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046153; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046176; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046191; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046194; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046234; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046248; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046272; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046294; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046300; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046345; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046355; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046385; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046387; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045496; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045524; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045560; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045572; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045599; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045634; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045675; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045691; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045715; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045721; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045724; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045740; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045775; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045799; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045851; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045870; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045885; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045901; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045911; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045913; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045960; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0045967; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046003; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046022; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046044; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046060; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046064; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046087; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046107; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046123; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046146; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046164; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046167; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046206; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046244; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046264; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046270; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046310; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046349; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0046351; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045630; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045657; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045658; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045694; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045733; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045768; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045810; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045826; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045849; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045855; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045858; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045874; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045909; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045933; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0045984; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046003; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046018; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046034; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046048; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046050; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046097; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046104; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046113; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046140; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046159; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046181; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046197; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046201; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046224; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046244; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046261; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046283; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046302; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046305; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046344; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046381; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046401; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046407; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046451; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046461; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046490; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0046492; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045458; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045467; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045494; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045495; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045531; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045540; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045546; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045573; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045649; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045665; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045681; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045689; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045695; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045698; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045714; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045749; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045773; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045825; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045842; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045857; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045874; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045884; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045886; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045933; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045940; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045949; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045976; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045995; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046017; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046034; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046038; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046078; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046095; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046120; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046138; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046180; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046194; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046218; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046238; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046245; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046289; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046300; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046329; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046331; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046302; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046311; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046338; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046339; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046375; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046380; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046387; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046414; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046445; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046486; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046502; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046518; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046531; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046537; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046540; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046556; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046591; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046616; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046669; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046687; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046702; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046718; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046729; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046731; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046778; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046785; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046794; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046821; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046841; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046879; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046883; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046908; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046931; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046947; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046972; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046990; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047033; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047047; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047089; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047095; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047148; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047177; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047179; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045159; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045166; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045193; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045194; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045230; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045242; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045263; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045265; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045301; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045345; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045363; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045379; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045387; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045393; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045396; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045412; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045448; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045472; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045518; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045537; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045552; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045569; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045580; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045582; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045629; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045668; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045687; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045709; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045726; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045729; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045753; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045772; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045789; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045814; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045834; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045836; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045876; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045890; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045916; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045935; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045941; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045983; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045994; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0046023; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0046025; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044849; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044856; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044883; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044884; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044920; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044927; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044951; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044986; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045027; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045043; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045068; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045074; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045077; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045093; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045128; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045152; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045204; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045223; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045238; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045255; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045266; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045268; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045315; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045322; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045331; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045358; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045377; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045399; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045416; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045419; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045443; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045460; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045476; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045497; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045512; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045515; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045554; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045594; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045614; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045620; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045662; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045672; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045702; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0045704; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7316878
FT                   /organism="Mus musculus"
FT                   /chromosome="17"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    1224..8134
FT                   /estimated_length=6911
FT                   /gap_type="unknown"
FT   assembly_gap    10671..11660
FT                   /estimated_length=990
FT                   /gap_type="unknown"
FT   assembly_gap    15050..19038
FT                   /estimated_length=3989
FT                   /gap_type="unknown"
FT   gene            complement(24941..25570)
FT                   /pseudo
FT                   /locus_tag="mCG_1033950"
FT                   /note="gene_id=mCG1033950.0"
FT   mRNA            complement(24941..25570)
FT                   /pseudo
FT                   /locus_tag="mCG_1033950"
FT                   /note="gene_id=mCG1033950.0 transcript_id=mCT151654.1
FT                   created on 22-MAY-2002"
FT   gene            complement(32458..36121)
FT                   /gene="Zfp40"
FT                   /locus_tag="mCG_13522"
FT                   /note="gene_id=mCG13522.1"
FT   mRNA            complement(join(32458..34946,35857..36121))
FT                   /gene="Zfp40"
FT                   /locus_tag="mCG_13522"
FT                   /product="zinc finger protein 40"
FT                   /note="gene_id=mCG13522.1 transcript_id=mCT14497.1 created
FT                   on 22-MAY-2002"
FT   CDS             complement(join(32803..34946,35857..35899))
FT                   /codon_start=1
FT                   /gene="Zfp40"
FT                   /locus_tag="mCG_13522"
FT                   /product="zinc finger protein 40"
FT                   /note="gene_id=mCG13522.1 transcript_id=mCT14497.1
FT                   protein_id=mCP9801.2"
FT                   /db_xref="GOA:G3UVW7"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:99185"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVW7"
FT                   /protein_id="EDL22242.1"
FT                   /translation="MDVMWENYSNLVFVENHCICGKYEEDMDQSSNHIIYQHANIEEKS
FT                   YKYHELDKMLYESSQSTPYNTSDTTENCKMYGSDNQWDPSNESLNLKAHKSRSTEEEEY
FT                   KDYREYLNLCSIIGSYTQMDTRKKEHKITEHDKFFDSKHKLMIKRMCSGEKPYQCRKCG
FT                   KCFRTYSSLYRHRRTHPGEKPYKLTECNKSILYLSHHKVHYNIHYGEKPYKCIECGKCY
FT                   YHSSFEKHYRIHSEEESYKCNDCRKSFICCLGLKRHHKIHGGERPYECKQCSKSFYTSS
FT                   HLENHYRTHRRKLHRCNECGKSLSSSSGLQRHQRIHRGEKAYICAECNKCFIQKSQLKT
FT                   HQRIHTGEKSYKCSECEKSFTVGSSLRIHQRIHTGEKPYKCSECHKCFIQQAHLRRHQK
FT                   IHTGEKPYKCSECEKSFTVGSDLRMHQKIHTGEKPYKCSDCDKCFIQKAKLKKHQRIHT
FT                   GEKPYKCSECEKCFTVVSDLRTHQKIHTGEKPYKCSECDKCFIRKANLRRHHRIHTGEK
FT                   PYKCSDCGKCFIQKANLRTHERIHTGEKPYKCECGKSFTVGSDLRKHQKCHTGEKPYKC
FT                   SECNKCFIRKAHLRRHQRIHTGEKPYKCSDCGKCFIQKANLRTHQKIHTGEKPYKCSEC
FT                   DKCFIQKDHLRTHQRLHTGEKPYKCSECEKSFTGGSVLRKHQKIHTARSLTNAMNLTNP
FT                   LSKKPTLELIKEFIQESSLLNAMYIAQSLPASHV"
FT   assembly_gap    59885..59904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    79731..80409
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   assembly_gap    91626..94541
FT                   /estimated_length=2916
FT                   /gap_type="unknown"
FT   gene            complement(100464..>131369)
FT                   /locus_tag="mCG_13523"
FT                   /note="gene_id=mCG13523.2"
FT   mRNA            complement(join(100464..101364,120223..120329,
FT                   120605..120832,127818..128630,128893..129184,
FT                   131173..>131369))
FT                   /locus_tag="mCG_13523"
FT                   /product="mCG13523"
FT                   /note="gene_id=mCG13523.2 transcript_id=mCT14498.2 created
FT                   on 22-MAY-2002"
FT   CDS             complement(join(100848..101364,120223..120329,
FT                   120605..120832,127818..128630,128893..>129048))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13523"
FT                   /product="mCG13523"
FT                   /note="gene_id=mCG13523.2 transcript_id=mCT14498.2
FT                   protein_id=mCP9802.2"
FT                   /protein_id="EDL22243.1"
FT                   /translation="LETLIHFSEQNSDNPPNYVCVEEMNCAVLLTGPEWEKSLRLQKII
FT                   DLYRSQKVLQLTYGPFHPILSDNEQFPYLYQMAPKDTSLALAMISFIVHFSWNWIGLAI
FT                   SDNDQGVQFLSYLRREMEKNTVCFAFVNMITVDIHLYMSRTEVYYNQIMTSTTNVVIIY
FT                   GNPDSTLALSFRMWESLRIQRLWVTTSQWDFTTSTSYFTLDSFYGTLAFVHNHAVIYGF
FT                   KRFVQTLNLLKYSDNYLARLEWMEFNCEVSVSNSKTLKNSLSNVTLEWLIEQTFEMAFS
FT                   DNIYDLYNAVYAVAHAIHGMLFQRMSNLEKDNGKGHNSHCLELNSFLRKTHFTNPVGER
FT                   VNMNQKEKLQAAYDIFYLLNFPHGLGIKVKIGKFSPDFPQGQQLLLSEDMIEWTTGSRQ
FT                   KIMPYSFSTIVITTQRDLNVLCYDEKKKLRLPVRKNDNFLSPSDMDQCVRCPEDKYAKT
FT                   EKNHCIHKAVLFLSYDDPLGMTLALMAFCFSVFTLLALGVFVKHHNTPIVKANNRTLSY
FT                   ILLVSLLFCFLCSFFFIGSPNSATCILQQITFGLVFTMAVSTVLAKTITVVMAFKVTVN
FT                   EGIMRHFLVSGAPKYIIPITILIQIILCAI"
FT   assembly_gap    101600..103823
FT                   /estimated_length=2224
FT                   /gap_type="unknown"
FT   assembly_gap    107068..112000
FT                   /estimated_length=4933
FT                   /gap_type="unknown"
FT   assembly_gap    133245..133264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(145215..166235)
FT                   /locus_tag="mCG_1033924"
FT                   /note="gene_id=mCG1033924.0"
FT   mRNA            complement(join(145215..146133,151141..151264,
FT                   161929..162156,163728..164541,164859..165150,
FT                   166033..166235))
FT                   /locus_tag="mCG_1033924"
FT                   /product="mCG1033924"
FT                   /note="gene_id=mCG1033924.0 transcript_id=mCT151628.1
FT                   created on 22-MAY-2002"
FT   assembly_gap    159771..159790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(164047..164541,164859..165150,
FT                   166033..166229))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033924"
FT                   /product="mCG1033924"
FT                   /note="gene_id=mCG1033924.0 transcript_id=mCT151628.1
FT                   protein_id=mCP84597.1"
FT                   /protein_id="EDL22244.1"
FT                   /translation="MFTLIFLFWLLNIPLLLADFISPRCFWKMKQNENRDRNQGTGCTF
FT                   MIHAVQRPVEKEYFSHILNIQTHAENYKNVLALAFSIYEINRNPDILPNMSVRFTVSKY
FT                   NCYWESELMSLIQLSLQNHDILPNYMCKELTRCTMALTRLNWVTTVKLNTILNNFISQQ
FT                   FFQITYGPFHPVLSDHEKFPYLYQMASDHTSLALALVSFIIHFSWNWVGLAILDNDQGI
FT                   QFLSYLRREMEKNAVCFAFVNMIPMSMNLYMSRAEVYYNQIMTSSTNVVIIYGDTDSTL
FT                   AVSFRMWESLGIQRLWITTSQWDVSPSMKDFTFGNEYGTFAFGQHP"
FT   gene            191234..>207277
FT                   /locus_tag="mCG_51145"
FT                   /note="gene_id=mCG51145.2"
FT   mRNA            join(191234..191359,192239..192530,192826..193638,
FT                   195033..195260,204113..204236,206358..>207277)
FT                   /locus_tag="mCG_51145"
FT                   /product="mCG51145"
FT                   /note="gene_id=mCG51145.2 transcript_id=mCT51328.2 created
FT                   on 23-MAY-2002"
FT   CDS             join(191247..191359,192239..192530,192826..193638,
FT                   195033..195260,204113..204236,206358..207277)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51145"
FT                   /product="mCG51145"
FT                   /note="gene_id=mCG51145.2 transcript_id=mCT51328.2
FT                   protein_id=mCP31888.2"
FT                   /protein_id="EDL22245.1"
FT                   /translation="MKQNENRDRNQGTGCTFMIHAVQRPVEKEYFSHILNIQTHTENHK
FT                   YALALAFSIYEINMNPDILPNMSLIFEFSVHNCVWESKLMSFMHVSLQNYDIFPNYLCK
FT                   EYTKCAMALTSLNWATTVKFNTILNNFISQQFFQITYGPFHPVLSDHEKFPYLHQMASD
FT                   HTSLALGLVSFIIHFGWNWVGLVISDNDQGIQFLSYLKTEMEKNTICFAFVNMIPMSMN
FT                   LYMSKAEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLGIQRLWITTSQWNVSPGM
FT                   KDFTFGNEYGTFAFGQHHSEISGFKHFVQTLNSVKCPDEYLVKLEWMHFNCEVSASKCK
FT                   TLKNCSSNHSLEWLMVHTFDMAFIEGSYDIYNAVYAFAHALHQITFQKFDNLPKDNGKE
FT                   HNYSCKKLYSFLRKTQFTNPVGDRVNMNQRDKLQEEYDIFYIWNFPQGLGFKVKIGIFS
FT                   PYFPNGQQVHLSEDMIEWAKGSTQMPTSVCSADCGPGSRKFRMDGMAACCFHCKPCPEN
FT                   EISNETNVDYCIQCLEDQYANTEQNHCIRKIVVFLSYEEPLGVALSLISLFFSAFTIVV
FT                   LGVIVKHHSTPVVKANNRTLTYILLISLIFCFLCPLLFIGHPNAATCILQQITFGIVFT
FT                   VSVSTVLAKTITVVLAFKITASQRMMKYFLVSGAINYIIPICILIQVIVCAVWLGASPP
FT                   SVDIDGQSEHGQIIIVCHKGSVNAFYCVLGYLATLAIGSFTLAFFSRNLPGAFNEAKSI
FT                   TFSMLVFCSVWVTFIPVYHSTKGKVMVAVEIFSTLASSAGMLGCIFVPKCYTILFRPDQ
FT                   NSLEMIRVKSSSHARIS"
FT   assembly_gap    192673..192692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    215103..215276
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    217734..217753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    221474..221493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    223998..224072
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    225599..227341
FT                   /estimated_length=1743
FT                   /gap_type="unknown"
FT   gene            <231606..>249009
FT                   /locus_tag="mCG_52599"
FT                   /note="gene_id=mCG52599.2"
FT   mRNA            join(<231606..231802,232715..233003,233473..234213,
FT                   235558..235737,244782..244905,248186..>249009)
FT                   /locus_tag="mCG_52599"
FT                   /product="mCG52599"
FT                   /note="gene_id=mCG52599.2 transcript_id=mCT52782.2 created
FT                   on 23-MAY-2002"
FT   CDS             join(231606..231802,232715..233003,233473..234213,
FT                   235558..235737,244782..244905,248186..249009)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52599"
FT                   /product="mCG52599"
FT                   /note="gene_id=mCG52599.2 transcript_id=mCT52782.2
FT                   protein_id=mCP31893.2"
FT                   /protein_id="EDL22246.1"
FT                   /translation="MFTLIFLFLFLNIPLLVADFISPRCFWKMKQNEYRDRHHGTGCIF
FT                   LILAIQQPVKKEYFSHILNIQTHTENHKYALALAFSIYEINRNPDLLPNMSLIFIFSAD
FT                   SCEWESELSLIRFGLQNSDNLPNYLCEELTKCILALTNMNWATTVTLHTILSNFLSDQM
FT                   ASDHTSLALALVSFIIHFGWNWVGLVISDSDQGIQFLSYLRREMEKYTLCFAFVNMIPL
FT                   NINLYMSRAEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLGIQRLWITTSRWDVT
FT                   PSMKDFTFGNKYGTFAFEQHHSEISGFKHFVQTLNSVKCPDEYLVKLEWMHFNCEVSAS
FT                   KCKTLKNCSSNHSLKWLMVHTFDMAFIEESYYIYNAVYAFAHVLHQFTFQKFDNLPKDN
FT                   GKEHNYSCKKLYSYLRKNHFINPVGDRVSMNQRDKLQEEYDIVYIWNFPQGLGLRVKIG
FT                   MFSPYFPNGQQVPTSMCSADCGPGSRKFRMDGMAACCFHCKPCPENEISNETKPLGMAL
FT                   SLLSLCFSAFTTVVLGIFVKHHNTPIVKANNRTLTYLLLISLIFCFLCPLLFIGHPNSA
FT                   TCILQQLTFGVVFTVSLSTVLAKTITVVLAFKIIASQRMMKYFLISGAINYIIPICILI
FT                   QVIVCAVWLRASPPSVDIDAHSEHGQIIIVCHKGSVNAFYCVLGYLAILAFGSFTLAFL
FT                   SRNLPGAFNEAKSITFSMLVFCSVWVTFIPVYHSTKGKVMVAVEIFSTLASSAGMLGCI
FT                   FVPKCYTILFRQDQNSLEMIRVKSSSNVHVS"
FT   assembly_gap    235875..235894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    242685..243091
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    271448..271467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    277361..278192
FT                   /estimated_length=832
FT                   /gap_type="unknown"
FT   assembly_gap    284523..284760
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   gene            complement(286314..291470)
FT                   /pseudo
FT                   /locus_tag="mCG_1033933"
FT                   /note="gene_id=mCG1033933.0"
FT   mRNA            complement(join(286314..287233,291347..291470))
FT                   /pseudo
FT                   /locus_tag="mCG_1033933"
FT                   /note="gene_id=mCG1033933.0 transcript_id=mCT151637.0
FT                   created on 23-MAY-2002"
FT   assembly_gap    295732..296158
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   gene            complement(<305260..>325172)
FT                   /locus_tag="mCG_13524"
FT                   /note="gene_id=mCG13524.1"
FT   mRNA            complement(join(<305260..306179,316762..316885,
FT                   320979..321158,322707..323519,323803..324094,
FT                   324976..>325172))
FT                   /locus_tag="mCG_13524"
FT                   /product="mCG13524"
FT                   /note="gene_id=mCG13524.1 transcript_id=mCT14499.1 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(305260..306179,316762..316885,
FT                   320979..321158,322707..323519,323803..324094,
FT                   324976..325172))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13524"
FT                   /product="mCG13524"
FT                   /note="gene_id=mCG13524.1 transcript_id=mCT14499.1
FT                   protein_id=mCP9803.1"
FT                   /protein_id="EDL22247.1"
FT                   /translation="MFTLIFLFWLLNIPLLVSDFIYPRCFWKIKQNEDKNRNQGTECTF
FT                   MIHAVQRPVEKEYFSHILNIQTHTENHKYALALAFSIYEINRNPDILPNMSLTFKFSNY
FT                   NCHWKSKYNSFIHLSLQNHDILPNYMCKEFTKCAMALTRLNWATTVKLNTILNNFMSQQ
FT                   FLQITYGPFHPVLSDHEKFPYLYQMASDHTSLALALVSFIIHFSWNWVGLVISDNDEDI
FT                   QFLSYLRREMEKNTVCFAFVNMIPMSMNLYMSRAEVYYNQIMTSSTNVVIIYGDTDSTL
FT                   AVSFRMWESLGIQRLWITTSQWDVSPSMKDFTFGNEYGTFAFGQHHSEISGFKHFVQTL
FT                   NSVKCPDEYLVKLEWMHFNCEVSASKCKTLKNCSSNHSLEWLMVHTFDMAFIEGSYDIY
FT                   NAVYAFAHALHQIAFQKLDNLPKDNGKEHNYSCKKLYSFLRKTQFTNPVGDRVNMNRRN
FT                   KLQEEYDIFYIWNFPQGLGLRVKIGMFSPYFPNGQQVPTSVCSAECGPGSRKFRMDGMA
FT                   ACCFHCKPCPENEISNETNVDYCVQCLEDQYANTEQNQCIRKTVVFLSYEEPLGMALSL
FT                   LSLCFSAFTTVVLGVMVKHHSTPIVKANNRTLTYILLISLIFCFLCPLLFIGHPNAATC
FT                   ILQQITFGVVFTVSVSTVLAKTITVVLAFKITASQRMMKYFLVSGAINYIIPICILIQV
FT                   IVCAVWLRASPPSVDIDAHSEHGQIIIVCHKGSVNAFYCVLGYLATLAIGSFTLAFFSR
FT                   NLPGAFNEAKSITFSMLVFCSVWVTFIPVYYSTKGKVMVAVEIFSILASSAGMLGCIFV
FT                   PKCYTILFRPDQNSLEMIRVKSSSNAHVS"
FT   assembly_gap    333875..333894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    336143..336162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    340575..340814
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    347929..348640
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   gene            354046..354913
FT                   /pseudo
FT                   /locus_tag="mCG_49084"
FT                   /note="gene_id=mCG49084.2"
FT   mRNA            354046..354913
FT                   /pseudo
FT                   /locus_tag="mCG_49084"
FT                   /note="gene_id=mCG49084.2 transcript_id=mCT49267.2 created
FT                   on 23-MAY-2002"
FT   assembly_gap    369702..372026
FT                   /estimated_length=2325
FT                   /gap_type="unknown"
FT   assembly_gap    374067..375198
FT                   /estimated_length=1132
FT                   /gap_type="unknown"
FT   assembly_gap    381676..381695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    390721..390787
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            complement(395689..403241)
FT                   /locus_tag="mCG_8063"
FT                   /note="gene_id=mCG8063.1"
FT   mRNA            complement(join(395689..397233,398237..398402,
FT                   398488..398558,399015..399132,400176..400690,
FT                   403009..403241))
FT                   /locus_tag="mCG_8063"
FT                   /product="mCG8063"
FT                   /note="gene_id=mCG8063.1 transcript_id=mCT6430.1 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(396581..397233,398237..398402,
FT                   398488..398558,399015..399132,400176..400574))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8063"
FT                   /product="mCG8063"
FT                   /note="gene_id=mCG8063.1 transcript_id=mCT6430.1
FT                   protein_id=mCP7036.1"
FT                   /db_xref="GOA:B2RX03"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR008916"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:3053094"
FT                   /db_xref="UniProtKB/TrEMBL:B2RX03"
FT                   /protein_id="EDL22248.1"
FT                   /translation="MASLQELQDPAPGEEEGLMIVKVEDCSWEQEPVQPVDSRDSEACR
FT                   QRFRQFCFRDAGGPHEAFSQLWELCCRWLRPELHSKEQILELLVLEQFLAVLPGEIQAQ
FT                   LQRQHLGSGEEAVALVEDIQNQSLKAWPQDELSEAEPKAAVQGLQATGSPQKAGVQKQL
FT                   PALQGQRSHAQLPVLKERQTGEVLDGCFDSAVDLPGRPELGRISPFQKSGSLGDIPFYC
FT                   SREEWSSLDPAQRNLFWNIKRKNSRDAALGLRPKSQKPPAEEAATALLGQTEVPMSWNP
FT                   EQAETEVWESENPMRTALDPLVGARRGRPPTHRRQFQNLLAEKPHSCAQCGKRFRWGSD
FT                   LARHQRTHTGEKPHKCPECDKSFRSSSDLVRHQGVHTGEKPFSCSECGKSFSRSAYLAD
FT                   HQRIHTGEKPFSCSECGKSFALRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQS
FT                   LHSKMAQPVG"
FT   assembly_gap    397645..397664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    398656..398881
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    407223..407329
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    410620..410823
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    414360..414379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(414707..425107)
FT                   /gene="Zfp13"
FT                   /locus_tag="mCG_140399"
FT                   /note="gene_id=mCG140399.1"
FT   mRNA            complement(join(414707..415974,418973..419093,
FT                   419632..419723,419918..420131,424292..424428,
FT                   424815..>425054))
FT                   /gene="Zfp13"
FT                   /locus_tag="mCG_140399"
FT                   /product="zinc finger protein 13, transcript variant
FT                   mCT191670"
FT                   /note="gene_id=mCG140399.1 transcript_id=mCT191670.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(<414920..416010,418973..419093,
FT                   419632..419723,419918..420131,424292..424428,
FT                   424815..425107))
FT                   /gene="Zfp13"
FT                   /locus_tag="mCG_140399"
FT                   /product="zinc finger protein 13, transcript variant
FT                   mCT169409"
FT                   /note="gene_id=mCG140399.1 transcript_id=mCT169409.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(join(414920..415974,418973..419093,
FT                   419632..419723,419918..420131,424292..424428,
FT                   424815..>424824))
FT                   /codon_start=1
FT                   /gene="Zfp13"
FT                   /locus_tag="mCG_140399"
FT                   /product="zinc finger protein 13, isoform CRA_b"
FT                   /note="gene_id=mCG140399.1 transcript_id=mCT191670.0
FT                   protein_id=mCP112639.0 isoform=CRA_b"
FT                   /protein_id="EDL22250.1"
FT                   /translation="SFPGSWLKPGRGSTSKGKNHLLFFLALKWKMSADSQSIAATENEE
FT                   KSHEVPGNVQHCGDMLSGQEETVPLGTSQESTHIKAEPEEPHSEGASREDRTPGTQRWM
FT                   SPCPGPKDKGPFLPGGVVPSPWTPVLSRGGRTRERKMAAALLTAWSQMPVTFEDVALYL
FT                   SQEEWGRLDHTQQNFYRDVLQGKNGLALGAVEMGKVVPALAVATLEDTKSIRTRARWAP
FT                   GEDPKCGQHVASGPGTKLTRDTGKAGQLKPAPSESRPLKTPEDSGPEKPSEGEEALKSG
FT                   EEGLVPDGDTGKKTYKCEQCGKGFSWHSHLVTHRRTHTGEKPYTCTDCGKRFGRSSHLI
FT                   QHQIIHTGEKPYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQ
FT                   GTHTGAKPHKCPICSKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTH
FT                   TGEKPYHCLDCGKSFSHSSHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHRHEKIHTTG
FT                   PKALAMLMLGAAAAGALTAPPPAST"
FT   CDS             complement(join(414920..416010,418973..419093,
FT                   419632..419723,419918..420131,424292..424348))
FT                   /codon_start=1
FT                   /gene="Zfp13"
FT                   /locus_tag="mCG_140399"
FT                   /product="zinc finger protein 13, isoform CRA_a"
FT                   /note="gene_id=mCG140399.1 transcript_id=mCT169409.0
FT                   protein_id=mCP92163.0 isoform=CRA_a"
FT                   /protein_id="EDL22249.1"
FT                   /translation="MSADSQSIAATENEEKSHEVPGNVQHCGDMLSGQEETVPLGTSQE
FT                   STHIKAEPEEPHSEGASREDRTPGTQRWMSPCPGPKDKGPFLPGGVVPSPWTPVLSRGG
FT                   RTRERKMAAALLTAWSQMPVTFEDVALYLSQEEWGRLDHTQQNFYRDVLQGKNGLALEV
FT                   YRQLAAYLFTGAVEMGKVVPALAVATLEDTKSIRTRARWAPGEDPKCGQHVASGPGTKL
FT                   TRDTGKAGQLKPAPSESRPLKTPEDSGPEKPSEGEEALKSGEEGLVPDGDTGKKTYKCE
FT                   QCGKGFSWHSHLVTHRRTHTGEKPYTCTDCGKRFGRSSHLIQHQIIHTGEKPYTCPSCW
FT                   KSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPHKCPICSKCF
FT                   TQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHS
FT                   SHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALT
FT                   APPPAST"
FT   assembly_gap    436478..436927
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   gene            436928..437921
FT                   /pseudo
FT                   /locus_tag="mCG_8064"
FT                   /note="gene_id=mCG8064.1"
FT   mRNA            436928..437921
FT                   /pseudo
FT                   /locus_tag="mCG_8064"
FT                   /note="gene_id=mCG8064.1 transcript_id=mCT6431.1 created on
FT                   26-JUN-2003"
FT   gene            441129..451410
FT                   /locus_tag="mCG_56431"
FT                   /note="gene_id=mCG56431.1"
FT   mRNA            join(441129..441297,445841..446300,447460..447724,
FT                   447916..447980,448498..448555,449656..451410)
FT                   /locus_tag="mCG_56431"
FT                   /product="mCG56431"
FT                   /note="gene_id=mCG56431.1 transcript_id=mCT56614.2 created
FT                   on 23-MAY-2002"
FT   CDS             join(445908..446300,447460..447724,447916..447980,
FT                   448498..448555,449656..451223)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56431"
FT                   /product="mCG56431"
FT                   /note="gene_id=mCG56431.1 transcript_id=mCT56614.2
FT                   protein_id=mCP29572.2"
FT                   /db_xref="GOA:Q3URR7"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR008916"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:3040700"
FT                   /db_xref="PDB:4E6S"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3URR7"
FT                   /protein_id="EDL22251.1"
FT                   /translation="MLAEPVPDALEQEHPGAVKLEEDEVGEEDPRLAESRPRPEVAHQL
FT                   FRCFQYQEDMGPRASLGRLRELCNHWLRPALHTKKQILELLVLEQFLSVLPPHVLSRLH
FT                   GQPLRDGEEVVQLLEGVPRDISHMGPLDFSFSAGKNAPADIISEEQNSPSQVPSHSPQT
FT                   ELPSEEIPALHPLNELPPPQPAPIRPAEPEEWRLAPSSNWPMSPEPQEILQDPRESNPS
FT                   QGPSWLEENSRDQELAAVLESLTFEDTSEKRAWPANPLGFGSRMPDNEELKVEEPKVTT
FT                   WPVVIGAESQTEKPEVAGEPLTQTEGQETSSTGWGGTPADGSEVVKVRGASDAPEPQGE
FT                   MQFICTYCGVNFPEMSHLQAHQLQSHPNLQPHPSSRSFRCLWCGKTFGRSSILKLHMRT
FT                   HTDERPHACHLCNRRFRQSSHLTKHLLTHSSEPAFRCAECNQGFQRRSSLMQHLLAHAQ
FT                   GKNLTPNPEGKTKVPEMAAVLCSHCGQTFKRRSSLKRHLRNHAKDKDHLSSEDPGSLSS
FT                   SQESNPYVCSDCGKAFRQSEQLMIHTRRVHTRERPFSCQVCGRCFTQNSQLISHQQIHT
FT                   GEKPHACPQCSKRFVRRAGLARHLLTHGSLRPYHCAQCGKSFRQMRDLTRHVRCHTGEK
FT                   PCRCNECGEGFTQNAHLARHQRIHTGEKPHACDICGHRFRNSSNLARHRRSHTGERPYS
FT                   CPTCGRSFRRNAHLQRHLITHTGSKQEKEVPQECPECGKSFNRSCNLLRHLLVHTGARP
FT                   YSCALCGRSFSRNSHLLRHLRTHARESLY"
FT   gene            complement(459466..461102)
FT                   /pseudo
FT                   /locus_tag="mCG_1033926"
FT                   /note="gene_id=mCG1033926.1"
FT   mRNA            complement(join(459466..459586,460270..461102))
FT                   /pseudo
FT                   /locus_tag="mCG_1033926"
FT                   /note="gene_id=mCG1033926.1 transcript_id=mCT151630.1
FT                   created on 23-MAY-2002"
FT   gene            complement(<470876..>485584)
FT                   /gene="Mmp25"
FT                   /locus_tag="mCG_8066"
FT                   /note="gene_id=mCG8066.2"
FT   mRNA            complement(join(<470876..471144,471314..471571,
FT                   471651..471803,472101..472183,472859..472943,
FT                   473044..473220,480508..480797,480894..481029,
FT                   484927..485059,485480..>485584))
FT                   /gene="Mmp25"
FT                   /locus_tag="mCG_8066"
FT                   /product="matrix metallopeptidase 25"
FT                   /note="gene_id=mCG8066.2 transcript_id=mCT6424.2 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(470876..471144,471314..471571,
FT                   471651..471803,472101..472183,472859..472943,
FT                   473044..473220,480508..480797,480894..481029,
FT                   484927..485059,485480..>485584))
FT                   /codon_start=1
FT                   /gene="Mmp25"
FT                   /locus_tag="mCG_8066"
FT                   /product="matrix metallopeptidase 25"
FT                   /note="gene_id=mCG8066.2 transcript_id=mCT6424.2
FT                   protein_id=mCP7038.2"
FT                   /protein_id="EDL22252.1"
FT                   /translation="LRLPAFGLPLLALLLVPLLPVRAQNPDAKVVSMGVEWLTRYGYLP
FT                   PADPVHAQMQSLEKLQDAIKVMQRFAGLPETGQMDPMTIKTMRKPRCSLPDVLGAAGLV
FT                   RRRRRYSLSGSVWKKRTLTWSIRSFSQKSQLSPQIVRTLLSYALAVWATESGLTFQEVN
FT                   SQYQEPDIIIHFARAYHQDSYPFDGSGGTLAHAFFPGEHPISGDTHFDDEETWTFGSTD
FT                   DNGIDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPATYRLPQDDRDGLQQLYG
FT                   RVSQNPNARPTRKPLVPPPQPPAMPPDSPATPVPDRCEGNFDAVANIRGEIFLFKGPWF
FT                   WRLQPSGQLVSPRPAGLHRFWEGLPTHVKVIQAAYARPLDGRIILFSGPQFWVFQERQL
FT                   EGAARPLVEFGLPPGEDVDAVFSWPHNGKTYLIRGQKYWRYDEVAARPDPGYPRALSLW
FT                   DGAPFAPDDVTISNTGDTYFFKGTHFWRFAEGSVKAESDSPQPIGPKWLDCPAPNSDPR
FT                   VTSPPKTTSKTRSCDCHCELNQASEQLSPLLLPLLPLVAGEVFSY"
FT   assembly_gap    477598..477653
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    480018..480294
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    482032..482051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            483130..484034
FT                   /pseudo
FT                   /locus_tag="mCG_1033934"
FT                   /note="gene_id=mCG1033934.1"
FT   mRNA            join(483130..483360,483954..484034)
FT                   /pseudo
FT                   /locus_tag="mCG_1033934"
FT                   /note="gene_id=mCG1033934.1 transcript_id=mCT151638.1
FT                   created on 23-MAY-2002"
FT   assembly_gap    491774..491887
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    496110..496641
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    499586..499683
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   gene            501573..509484
FT                   /gene="BC038613"
FT                   /locus_tag="mCG_8077"
FT                   /note="gene_id=mCG8077.2"
FT   mRNA            join(501573..501611,502820..503121,506255..506470,
FT                   506608..506724,506809..506955,507616..507813,
FT                   507927..508076,508416..508546,508756..508876,
FT                   508970..509484)
FT                   /gene="BC038613"
FT                   /locus_tag="mCG_8077"
FT                   /product="cDNA sequence BC038613, transcript variant
FT                   mCT6417"
FT                   /note="gene_id=mCG8077.2 transcript_id=mCT6417.2 created on
FT                   23-MAY-2002"
FT   mRNA            join(<501579..501611,502827..503121,506255..506470,
FT                   506608..506724,506809..506955,507616..507813,
FT                   507927..508076,508416..508546,508756..508876,
FT                   508970..509477)
FT                   /gene="BC038613"
FT                   /locus_tag="mCG_8077"
FT                   /product="cDNA sequence BC038613, transcript variant
FT                   mCT191712"
FT                   /note="gene_id=mCG8077.2 transcript_id=mCT191712.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<501580..501611,502827..503121,506255..506470,
FT                   506608..506724,506809..506955,507616..507813,
FT                   507927..508076,508416..508546,508756..508876,
FT                   508970..509131)
FT                   /codon_start=1
FT                   /gene="BC038613"
FT                   /locus_tag="mCG_8077"
FT                   /product="cDNA sequence BC038613, isoform CRA_a"
FT                   /note="gene_id=mCG8077.2 transcript_id=mCT191712.0
FT                   protein_id=mCP112686.0 isoform=CRA_a"
FT                   /protein_id="EDL22253.1"
FT                   /translation="GGPRREPGGDRCEGTMDSPGEPSFPSGLLSGCASPSGDEGFFPFV
FT                   LERRDSFLGGGPGPEEPEDLALQLQQKEKDLLLAAELGKMLLERNEELRRQLETLNTQH
FT                   LEHEERLQQENHELRRGLAARGAEWEARAVELEGDVEALRAQLGEQRSERQDSGRERAR
FT                   ALGELSEQNLRLSQQLAQASRSEQELQRELDTLRERCQTQALAGAELGARLESLQAENQ
FT                   MLQDRRQDLEAQIRGLREEVDKGQNRLQTTHEELLLLRRERKEHKLELERARFEAGEAL
FT                   RTLRGLQRRVSELEEESRLQDTEISGASLQTELAHSLDSDQDQDQQVNECGGSQAILSP
FT                   ETQETSSPQPSIQEEILEPPKKRASLSPVEILEEKEAEVARLQDEITLHRTELQTLRDE
FT                   LQRQKELRAQDNPEEALSSALSDRDEAVNKAMKLSLELSRVSLERDSLSRELLRAIRQK
FT                   VALTQELEAWQDDMQVVIGQQLRSQRQKELSEAAAAPRRAKTRFSLRLGSGQSGGFLSN
FT                   LFRRT"
FT   CDS             join(502840..503121,506255..506470,506608..506724,
FT                   506809..506955,507616..507813,507927..508076,
FT                   508416..508546,508756..508876,508970..509131)
FT                   /codon_start=1
FT                   /gene="BC038613"
FT                   /locus_tag="mCG_8077"
FT                   /product="cDNA sequence BC038613, isoform CRA_b"
FT                   /note="gene_id=mCG8077.2 transcript_id=mCT6417.2
FT                   protein_id=mCP7032.2 isoform=CRA_b"
FT                   /protein_id="EDL22254.1"
FT                   /translation="MDSPGEPSFPSGLLSGCASPSGDEGFFPFVLERRDSFLGGGPGPE
FT                   EPEDLALQLQQKEKDLLLAAELGKMLLERNEELRRQLETLNTQHLEHEERLQQENHELR
FT                   RGLAARGAEWEARAVELEGDVEALRAQLGEQRSERQDSGRERARALGELSEQNLRLSQQ
FT                   LAQASRSEQELQRELDTLRERCQTQALAGAELGARLESLQAENQMLQDRRQDLEAQIRG
FT                   LREEVDKGQNRLQTTHEELLLLRRERKEHKLELERARFEAGEALRTLRGLQRRVSELEE
FT                   ESRLQDTEISGASLQTELAHSLDSDQDQDQQVNECGGSQAILSPETQETSSPQPSIQEE
FT                   ILEPPKKRASLSPVEILEEKEAEVARLQDEITLHRTELQTLRDELQRQKELRAQDNPEE
FT                   ALSSALSDRDEAVNKAMKLSLELSRVSLERDSLSRELLRAIRQKVALTQELEAWQDDMQ
FT                   VVIGQQLRSQRQKELSEAAAAPRRAKTRFSLRLGSGQSGGFLSNLFRRT"
FT   gene            complement(509480..>514778)
FT                   /gene="Thoc6"
FT                   /locus_tag="mCG_8078"
FT                   /note="gene_id=mCG8078.3"
FT   mRNA            complement(join(509480..509753,509844..509978,
FT                   510064..510174,510259..510321,510395..510444,
FT                   510714..510816,510903..510974,511316..511419,
FT                   511508..511572,511659..511774,514449..>514725))
FT                   /gene="Thoc6"
FT                   /locus_tag="mCG_8078"
FT                   /product="THO complex 6 homolog (Drosophila), transcript
FT                   variant mCT6421"
FT                   /note="gene_id=mCG8078.3 transcript_id=mCT6421.2 created on
FT                   23-MAY-2002"
FT   mRNA            complement(join(509485..509753,509844..509978,
FT                   510064..510174,510259..510321,510395..510444,
FT                   510714..510974,511060..511419,511508..511572,
FT                   511659..511774,514449..>514778))
FT                   /gene="Thoc6"
FT                   /locus_tag="mCG_8078"
FT                   /product="THO complex 6 homolog (Drosophila), transcript
FT                   variant mCT191715"
FT                   /note="gene_id=mCG8078.3 transcript_id=mCT191715.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(509673..509753,509844..509978,
FT                   510064..510174,510259..510321,510395..510444,
FT                   510714..510816,510903..510974,511316..511419,
FT                   511508..511572,511659..511774,514449..>514514))
FT                   /codon_start=1
FT                   /gene="Thoc6"
FT                   /locus_tag="mCG_8078"
FT                   /product="THO complex 6 homolog (Drosophila), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG8078.3 transcript_id=mCT6421.2
FT                   protein_id=mCP7035.2 isoform=CRA_c"
FT                   /protein_id="EDL22257.1"
FT                   /translation="SPLGLVVLKMEHAAPLAVPLGQAEVFQALQRLHMTIFSQSVSPCG
FT                   KFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVVVFHAHDGPVYSMVSTDRHLLSAGDG
FT                   EVKGWLWAEILKKENSLILAGGDCQLHSMDLETGAFTRALRGHTDYIHCLALRERSPEV
FT                   LSGGEDGAVRLWDLRIAKEVQTIEVYKHEECSRPHNGRWIGCLATDSDWMVCGGGPALT
FT                   LWHLRSSTPTTVFPIRAPQKHVTFYQDLILSAGQGCCVNHWQLSGELKAQVPGSSPGLL
FT                   SLSLNQQPAAPECKVLTASGNSCRVDVFTNLGYRAFSLSF"
FT   CDS             complement(join(509673..509753,509844..509978,
FT                   510064..510174,510259..510321,510395..510444,
FT                   510714..>510840))
FT                   /codon_start=1
FT                   /gene="Thoc6"
FT                   /locus_tag="mCG_8078"
FT                   /product="THO complex 6 homolog (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG8078.3 transcript_id=mCT191715.0
FT                   protein_id=mCP112688.0 isoform=CRA_b"
FT                   /protein_id="EDL22256.1"
FT                   /translation="AVHRSSLQRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLR
FT                   IAKEVQTIEVYKHEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTVFPI
FT                   RAPQKHVTFYQDLILSAGQGCCVNHWQLSGELKAQVPGSSPGLLSLSLNQQPAAPECKV
FT                   LTASGNSCRVDVFTNLGYRAFSLSF"
FT   mRNA            complement(join(<510395..510444,510714..510816,
FT                   510903..510974,511060..511108,511190..511227,
FT                   511316..511419,511508..511572,511659..511774,
FT                   514449..>514676))
FT                   /gene="Thoc6"
FT                   /locus_tag="mCG_8078"
FT                   /product="THO complex 6 homolog (Drosophila), transcript
FT                   variant mCT191714"
FT                   /note="gene_id=mCG8078.3 transcript_id=mCT191714.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<510395..510444,510714..510816,
FT                   510903..510974,511060..511108,511190..511227,
FT                   511316..511419,511508..511572,511659..511774,
FT                   514449..>514514))
FT                   /codon_start=1
FT                   /gene="Thoc6"
FT                   /locus_tag="mCG_8078"
FT                   /product="THO complex 6 homolog (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG8078.3 transcript_id=mCT191714.0
FT                   protein_id=mCP112687.0 isoform=CRA_a"
FT                   /protein_id="EDL22255.1"
FT                   /translation="SPLGLVVLKMEHAAPLAVPLGQAEVFQALQRLHMTIFSQSVSPCG
FT                   KFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVVVFHAHDGPVYSMVSTDRHLLSAGDG
FT                   EVKGWLWAEILKKGCKELWRRQPPYRTSLEVPEINALLLVPKENSLILAGGDCQLHSMD
FT                   LETGAFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYKHE"
FT   assembly_gap    511851..511870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            514543..516459
FT                   /gene="Hcfc1r1"
FT                   /locus_tag="mCG_8073"
FT                   /note="gene_id=mCG8073.2"
FT   mRNA            join(514543..515003,515428..515610,515819..516459)
FT                   /gene="Hcfc1r1"
FT                   /locus_tag="mCG_8073"
FT                   /product="host cell factor C1 regulator 1 (XPO1-dependent),
FT                   transcript variant mCT6427"
FT                   /note="gene_id=mCG8073.2 transcript_id=mCT6427.2 created on
FT                   23-MAY-2002"
FT   mRNA            join(514543..515003,515470..515610,515819..516459)
FT                   /gene="Hcfc1r1"
FT                   /locus_tag="mCG_8073"
FT                   /product="host cell factor C1 regulator 1 (XPO1-dependent),
FT                   transcript variant mCT169418"
FT                   /note="gene_id=mCG8073.2 transcript_id=mCT169418.0 created
FT                   on 23-MAY-2002"
FT   CDS             join(514918..515003,515428..515610,515819..515954)
FT                   /codon_start=1
FT                   /gene="Hcfc1r1"
FT                   /locus_tag="mCG_8073"
FT                   /product="host cell factor C1 regulator 1 (XPO1-dependent),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8073.2 transcript_id=mCT6427.2
FT                   protein_id=mCP7034.2 isoform=CRA_b"
FT                   /protein_id="EDL22259.1"
FT                   /translation="MILQQPLERGPPSRDPRATTGVTRGLNASLPPLSTSLPLFFSGLS
FT                   PREPLHKQFLSEENMATHFSRLSLHNDHPYCSPPVTFPEALPPLRSPCPELLLWRYPGS
FT                   LIPEALRLLRLGDTPSPYYPASPAGDIVEL"
FT   CDS             join(514918..515003,515470..515610,515819..515954)
FT                   /codon_start=1
FT                   /gene="Hcfc1r1"
FT                   /locus_tag="mCG_8073"
FT                   /product="host cell factor C1 regulator 1 (XPO1-dependent),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8073.2 transcript_id=mCT169418.0
FT                   protein_id=mCP92166.0 isoform=CRA_a"
FT                   /protein_id="EDL22258.1"
FT                   /translation="MILQQPLERGPPSRDPRATTGVTRGLNASLSPREPLHKQFLSEEN
FT                   MATHFSRLSLHNDHPYCSPPVTFPEALPPLRSPCPELLLWRYPGSLIPEALRLLRLGDT
FT                   PSPYYPASPAGDIVEL"
FT   gene            complement(516380..518377)
FT                   /gene="Tnfrsf12a"
FT                   /locus_tag="mCG_8067"
FT                   /note="gene_id=mCG8067.0"
FT   mRNA            complement(join(516380..516981,517074..517208,
FT                   517452..517556,518260..518377))
FT                   /gene="Tnfrsf12a"
FT                   /locus_tag="mCG_8067"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 12a, transcript variant mCT6433"
FT                   /note="gene_id=mCG8067.0 transcript_id=mCT6433.0 created on
FT                   23-MAY-2002"
FT   mRNA            complement(join(516437..516981,517074..517117,
FT                   517452..517556,518260..518377))
FT                   /gene="Tnfrsf12a"
FT                   /locus_tag="mCG_8067"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 12a, transcript variant mCT169417"
FT                   /note="gene_id=mCG8067.0 transcript_id=mCT169417.0 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(516807..516981,517074..517099))
FT                   /codon_start=1
FT                   /gene="Tnfrsf12a"
FT                   /locus_tag="mCG_8067"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 12a, isoform CRA_a"
FT                   /note="gene_id=mCG8067.0 transcript_id=mCT169417.0
FT                   protein_id=mCP92161.0 isoform=CRA_a"
FT                   /protein_id="EDL22260.1"
FT                   /translation="MPPERKVYYPHRGDWWRGLPRCGTDPVRSTRAGAHSSSIHSFWSQ
FT                   PGLPDRSRARLFQPQGGGARW"
FT   CDS             complement(join(516926..516981,517074..517208,
FT                   517452..517556,518260..518353))
FT                   /codon_start=1
FT                   /gene="Tnfrsf12a"
FT                   /locus_tag="mCG_8067"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 12a, isoform CRA_b"
FT                   /note="gene_id=mCG8067.0 transcript_id=mCT6433.0
FT                   protein_id=mCP7018.1 isoform=CRA_b"
FT                   /protein_id="EDL22261.1"
FT                   /translation="MAPGWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSAD
FT                   LDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWPILGGALSLVLVLALVSSFLVWRRC
FT                   RRREKFTTPIEETGGEGCPGVALIQ"
FT   gene            520305..523386
FT                   /gene="Cldn6"
FT                   /locus_tag="mCG_8070"
FT                   /note="gene_id=mCG8070.1"
FT   mRNA            join(520305..520348,520704..520767,521994..523386)
FT                   /gene="Cldn6"
FT                   /locus_tag="mCG_8070"
FT                   /product="claudin 6"
FT                   /note="gene_id=mCG8070.1 transcript_id=mCT6425.1 created on
FT                   23-MAY-2002"
FT   CDS             522010..522669
FT                   /codon_start=1
FT                   /gene="Cldn6"
FT                   /locus_tag="mCG_8070"
FT                   /product="claudin 6"
FT                   /note="gene_id=mCG8070.1 transcript_id=mCT6425.1
FT                   protein_id=mCP7020.0"
FT                   /db_xref="GOA:Q0GH64"
FT                   /db_xref="InterPro:IPR003925"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR006187"
FT                   /db_xref="InterPro:IPR017974"
FT                   /db_xref="MGI:MGI:1859284"
FT                   /db_xref="UniProtKB/TrEMBL:Q0GH64"
FT                   /protein_id="EDL22262.1"
FT                   /translation="MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQM
FT                   VWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKC
FT                   TTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGAS
FT                   LYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV"
FT   gene            complement(<523942..>524595)
FT                   /gene="Cldn9"
FT                   /locus_tag="mCG_8056"
FT                   /note="gene_id=mCG8056.0"
FT   mRNA            complement(<523942..>524595)
FT                   /gene="Cldn9"
FT                   /locus_tag="mCG_8056"
FT                   /product="claudin 9"
FT                   /note="gene_id=mCG8056.0 transcript_id=mCT6435.0 created on
FT                   23-MAY-2002"
FT   CDS             complement(523942..524595)
FT                   /codon_start=1
FT                   /gene="Cldn9"
FT                   /locus_tag="mCG_8056"
FT                   /product="claudin 9"
FT                   /note="gene_id=mCG8056.0 transcript_id=mCT6435.0
FT                   protein_id=mCP7022.0"
FT                   /db_xref="GOA:Q9Z0S7"
FT                   /db_xref="InterPro:IPR003553"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR006187"
FT                   /db_xref="InterPro:IPR017974"
FT                   /db_xref="MGI:MGI:1913100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0S7"
FT                   /protein_id="EDL22263.1"
FT                   /translation="MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQV
FT                   VWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQC
FT                   TTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGAS
FT                   LYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV"
FT   assembly_gap    526960..551873
FT                   /estimated_length=24914
FT                   /gap_type="unknown"
FT   gene            554848..565250
FT                   /gene="Pkmyt1"
FT                   /locus_tag="mCG_8058"
FT                   /note="gene_id=mCG8058.1"
FT   mRNA            join(554848..555023,560804..561309,562328..562821,
FT                   563471..563577,563708..563880,564071..564228,
FT                   564832..564909,565003..565250)
FT                   /gene="Pkmyt1"
FT                   /locus_tag="mCG_8058"
FT                   /product="protein kinase, membrane associated
FT                   tyrosine/threonine 1, transcript variant mCT6437"
FT                   /note="gene_id=mCG8058.1 transcript_id=mCT6437.1 created on
FT                   23-MAY-2002"
FT   mRNA            join(<555021..555048,560822..561309,562328..562821,
FT                   563471..563577,563708..563880,564071..564228,
FT                   564832..564909,565003..565237)
FT                   /gene="Pkmyt1"
FT                   /locus_tag="mCG_8058"
FT                   /product="protein kinase, membrane associated
FT                   tyrosine/threonine 1, transcript variant mCT191705"
FT                   /note="gene_id=mCG8058.1 transcript_id=mCT191705.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<555021..555048,560822..561309,562328..562821,
FT                   563471..563577,563708..563880,564071..564228,
FT                   564832..564909,565003..565114)
FT                   /codon_start=1
FT                   /gene="Pkmyt1"
FT                   /locus_tag="mCG_8058"
FT                   /product="protein kinase, membrane associated
FT                   tyrosine/threonine 1, isoform CRA_a"
FT                   /note="gene_id=mCG8058.1 transcript_id=mCT191705.0
FT                   protein_id=mCP112684.0 isoform=CRA_a"
FT                   /protein_id="EDL22264.1"
FT                   /translation="HAAPRPASPGTCGPHDLHVDNTTCVWQRSGSLVGHRTKCCLSGHI
FT                   ALCSDPLALAMTMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPGGLSRSLPPRPPAK
FT                   GCIPVSRLFPPRTPGWHQPQPRRVSFLCETSEPLQSPGYDPSRPESFFQQNFQRLSRLG
FT                   HGSYGEVFKVRSKEDGRLYAVKRYMSPFRGPKDRTRKLAEVGGHEKVGQHPHCVRLERA
FT                   WEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDILLALDHLHSQGLVHLDVK
FT                   PANIFLGPRGRCKLGDFGLLVELGSTGAGEAQEGDPRYMAPELLQGSYGTAADVFSLGL
FT                   TILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLAMMLEPDPQLRATAEAL
FT                   LALPMLRQPRPWNVLWYMAAEALSRGWALWQALVTLLCWLWHGLVHPASWLQPPGPPAT
FT                   PPGSPPCSPLLDSTLSSSWDNDSIGPSLSPETVLSRITRRTSTPRGRYIPRDALDLTDV
FT                   DSEPPRGPCPTFEPRNLLSLFEDSLDPA"
FT   assembly_gap    555288..555387
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   CDS             join(560959..561309,562328..562821,563471..563577,
FT                   563708..563880,564071..564228,564832..564909,
FT                   565003..565114)
FT                   /codon_start=1
FT                   /gene="Pkmyt1"
FT                   /locus_tag="mCG_8058"
FT                   /product="protein kinase, membrane associated
FT                   tyrosine/threonine 1, isoform CRA_b"
FT                   /note="gene_id=mCG8058.1 transcript_id=mCT6437.1
FT                   protein_id=mCP7024.2 isoform=CRA_b"
FT                   /protein_id="EDL22265.1"
FT                   /translation="MTMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPGGLSRSLPPR
FT                   PPAKGCIPVSRLFPPRTPGWHQPQPRRVSFLCETSEPLQSPGYDPSRPESFFQQNFQRL
FT                   SRLGHGSYGEVFKVRSKEDGRLYAVKRYMSPFRGPKDRTRKLAEVGGHEKVGQHPHCVR
FT                   LERAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDILLALDHLHSQGLVH
FT                   LDVKPANIFLGPRGRCKLGDFGLLVELGSTGAGEAQEGDPRYMAPELLQGSYGTAADVF
FT                   SLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLAMMLEPDPQLRAT
FT                   AEALLALPMLRQPRPWNVLWYMAAEALSRGWALWQALVTLLCWLWHGLVHPASWLQPPG
FT                   PPATPPGSPPCSPLLDSTLSSSWDNDSIGPSLSPETVLSRITRRTSTPRGRYIPRDALD
FT                   LTDVDSEPPRGPCPTFEPRNLLSLFEDSLDPA"
FT   gene            complement(564989..568855)
FT                   /gene="Paqr4"
FT                   /locus_tag="mCG_8057"
FT                   /note="gene_id=mCG8057.1"
FT   mRNA            complement(join(564989..566507,566648..566869,
FT                   568464..568855))
FT                   /gene="Paqr4"
FT                   /locus_tag="mCG_8057"
FT                   /product="progestin and adipoQ receptor family member IV"
FT                   /note="gene_id=mCG8057.1 transcript_id=mCT6436.1 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(566074..566507,566648..566869,
FT                   568464..568629))
FT                   /codon_start=1
FT                   /gene="Paqr4"
FT                   /locus_tag="mCG_8057"
FT                   /product="progestin and adipoQ receptor family member IV"
FT                   /note="gene_id=mCG8057.1 transcript_id=mCT6436.1
FT                   protein_id=mCP7023.1"
FT                   /protein_id="EDL22266.1"
FT                   /translation="MAFLTGPRLLDWASSPPHLQFNKFVLTGYRPASSGSGCLRSLFYL
FT                   HNELGNIYTHGLALLGFLVLVPMTMPWSQLGKDGWLGGTHCVACLVPPAASVLYHLFMC
FT                   HQGGSPVYTRLLALDMCGVCLVNTLGALPIIHCTLACRPWLRPAALMGYTALSGVAGWR
FT                   ALTAPSTSARLRAFGWQAGARLLVFGARGVGLGSGAPGSLPCYLRMDALALLGGLVNVA
FT                   RLPERWGPGRFDYWGNSHQIMHLLSVGSILQLHAGVVPDLLWAAHHACPPD"
FT   assembly_gap    568036..568137
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            complement(569803..>574414)
FT                   /gene="Kremen2"
FT                   /locus_tag="mCG_8071"
FT                   /note="gene_id=mCG8071.3"
FT   mRNA            complement(join(569803..570581,570807..570885,
FT                   570949..571092,571172..571504,571830..571983,
FT                   572165..572289,572363..572454,573158..573332,
FT                   573550..>573640))
FT                   /gene="Kremen2"
FT                   /locus_tag="mCG_8071"
FT                   /product="kringle containing transmembrane protein 2,
FT                   transcript variant mCT6426"
FT                   /note="gene_id=mCG8071.3 transcript_id=mCT6426.2 created on
FT                   23-MAY-2002"
FT   mRNA            complement(join(569804..570581,570807..570885,
FT                   570967..571092,571172..571504,571830..571983,
FT                   572165..572289,572363..572454,573158..573332,
FT                   573550..573718,574354..>574414))
FT                   /gene="Kremen2"
FT                   /locus_tag="mCG_8071"
FT                   /product="kringle containing transmembrane protein 2,
FT                   transcript variant mCT191704"
FT                   /note="gene_id=mCG8071.3 transcript_id=mCT191704.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(570371..570581,570807..570885,
FT                   570967..571092,571172..571504,571830..571983,
FT                   572165..572289,572363..572454,573158..573332,
FT                   573550..>573649))
FT                   /codon_start=1
FT                   /gene="Kremen2"
FT                   /locus_tag="mCG_8071"
FT                   /product="kringle containing transmembrane protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8071.3 transcript_id=mCT191704.0
FT                   protein_id=mCP112685.0 isoform=CRA_a"
FT                   /protein_id="EDL22267.1"
FT                   /translation="LGKMGTPHLQGFLLLFPLLLRLHGASAGSLHSPGLSECFQVNGAD
FT                   YRGHQNYTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYV
FT                   AETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGY
FT                   QLAGVEAGYACFCGSESDLARGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQ
FT                   GNWSAPQGVIYSPDFPDEYGPDRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDVSS
FT                   GNLLRAFDGAHPPPPGPLRLRTAALLLTFRSDARGHAQGFALTYRGLQDTVEGRASPED
FT                   STESLAGDPDGANASCSPKPGAAQASIGARVFSTVTAFSVLLLLLLSLLRLLRRRSCLL
FT                   APGKGSLAMGPSRGPGRSWAVWYRRPRGVALPCPPGDSQAEGPAAGYRPLSASSQSSLR
FT                   SLVSAL"
FT   CDS             complement(join(570371..570581,570807..570885,
FT                   570949..571092,571172..571504,571830..571983,
FT                   572165..572289,572363..572454,573158..573332,
FT                   573550..573640))
FT                   /codon_start=1
FT                   /gene="Kremen2"
FT                   /locus_tag="mCG_8071"
FT                   /product="kringle containing transmembrane protein 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8071.3 transcript_id=mCT6426.2
FT                   protein_id=mCP7031.2 isoform=CRA_b"
FT                   /protein_id="EDL22268.1"
FT                   /translation="MGTPHLQGFLLLFPLLLRLHGASAGSLHSPGLSECFQVNGADYRG
FT                   HQNYTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAET
FT                   EEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLA
FT                   GVEAGYACFCGSESDLARGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNW
FT                   SAPQGVIYSPDFPDEYGPDRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDVSSGNL
FT                   LRAFDGAHPPPPGPLRLRTAALLLTFRSDARGHAQGFALTYRGLQDTVEGRASPEDSTE
FT                   SLAGDPDGANASCSPKPGAAQASIGGEADLQARVFSTVTAFSVLLLLLLSLLRLLRRRS
FT                   CLLAPGKGSLAMGPSRGPGRSWAVWYRRPRGVALPCPPGDSQAEGPAAGYRPLSASSQS
FT                   SLRSLVSAL"
FT   assembly_gap    574415..574873
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   gene            <577869..578830
FT                   /locus_tag="mCG_128522"
FT                   /note="gene_id=mCG128522.0"
FT   mRNA            join(<577869..578177,578250..578360,578448..578830)
FT                   /locus_tag="mCG_128522"
FT                   /product="mCG128522, transcript variant mCT129819"
FT                   /note="gene_id=mCG128522.0 transcript_id=mCT129819.0
FT                   created on 23-MAY-2002"
FT   mRNA            join(<577885..578360,578448..>578634)
FT                   /locus_tag="mCG_128522"
FT                   /product="mCG128522, transcript variant mCT169413"
FT                   /note="gene_id=mCG128522.0 transcript_id=mCT169413.0
FT                   created on 23-MAY-2002"
FT   CDS             join(<578123..578177,578250..578360,578448..578635)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128522"
FT                   /product="mCG128522, isoform CRA_b"
FT                   /note="gene_id=mCG128522.0 transcript_id=mCT129819.0
FT                   protein_id=mCP84575.0 isoform=CRA_b"
FT                   /protein_id="EDL22270.1"
FT                   /translation="LVRNHHDLVSESAGLEQKGKLRHQLGAANACGGPSCCWCPGPPGP
FT                   PGVGLPLSQRGLEVQMPAALAMRAGGVLKLERATACLHPQPWSGPAGDPLFRASWPSTA
FT                   FPTVPLKTLLVPG"
FT   CDS             join(<578123..578360,578448..>578634)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128522"
FT                   /product="mCG128522, isoform CRA_a"
FT                   /note="gene_id=mCG128522.0 transcript_id=mCT169413.0
FT                   protein_id=mCP92164.0 isoform=CRA_a"
FT                   /protein_id="EDL22269.1"
FT                   /translation="LVRNHHDLVSESAGLEQKGRNCILPILSSCFPRPLTLSSLSSGKL
FT                   RHQLGAANACGGPSCCWCPGPPGPPGVGLPLSQRGLEVQMPAALAMRAGGVLKLERATA
FT                   CLHPQPWSGPAGDPLFRASWPSTAFPTVPLKTLLVPG"
FT   gene            complement(581444..614506)
FT                   /locus_tag="mCG_8069"
FT                   /note="gene_id=mCG8069.2"
FT   mRNA            complement(join(581444..582516,584309..584599,
FT                   585202..585465,588837..589100,589240..589319,
FT                   589374..589749,590823..591251,608233..608661,
FT                   614426..614506))
FT                   /locus_tag="mCG_8069"
FT                   /product="mCG8069"
FT                   /note="gene_id=mCG8069.2 transcript_id=mCT6423.2 created on
FT                   23-MAY-2002"
FT   CDS             complement(join(582494..582516,584309..584599,
FT                   585202..585465,588837..589100,589240..589319,
FT                   589374..589749,590823..591251,608233..608554))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8069"
FT                   /product="mCG8069"
FT                   /note="gene_id=mCG8069.2 transcript_id=mCT6423.2
FT                   protein_id=mCP7019.2"
FT                   /protein_id="EDL22271.1"
FT                   /translation="MPQPKASEQEGESMKASQEPAPQPGTDVVPAAPRKPRKFSKLVLL
FT                   TASKDSAKVAGAKRKGVHCIMSLGVPGPATLAKALLKTHPEAQRAIEATPLEPEQKRSK
FT                   QNLVPPQPLEFLKTPFGGRLLVHKSFLYKQEKAVGDKVYWKCRQHSELSCRGRAITRGF
FT                   RVTEMRDHCHPPEKEGLDRKKRHRGRPPSSALPEGAEVQEDEVSLWLYPVEPEPTPQPS
FT                   TETPEEEQGYRSLALQSLPPKKRPTPGVVRYRPLEFLKTCYGGTFLVHQSFLYKREKTV
FT                   GGKVYWTCREHAVHGCRSRAITQGQRVTVMRSHCHSPDIEGLQARRQQEKTIKKIQARR
FT                   IGAGDLEDCDDIEDSLLQGVDSLFYRRGQGTLTLSRSRSRKRAKKQQESSQEPPEEDQD
FT                   VDPRGPEFLKTPLGGNFLVYESFLYRREKVAGEKVYWTCRDQARMGCRSRAITQGRQVT
FT                   VMRSHCHPPDLLGLETLRQREKRPGPSQWDGPEGPEFLKTPLGGSFLVYESFLYRREKA
FT                   TGDKVYWTCRDQARMGCRSRAITQGQRVMVMRRHCHPPDMGGLEALRQRENFPNLTHWE
FT                   GPEPLQPLEFLRTSLGGRFLVYESFLYRKEKAAGEKVYWMCRDQARLGCRSRAITQGRR
FT                   VMVMRSHCHPPDLAGLEALRQREKAPSAAKKKKKKKKKKKGKSKSKN"
FT   gene            619025..622540
FT                   /locus_tag="mCG_147766"
FT                   /note="gene_id=mCG147766.0"
FT   mRNA            join(619025..619267,620689..622540)
FT                   /locus_tag="mCG_147766"
FT                   /product="mCG147766"
FT                   /note="gene_id=mCG147766.0 transcript_id=mCT188029.0
FT                   created on 13-JAN-2004"
FT   CDS             620999..621286
FT                   /codon_start=1
FT                   /locus_tag="mCG_147766"
FT                   /product="mCG147766"
FT                   /note="gene_id=mCG147766.0 transcript_id=mCT188029.0
FT                   protein_id=mCP108944.0"
FT                   /protein_id="EDL22272.1"
FT                   /translation="MYKHVEVRGQFVGVSSFLPMRVPETELRPPGFLADVQPTGPSSLP
FT                   SLSFETGIGSELIRLDWLVIRPQRPTVLTFQLLKLPAGAVTSGFFLFTWF"
FT   assembly_gap    624502..624776
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    628076..628095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <631839..653851
FT                   /gene="Srrm2"
FT                   /locus_tag="mCG_145352"
FT                   /note="gene_id=mCG145352.0"
FT   mRNA            join(<631839..632011,636655..636762,636941..637105,
FT                   638783..638860,639227..639289,639553..639585,
FT                   639845..639897,641566..641759,644259..648367,
FT                   648563..650812,651535..651822,652913..653026,
FT                   653138..653242,653338..653851)
FT                   /gene="Srrm2"
FT                   /locus_tag="mCG_145352"
FT                   /product="serine/arginine repetitive matrix 2"
FT                   /note="gene_id=mCG145352.0 transcript_id=mCT184776.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<631983..632011,636655..636762,636941..637105,
FT                   638783..638860,639227..639289,639553..639585,
FT                   639845..639897,641566..641759,644259..648367,
FT                   648563..650812,651535..651822,652913..653026,
FT                   653138..653242,653338..653347)
FT                   /codon_start=1
FT                   /gene="Srrm2"
FT                   /locus_tag="mCG_145352"
FT                   /product="serine/arginine repetitive matrix 2"
FT                   /note="gene_id=mCG145352.0 transcript_id=mCT184776.0
FT                   protein_id=mCP105318.0"
FT                   /protein_id="EDL22273.1"
FT                   /translation="QSAAGGGGGGYEEQQIQEKVATFRLMLLEKDVNPGAKEETPGQRP
FT                   VVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQIAPEPPKPYSLVR
FT                   ETSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKKKHRSESESKKRKHRSPTP
FT                   KSKRKSKDKKRKRWSRSAAAKIHTTALTGQSPPLASGHQGEGDAPSVEPGATNIQQPSS
FT                   PAPSTKQSSSPYEDKDKKEKSAVRPSPSPERSSTGPELPAPTPLLVEQHDDSPRPLAAI
FT                   PSSQEPVNPSSEASPTRGCSPPKSPEKPPQSTSSESCPPSPQPTKVSRHASSSPESLKP
FT                   TPAPGSRREISSSPTSKNRSHGRAKRDKSHSHTPSHRAGRSRSPATKRGRSRSRTPTKR
FT                   GHSRSRSPQWRRSRSAQRWGKSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRS
FT                   HSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPARRRSRSRTPARRGRSRSRTPA
FT                   RRRSRTRSPVRRRSRSRSQARRSGRSRSRTPARRSGRSRSRTPARRGRSRSRTPARRSA
FT                   RSRSRTPARRGRSRSRTPARRRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQ
FT                   RRSRSNSSPEMKKSHVSSRRSRSLSSPRSKAKSLRRSLSGSSPCPKQKSQTPTRRSRSG
FT                   SSPPKQKSKTPPRQSRSNSPQPKVKSGTPPRPGSVTNMQADECTATPQRQSHSESSPDG
FT                   EVKSRTPSRQSCSGSSPRVKSSTPPRQSPSRSSSPQPKVKTVISPRGRSHSSSSSPSPS
FT                   RVTSRTPQRKSRSVSPCPKVDSRLRHSRSRSSSPDSKMELGTPLRHSGSTSPYPKSMLQ
FT                   TPPDQNLSGSKSPCPQKSRDSPTGSSGSFHLCPGVTPSSIVPGESCFSASFVQQKGHTQ
FT                   TWPDTSSPEVMQTQVESPLLQSKSQTSPKGSLSRSSSPVTELTARSPVKQDKSEISTDP
FT                   KLKSGMSPEQSKTKPDSSIYPLVDSKSFLVQSRLEPSELKERLGLIQEDVASSCIPRDK
FT                   FSPTQDRPESSTVLKVTPRVLLKERSGAGSPPGKRDQKSLLPNSSQDELMEVEKSEQPL
FT                   SQVLPSLSPEHKEMPGSNIESSPEVEERPAVLSALDQSQSQPSKAAETPAVASCWSGPQ
FT                   VSPEHKELSHSPPRENSFESSLEFKNSGPVSEVNTGFSPEVKEELNGSFLNQTEADPSV
FT                   DMKEQSRSSRRSSSELSPEVVEKVGLFSSQKVSSPVLETVQQRTPSRERSSSASPELKD
FT                   GLPRTPSRRSRSGSSPGLRDGSGTPSRHSLSGSSPGMKDTPQTPSRGRSECDSSPEPKA
FT                   LPQTPRARSHSPSSPERNNKSVTPQRERSGSESSVEQKNLARTSPGQRSRSGSSQELDG
FT                   KPSASPQERSESDSSPDSKPKTRTPLRQRSHSGSSPEVDSKSRHSPRLSRSGSSPEMKD
FT                   KPRVLQRAQSGTDSSPEHKIPAPRALPRHSRSGSSSKERGPSPEGSSSSESSPEHAPKS
FT                   RTARRGSRSSIEPKTKSRTPPRRRSSRSSPELTRKARVSRRSRSASSSPEIRSRTPPRR
FT                   RRSPSVSSPEPTEKSRSSREEALSFFSPYQDNRQESSRTSSRRRRGRSRTPLTSRKRSR
FT                   SRTSPAPWKRSRSRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSVNRRRSRSRA
FT                   SPVSRRRSRSRTPPVTRRRSRSRTPTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTS
FT                   PVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRRRSRSRT
FT                   PLLPRKRSRSRSPLAIRRRSRSRTPRAARGKRSLTRSPPAIRRRSASGSSSDRSRSATP
FT                   PATRNHSGSRTPPVALSSSRMSCFSRPSMSPTPLDRCRSPGMLEPLGSARTPMSVLQQT
FT                   GGSMMDGPGPRIPDHPRSSVPENHAQSRIALALTAISLGTARPPPSMSAAGLAARMSQV
FT                   PAPVPLMSLRTAPAANLASRIPAASAAAMNLASARTSAIPASVNLADSRTPAAAAAMNL
FT                   ASPRTAVAPSAVNLADPRTPAASAVNLAGARTPAALAALSLTGSGTPPTAANYPSSSRT
FT                   PQAPTPANLVVGPRSAHGTAPVNIAGSRTPAGLAPTNLSSSRMAPALSGANLTSPRVPL
FT                   SAYDRVSGRTSPLMLDRARSRTPPSAPSQSRMTSERERAPSPASRMVQASSQSLLPPAQ
FT                   DRPRSPVPSAFSDQSRSVAQTTPVAGSQSLSSGTVAKSTSSASDHNGMLSGPAPGISHA
FT                   EGGEPPASTGAQQPSTLAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDS
FT                   EGSSLPAQPEVALKRVPSPTPVPKEAIREGRPQEPTPAKRKRRSSSSSSSSSSSSSSSS
FT                   SSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKP
FT                   IDSLRDSRSLSYSPVERRQPSPQPSPRDLQSSERVSWRGQRGDSHSPGHKRKETPSPRS
FT                   NRHRSSRSP"
FT   assembly_gap    632022..632110
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    633634..633923
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    634160..634208
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    640211..641031
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    648368..648562
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            complement(653855..>658268)
FT                   /locus_tag="mCG_128496"
FT                   /note="gene_id=mCG128496.0"
FT   mRNA            complement(join(653855..654094,656579..656684,
FT                   657990..658083,658239..>658268))
FT                   /locus_tag="mCG_128496"
FT                   /product="mCG128496"
FT                   /note="gene_id=mCG128496.0 transcript_id=mCT129793.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(join(653982..654094,656579..656684,
FT                   657990..>658082))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128496"
FT                   /product="mCG128496"
FT                   /note="gene_id=mCG128496.0 transcript_id=mCT129793.0
FT                   protein_id=mCP84763.1"
FT                   /protein_id="EDL22274.1"
FT                   /translation="TDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC
FT                   GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ"
FT   assembly_gap    658084..658230
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   gene            complement(<662998..673344)
FT                   /gene="4931440B09Rik"
FT                   /locus_tag="mCG_140400"
FT                   /note="gene_id=mCG140400.0"
FT   mRNA            complement(join(<662998..663156,663388..663557,
FT                   663794..664065,664195..664357,664473..>664488))
FT                   /gene="4931440B09Rik"
FT                   /locus_tag="mCG_140400"
FT                   /product="RIKEN cDNA 4931440B09, transcript variant
FT                   mCT169412"
FT                   /note="gene_id=mCG140400.0 transcript_id=mCT169412.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(join(662998..663156,663388..663557,
FT                   663794..664065,664195..664357,664473..664488))
FT                   /codon_start=1
FT                   /gene="4931440B09Rik"
FT                   /locus_tag="mCG_140400"
FT                   /product="RIKEN cDNA 4931440B09, isoform CRA_b"
FT                   /note="gene_id=mCG140400.0 transcript_id=mCT169412.0
FT                   protein_id=mCP92160.0 isoform=CRA_b"
FT                   /protein_id="EDL22276.1"
FT                   /translation="MQECAACGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSL
FT                   IAPQWVLTAGHCFPRRVWPSEYSVLLGALSLDVRSSHELLVPVLRVLLPPDYSEDEARG
FT                   DLALLQLRHPVSLSTRIQPVCLPAPGSHPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVR
FT                   VPLLDSRACDRLYHVGANVPQGERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESGHW
FT                   VLVGVVSWGKGCALPNRPGVYTNVAKYSPWIQARLSL"
FT   assembly_gap    663241..663349
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   mRNA            complement(join(665983..666345,666688..666845,
FT                   671410..671690,672611..672779,673010..673042,
FT                   673128..673154,673248..673344))
FT                   /gene="4931440B09Rik"
FT                   /locus_tag="mCG_140400"
FT                   /product="RIKEN cDNA 4931440B09, transcript variant
FT                   mCT169411"
FT                   /note="gene_id=mCG140400.0 transcript_id=mCT169411.0
FT                   created on 23-MAY-2002"
FT   mRNA            complement(join(665983..666345,666688..666845,
FT                   671410..671690,672611..672779,673010..673042,
FT                   673128..673154,673271..673328))
FT                   /gene="4931440B09Rik"
FT                   /locus_tag="mCG_140400"
FT                   /product="RIKEN cDNA 4931440B09, transcript variant
FT                   mCT169410"
FT                   /note="gene_id=mCG140400.0 transcript_id=mCT169410.0
FT                   created on 23-MAY-2002"
FT   CDS             complement(join(666106..666345,666688..666845,
FT                   671410..671690,672611..672779,673010..673042,
FT                   673128..673154,673248..673308))
FT                   /codon_start=1
FT                   /gene="4931440B09Rik"
FT                   /locus_tag="mCG_140400"
FT                   /product="RIKEN cDNA 4931440B09, isoform CRA_c"
FT                   /note="gene_id=mCG140400.0 transcript_id=mCT169411.0
FT                   protein_id=mCP92167.0 isoform=CRA_c"
FT                   /protein_id="EDL22277.1"
FT                   /translation="MGIQGPVLLLLLLCVMLGKPGSREESQAADLKTTDIKLLSMPCGR
FT                   RNDTRSRIVGGVESMQGRWPWQASLRLKKSHRCGGSLLSRRWVLTAAHCFRKYLDPEKW
FT                   TVQLGQLTSKPSYWNRKAYSGRYRVKDIIVNSEDKLKSHDLALLRLASSVTYNKDIQPV
FT                   CVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLH
FT                   HLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGIGCGRPNLPGIYTN
FT                   VSHYYNWIETMMILNGAVRRDLALPLLSITLLQAPWLLRPT"
FT   CDS             complement(join(666106..666345,666688..666845,
FT                   671410..671690,672611..672779,673010))
FT                   /codon_start=1
FT                   /gene="4931440B09Rik"
FT                   /locus_tag="mCG_140400"
FT                   /product="RIKEN cDNA 4931440B09, isoform CRA_a"
FT                   /note="gene_id=mCG140400.0 transcript_id=mCT169410.0
FT                   protein_id=mCP92162.0 isoform=CRA_a"
FT                   /protein_id="EDL22275.1"
FT                   /translation="MPCGRRNDTRSRIVGGVESMQGRWPWQASLRLKKSHRCGGSLLSR
FT                   RWVLTAAHCFRKYLDPEKWTVQLGQLTSKPSYWNRKAYSGRYRVKDIIVNSEDKLKSHD
FT                   LALLRLASSVTYNKDIQPVCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQ
FT                   VSILNNSRCQELFEIFSLHHLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIG
FT                   IVSWGIGCGRPNLPGIYTNVSHYYNWIETMMILNGAVRRDLALPLLSITLLQAPWLLRP
FT                   T"
FT   gene            682487..688657
FT                   /gene="Prss32"
FT                   /locus_tag="mCG_8060"
FT                   /note="gene_id=mCG8060.2"
FT   mRNA            join(682487..682870,683323..683485,684893..685173,
FT                   686158..686321,687969..688657)
FT                   /gene="Prss32"
FT                   /locus_tag="mCG_8060"
FT                   /product="protease, serine, 32, transcript variant
FT                   mCT169415"
FT                   /note="gene_id=mCG8060.2 transcript_id=mCT169415.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(682487..682870,683323..683396,684893..685173,
FT                   686158..686321,687969..688657)
FT                   /gene="Prss32"
FT                   /locus_tag="mCG_8060"
FT                   /product="protease, serine, 32, transcript variant
FT                   mCT169416"
FT                   /note="gene_id=mCG8060.2 transcript_id=mCT169416.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(682487..682870,683323..683485,684893..685003,
FT                   688442..688654)
FT                   /gene="Prss32"
FT                   /locus_tag="mCG_8060"
FT                   /product="protease, serine, 32, transcript variant mCT6440"
FT                   /note="gene_id=mCG8060.2 transcript_id=mCT6440.2 created on
FT                   23-MAY-2002"
FT   CDS             join(682741..682870,683323..683485,684893..685003,
FT                   688442..688613)
FT                   /codon_start=1
FT                   /gene="Prss32"
FT                   /locus_tag="mCG_8060"
FT                   /product="protease, serine, 32, isoform CRA_c"
FT                   /note="gene_id=mCG8060.2 transcript_id=mCT6440.2
FT                   protein_id=mCP7033.2 isoform=CRA_c"
FT                   /protein_id="EDL22280.1"
FT                   /translation="MELALPAILFTFFPGVLLGSEVLPTDSDSPSTTTGRRSIDLDSVC
FT                   GRPRTSGRIVSGQDAQLGRWPWQVSVRENGAHVCGGSLIAEDWVLTAAHCFNQGQSLSI
FT                   YTVLLGTISSYPEDNEPKELRAVAQFIKHPSSDLLAPMDPELPLTPLGPVGFQGQRDFL
FT                   SLTPGWSTGHSHLSGYPLVVSVTRQVFL"
FT   CDS             join(682741..682870,683323..683485,684893..685173,
FT                   686158..686321,687969..688226)
FT                   /codon_start=1
FT                   /gene="Prss32"
FT                   /locus_tag="mCG_8060"
FT                   /product="protease, serine, 32, isoform CRA_a"
FT                   /note="gene_id=mCG8060.2 transcript_id=mCT169415.0
FT                   protein_id=mCP92159.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q80X17"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1917064"
FT                   /db_xref="UniProtKB/TrEMBL:Q80X17"
FT                   /protein_id="EDL22278.1"
FT                   /translation="MELALPAILFTFFPGVLLGSEVLPTDSDSPSTTTGRRSIDLDSVC
FT                   GRPRTSGRIVSGQDAQLGRWPWQVSVRENGAHVCGGSLIAEDWVLTAAHCFNQGQSLSI
FT                   YTVLLGTISSYPEDNEPKELRAVAQFIKHPSYSADEHSSGDIALVQLASPISFNDYMLP
FT                   VCLPKPGDPLDPGTMCWVTGWGHIGTNQPLPPPFTLQELQVPLIDAETCNTYYQENSIP
FT                   GTEPVILEGMLCAGFQEGKKDACNGDSGGPLVCDINDVWIQAGVVSWGSDCALFKRPGV
FT                   YTNVSVYISWIQNTMWNLPMEGRGFSPSLSGTPLLGLLTSLSSAFFLLGP"
FT   CDS             join(683368..683396,684893..685173,686158..686321,
FT                   687969..688226)
FT                   /codon_start=1
FT                   /gene="Prss32"
FT                   /locus_tag="mCG_8060"
FT                   /product="protease, serine, 32, isoform CRA_b"
FT                   /note="gene_id=mCG8060.2 transcript_id=mCT169416.0
FT                   protein_id=mCP92165.0 isoform=CRA_b"
FT                   /protein_id="EDL22279.1"
FT                   /translation="MPSWAGGLGRGQSLSIYTVLLGTISSYPEDNEPKELRAVAQFIKH
FT                   PSYSADEHSSGDIALVQLASPISFNDYMLPVCLPKPGDPLDPGTMCWVTGWGHIGTNQP
FT                   LPPPFTLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDACNGDSGG
FT                   PLVCDINDVWIQAGVVSWGSDCALFKRPGVYTNVSVYISWIQNTMWNLPMEGRGFSPSL
FT                   SGTPLLGLLTSLSSAFFLLGP"
FT   gene            696938..701948
FT                   /gene="Prss21"
FT                   /locus_tag="mCG_8062"
FT                   /note="gene_id=mCG8062.1"
FT   mRNA            join(696938..697063,697165..697191,697483..697648,
FT                   698208..698491,701207..701361,701631..701948)
FT                   /gene="Prss21"
FT                   /locus_tag="mCG_8062"
FT                   /product="protease, serine, 21"
FT                   /note="gene_id=mCG8062.1 transcript_id=mCT6429.1 created on
FT                   23-MAY-2002"
FT   CDS             join(696961..697063,697165..697191,697483..697648,
FT                   698208..698491,701207..701361,701631..701870)
FT                   /codon_start=1
FT                   /gene="Prss21"
FT                   /locus_tag="mCG_8062"
FT                   /product="protease, serine, 21"
FT                   /note="gene_id=mCG8062.1 transcript_id=mCT6429.1
FT                   protein_id=mCP7027.1"
FT                   /db_xref="GOA:Q54AE4"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="InterPro:IPR034380"
FT                   /db_xref="MGI:MGI:1916698"
FT                   /db_xref="UniProtKB/TrEMBL:Q54AE4"
FT                   /protein_id="EDL22281.1"
FT                   /translation="MGARGKTLVPLLVVVATAAMALQSTYLQVDPEKPELQEPDLLSGP
FT                   CGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDNDPF
FT                   DWTVQFGELTSRPSLWNLQAYSNRYQIEDIFLSPKYSEQYPNDIALLKLSSPVTYNNFI
FT                   QPICLLNSTYKFENRTDCWVTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPD
FT                   FRTNIWGDMVCAGTPEGGKDACFGDSGGPLACDQDTVWYQVGVVSWGIGCGRPNRPGVY
FT                   TNISHHYNWIQSTMIRNGLLRPDPVPLLLFLTLAWASSLLRPA"
FT   assembly_gap    707804..707823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    708916..711389
FT                   /estimated_length=2474
FT                   /gap_type="unknown"
FT   gene            715193..717158
FT                   /locus_tag="mCG_8068"
FT                   /note="gene_id=mCG8068.2"
FT   mRNA            join(715193..715219,715309..715389,715638..715740,
FT                   716758..717157)
FT                   /locus_tag="mCG_8068"
FT                   /product="mCG8068, transcript variant mCT6422"
FT                   /note="gene_id=mCG8068.2 transcript_id=mCT6422.1 created on
FT                   24-MAY-2002"
FT   mRNA            join(715218..715389,715638..715740,716758..717158)
FT                   /locus_tag="mCG_8068"
FT                   /product="mCG8068, transcript variant mCT169691"
FT                   /note="gene_id=mCG8068.2 transcript_id=mCT169691.0 created
FT                   on 24-MAY-2002"
FT   CDS             join(715242..715389,715638..715740,716758..717097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8068"
FT                   /product="mCG8068, isoform CRA_a"
FT                   /note="gene_id=mCG8068.2 transcript_id=mCT169691.0
FT                   protein_id=mCP92693.0 isoform=CRA_a"
FT                   /protein_id="EDL22282.1"
FT                   /translation="MDMAKGSWFPVQDLGGLCSFPSDFEMFQLEAMLPLLILAFLGTPM
FT                   VLTQDYHGPEVGKHSCTSAPEGKNITSIRVFLKGRLIVGIQFNYNDNKDGQVYGSTAGK
FT                   EMVARVSKEEHIIAVQGTYTPSAITQIIFTTNQPRQLMVGYYVGSSEYSSFPDDPSHVL
FT                   KGACVSWRAGGIKSILFLWGTENSSCVKYGHSG"
FT   CDS             join(715317..715389,715638..715740,716758..717097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8068"
FT                   /product="mCG8068, isoform CRA_b"
FT                   /note="gene_id=mCG8068.2 transcript_id=mCT6422.1
FT                   protein_id=mCP7030.2 isoform=CRA_b"
FT                   /protein_id="EDL22283.1"
FT                   /translation="MFQLEAMLPLLILAFLGTPMVLTQDYHGPEVGKHSCTSAPEGKNI
FT                   TSIRVFLKGRLIVGIQFNYNDNKDGQVYGSTAGKEMVARVSKEEHIIAVQGTYTPSAIT
FT                   QIIFTTNQPRQLMVGYYVGSSEYSSFPDDPSHVLKGACVSWRAGGIKSILFLWGTENSS
FT                   CVKYGHSG"
FT   assembly_gap    721858..722224
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   gene            730601..732595
FT                   /locus_tag="mCG_12801"
FT                   /note="gene_id=mCG12801.0"
FT   mRNA            join(730601..730634,730724..730804,731116..731218,
FT                   732201..732595)
FT                   /locus_tag="mCG_12801"
FT                   /product="mCG12801"
FT                   /note="gene_id=mCG12801.0 transcript_id=mCT13668.0 created
FT                   on 24-MAY-2002"
FT   CDS             join(730732..730804,731116..731218,732201..732537)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12801"
FT                   /product="mCG12801"
FT                   /note="gene_id=mCG12801.0 transcript_id=mCT13668.0
FT                   protein_id=mCP23227.1"
FT                   /db_xref="GOA:Q64097"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="MGI:MGI:105949"
FT                   /db_xref="UniProtKB/TrEMBL:Q64097"
FT                   /protein_id="EDL22284.1"
FT                   /translation="MFQLEAMLPLLILAFLGTPTVLTQDYHGPEVGKHSCTSAPEGKNI
FT                   TSIRVFLQGRSIVGIQFNYNNEDGQVYGSTAGKVMVARLNNEESIIAAEGTYSPSALTQ
FT                   IIFTTNQPRQLMVGYYVGSSEYSSFPDDPSHVLKGACVSWRAGGIKSILFLWGTENSSC
FT                   VKYGHSG"
FT   assembly_gap    733076..733468
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    736260..736373
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            complement(742830..746292)
FT                   /pseudo
FT                   /locus_tag="mCG_128514"
FT                   /note="gene_id=mCG128514.1"
FT   mRNA            complement(join(742830..742984,745598..746292))
FT                   /pseudo
FT                   /locus_tag="mCG_128514"
FT                   /note="gene_id=mCG128514.1 transcript_id=mCT129811.1
FT                   created on 24-MAY-2002"
FT   assembly_gap    746675..751297
FT                   /estimated_length=4623
FT                   /gap_type="unknown"
FT   assembly_gap    752301..752503
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    753623..753642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    755193..755212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    761759..765689
FT                   /estimated_length=3931
FT                   /gap_type="unknown"
FT   assembly_gap    772057..772121
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            786317..789715
FT                   /locus_tag="mCG_12805"
FT                   /note="gene_id=mCG12805.1"
FT   mRNA            join(786317..786440,786552..786657,789120..789715)
FT                   /locus_tag="mCG_12805"
FT                   /product="mCG12805"
FT                   /note="gene_id=mCG12805.1 transcript_id=mCT13673.1 created
FT                   on 24-MAY-2002"
FT   CDS             join(786386..786440,786552..786657,789120..789558)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12805"
FT                   /product="mCG12805"
FT                   /note="gene_id=mCG12805.1 transcript_id=mCT13673.1
FT                   protein_id=mCP23244.2"
FT                   /db_xref="InterPro:IPR001229"
FT                   /db_xref="MGI:MGI:106021"
FT                   /db_xref="UniProtKB/TrEMBL:Q544L5"
FT                   /protein_id="EDL22285.1"
FT                   /translation="MLLLLTLAFLASPTCRAQNVLGNAAGKYFYVQGEDQGQLKGMRIF
FT                   LSVFKFIKGFQLQFGSNWTDVYGTRSDNFIDFLLEDGEHVIKVEGSAVICLTSLTFTTN
FT                   KGRVATFGVRRGRYFSDTGGSDKHLVTVNGMHAPGLCVRGIGFKWGNINANGNDHYNNK
FT                   EDKADNKDADNKDADNKDDGDEDDDGNDDDDQKDES"
FT   assembly_gap    788728..788899
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    790000..790929
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    796976..797212
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   gene            complement(797575..802447)
FT                   /locus_tag="mCG_12826"
FT                   /note="gene_id=mCG12826.1"
FT   mRNA            complement(join(797575..798226,802122..802227,
FT                   802340..802447))
FT                   /locus_tag="mCG_12826"
FT                   /product="mCG12826"
FT                   /note="gene_id=mCG12826.1 transcript_id=mCT13694.1 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(797734..798226,802122..802227,
FT                   802340..802439))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12826"
FT                   /product="mCG12826"
FT                   /note="gene_id=mCG12826.1 transcript_id=mCT13694.1
FT                   protein_id=mCP23259.2"
FT                   /protein_id="EDL22286.1"
FT                   /translation="MKSWHLPLGPEPSGAMLLLLTLALLASPTCRAQNVLENGVGNYFY
FT                   VQGEDQGQLKGMRIFLSLLKFIKGFQLQFGNNWTDVYGTRSENFIDFLLEDGEHVIKVE
FT                   GSAVICLTSLTFTTNKGRVATFGVRRGRYFSDTGGSDKHLVTVNGMHAPGLCVTGIGFK
FT                   WEDNAKDLGSPEPVKEPKDSSDSSNKKEDEGRGKDDDDNDEDEDDNDEDENNYGNDDDD
FT                   DDNDDQKDES"
FT   assembly_gap    798644..798663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    799918..799937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    801281..801300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    815320..815339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    819047..819251
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   gene            complement(820687..823750)
FT                   /gene="Tmprss8"
FT                   /locus_tag="mCG_12828"
FT                   /note="gene_id=mCG12828.0"
FT   mRNA            complement(join(820687..821426,821597..821757,
FT                   822136..822407,822500..822665,822779..822805,
FT                   823686..823750))
FT                   /gene="Tmprss8"
FT                   /locus_tag="mCG_12828"
FT                   /product="transmembrane protease, serine 8 (intestinal)"
FT                   /note="gene_id=mCG12828.0 transcript_id=mCT13696.0 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(821172..821426,821597..821757,
FT                   822136..822407,822500..822665,822779..822805,
FT                   823686..823737))
FT                   /codon_start=1
FT                   /gene="Tmprss8"
FT                   /locus_tag="mCG_12828"
FT                   /product="transmembrane protease, serine 8 (intestinal)"
FT                   /note="gene_id=mCG12828.0 transcript_id=mCT13696.0
FT                   protein_id=mCP23169.1"
FT                   /protein_id="EDL22287.1"
FT                   /translation="MESRARCIFLLLLQILTRARGDILPSVCGHSRDAGKIVGGQDALE
FT                   GQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLSLLEPH
FT                   STLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFTPVCLPAAQTPLTPGTVCWV
FT                   TGWGATQERDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGYVEGQK
FT                   DSCQGDSGGPLVCSINSSWIQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENHS
FT                   DAYGYHSSASAAYQMLLPVLLAVALPGSL"
FT   assembly_gap    834493..834512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(841856..846432)
FT                   /gene="Prss22"
FT                   /locus_tag="mCG_147772"
FT                   /note="gene_id=mCG147772.0"
FT   mRNA            complement(join(841856..842359,842948..843105,
FT                   844598..844875,845022..845193,845651..845677,
FT                   846256..846432))
FT                   /gene="Prss22"
FT                   /locus_tag="mCG_147772"
FT                   /product="protease, serine, 22"
FT                   /note="gene_id=mCG147772.0 transcript_id=mCT188035.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(842153..842359,842948..843105,
FT                   844598..844875,845022..845193,845651..845677,
FT                   846256..846337))
FT                   /codon_start=1
FT                   /gene="Prss22"
FT                   /locus_tag="mCG_147772"
FT                   /product="protease, serine, 22"
FT                   /note="gene_id=mCG147772.0 transcript_id=mCT188035.0
FT                   protein_id=mCP108949.0"
FT                   /db_xref="GOA:Q7TML0"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1918085"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TML0"
FT                   /protein_id="EDL22288.1"
FT                   /translation="MMISRPPPALGGDQFSILILLVLLTSTAPISAATIRVSPDCGKPQ
FT                   QLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSV
FT                   LLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLP
FT                   DSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAIT
FT                   EGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRPGVYTSLLAH
FT                   RSWVQRIVQGVQLRGYLADSGDTGSS"
FT   gene            complement(852578..>852979)
FT                   /locus_tag="mCG_60998"
FT                   /note="gene_id=mCG60998.2"
FT   mRNA            complement(852578..>852979)
FT                   /locus_tag="mCG_60998"
FT                   /product="mCG60998"
FT                   /note="gene_id=mCG60998.2 transcript_id=mCT61181.2 created
FT                   on 14-AUG-2002"
FT   CDS             complement(852692..852979)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60998"
FT                   /product="mCG60998"
FT                   /note="gene_id=mCG60998.2 transcript_id=mCT61181.2
FT                   protein_id=mCP42857.2"
FT                   /protein_id="EDL22289.1"
FT                   /translation="MAALQPLVKPKISRKRSKKCTWHQSDGCVRMKPAWQEPRSISTWV
FT                   WGGLKGKVLMLRIGYGNKMTKLMLPIISFRSLVLSSSWKCSRCATDSLLS"
FT   assembly_gap    873646..873995
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    875250..875384
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    881392..881861
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    887556..888427
FT                   /estimated_length=872
FT                   /gap_type="unknown"
FT   gene            complement(889771..914267)
FT                   /gene="Kctd5"
FT                   /locus_tag="mCG_12850"
FT                   /note="gene_id=mCG12850.2"
FT   mRNA            complement(join(889771..890542,896837..896962,
FT                   898654..898749,900135..900226,901094..901202,
FT                   914000..914267))
FT                   /gene="Kctd5"
FT                   /locus_tag="mCG_12850"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 5"
FT                   /note="gene_id=mCG12850.2 transcript_id=mCT13718.2 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(890513..890542,896837..896962,
FT                   898654..898749,900135..900226,901094..901202,
FT                   914000..914251))
FT                   /codon_start=1
FT                   /gene="Kctd5"
FT                   /locus_tag="mCG_12850"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 5"
FT                   /note="gene_id=mCG12850.2 transcript_id=mCT13718.2
FT                   protein_id=mCP23269.2"
FT                   /protein_id="EDL22290.1"
FT                   /translation="MAENHCELLPPAPSGLGAGLGGGLCRRCSAGMGALAQRPGGVSKW
FT                   VRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLN
FT                   YLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSRISQMPVKHVYRVLQC
FT                   QEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTTSEPSE
FT                   KAKILQERGSRM"
FT   assembly_gap    901638..901657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(919695..981235)
FT                   /gene="Pdpk1"
FT                   /locus_tag="mCG_12832"
FT                   /note="gene_id=mCG12832.1"
FT   mRNA            complement(join(919695..919952,920302..920454,
FT                   921187..921244,928784..929001,932193..932366,
FT                   933945..934041,934292..934360,938381..938456,
FT                   940872..940969,941663..941807,946890..947027,
FT                   947292..947334,950926..951195,981113..981235))
FT                   /gene="Pdpk1"
FT                   /locus_tag="mCG_12832"
FT                   /product="3-phosphoinositide dependent protein kinase-1"
FT                   /note="gene_id=mCG12832.1 transcript_id=mCT13700.1 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(919836..919952,920302..920454,
FT                   921187..921244,928784..929001,932193..932366,
FT                   933945..934041,934292..934360,938381..938456,
FT                   940872..940969,941663..941807,946890..947027,
FT                   947292..947334,950926..951195,981113..981136))
FT                   /codon_start=1
FT                   /gene="Pdpk1"
FT                   /locus_tag="mCG_12832"
FT                   /product="3-phosphoinositide dependent protein kinase-1"
FT                   /note="gene_id=mCG12832.1 transcript_id=mCT13700.1
FT                   protein_id=mCP23194.1"
FT                   /protein_id="EDL22291.1"
FT                   /translation="MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGV
FT                   SRQGSTMDGTTAEARPSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARE
FT                   LATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLS
FT                   YAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHI
FT                   QITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAG
FT                   LPPFRAGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLK
FT                   AHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHS
FT                   LSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENN
FT                   LILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTF
FT                   FVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQSNPDAAVQ"
FT   assembly_gap    928530..928549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    936673..937199
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    964661..964705
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    981328..981398
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            complement(995842..1003846)
FT                   /gene="Amdhd2"
FT                   /locus_tag="mCG_140472"
FT                   /note="gene_id=mCG140472.0"
FT   mRNA            complement(join(995842..996095,996581..996682,
FT                   997538..997606,997750..997857,997928..998072,
FT                   998154..998242,998320..998532,998650..998704,
FT                   1003039..1003178,1003259..1003395,1003645..1003846))
FT                   /gene="Amdhd2"
FT                   /locus_tag="mCG_140472"
FT                   /product="amidohydrolase domain containing 2"
FT                   /note="gene_id=mCG140472.0 transcript_id=mCT169686.0
FT                   created on 30-AUG-2002"
FT   CDS             complement(join(996007..996095,996581..996682,
FT                   997538..997606,997750..997857,997928..998072,
FT                   998154..998242,998320..998532,998650..998704,
FT                   1003039..1003178,1003259..1003395,1003645..1003727))
FT                   /codon_start=1
FT                   /gene="Amdhd2"
FT                   /locus_tag="mCG_140472"
FT                   /product="amidohydrolase domain containing 2"
FT                   /note="gene_id=mCG140472.0 transcript_id=mCT169686.0
FT                   protein_id=mCP92672.0"
FT                   /protein_id="EDL22292.1"
FT                   /translation="MRSGQCAAGAPVLQFTNCRILRGGTLLREDLWVRGGRILDPEKLF
FT                   FEERRVADEQRDCGGRILAPGFIDVQINGGFGVDFSKATEDVGSGVALVARRLLSHGVT
FT                   SFCPTLVTSPPEVYHKVLPQIPVKSGGPHGAGVLGVHLEGPFISREKRGAHPEAYLRSF
FT                   EANAFHDVLATYGPLDNVCIVTLAPELDRSHEVIQALTAQGIRVSLGHSVADLRAAEVA
FT                   VQSGATFITHLFNAMLPFHHRDPGIVGLLTSDQLPPGHCIFYGMIADGIHTNPAALRIA
FT                   HRAHPQGLVLVTDAVPALGLGNGRHTLGQQEVEVDGLIAYIAGTKTLGGSIAPMDVCVR
FT                   HFLQATGCSVESALEAASLHPAQMLGLEKTKGSLDFGADADFVVLDDTLHVQATYISGE
FT                   LVWQAEEAGP"
FT   assembly_gap    1000013..1000032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1003929..1009392)
FT                   /locus_tag="mCG_12839"
FT                   /note="gene_id=mCG12839.0"
FT   mRNA            complement(join(1003929..1004671,1004762..1004945,
FT                   1009167..1009392))
FT                   /locus_tag="mCG_12839"
FT                   /product="mCG12839"
FT                   /note="gene_id=mCG12839.0 transcript_id=mCT13707.1 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(1004467..1004671,1004762..1004945,
FT                   1009167..1009245))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12839"
FT                   /product="mCG12839"
FT                   /note="gene_id=mCG12839.0 transcript_id=mCT13707.1
FT                   protein_id=mCP23237.1"
FT                   /db_xref="GOA:A3KML5"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="MGI:MGI:88116"
FT                   /db_xref="UniProtKB/TrEMBL:A3KML5"
FT                   /protein_id="EDL22293.1"
FT                   /translation="MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMS
FT                   VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGL
FT                   AAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK"
FT   gene            complement(1015388..1016249)
FT                   /locus_tag="mCG_1033956"
FT                   /note="gene_id=mCG1033956.0"
FT   mRNA            complement(join(1015388..1015452,1015663..1016249))
FT                   /locus_tag="mCG_1033956"
FT                   /product="mCG1033956"
FT                   /note="gene_id=mCG1033956.0 transcript_id=mCT151660.0
FT                   created on 28-MAY-2002"
FT   CDS             complement(join(1015411..1015452,1015663..1015764))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033956"
FT                   /product="mCG1033956"
FT                   /note="gene_id=mCG1033956.0 transcript_id=mCT151660.0
FT                   protein_id=mCP84797.1"
FT                   /protein_id="EDL22294.1"
FT                   /translation="MWSPADHRSVWMSSQHTRAYKAKVWTCSNIQLCDKISDLVSVSMF
FT                   PK"
FT   gene            complement(1018755..>1045700)
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /note="gene_id=mCG145992.1"
FT   mRNA            complement(join(1018755..1020877,1021426..1021596,
FT                   1021957..1022185,1022651..1022746,1022987..1023050,
FT                   1023895..1024053,1025403..1026486,1030101..1030210,
FT                   1045637..>1045685))
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /product="TBC1 domain family, member 24, transcript variant
FT                   mCT186100"
FT                   /note="gene_id=mCG145992.1 transcript_id=mCT186100.0
FT                   created on 04-JUL-2003"
FT   mRNA            complement(join(1018963..1021596,1021957..1022185,
FT                   1022651..1022746,1022987..1023050,1023895..1024053,
FT                   1025403..1026400,1030101..1030210,1045637..>1045700))
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /product="TBC1 domain family, member 24, transcript variant
FT                   mCT191728"
FT                   /note="gene_id=mCG145992.1 transcript_id=mCT191728.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(1018986..1021596,1021957..1022185,
FT                   1022651..1022746,1022987..1023050,1023895..1024053,
FT                   1025403..1026486,1030101..1030210,1045637..>1045679))
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /product="TBC1 domain family, member 24, transcript variant
FT                   mCT191726"
FT                   /note="gene_id=mCG145992.1 transcript_id=mCT191726.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(1019201..1021596,1021957..1022185,
FT                   1022651..1022746,1022987..1023050,1023895..1024049,
FT                   1025403..1026400,1030101..1030210,1045637..>1045688))
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /product="TBC1 domain family, member 24, transcript variant
FT                   mCT191727"
FT                   /note="gene_id=mCG145992.1 transcript_id=mCT191727.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1021442..1021596,1021957..1022185,
FT                   1022651..1022746,1022987..1023050,1023895..1024053,
FT                   1025403..1026400,1030101..1030210,1045637..>1045700))
FT                   /codon_start=1
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /product="TBC1 domain family, member 24, isoform CRA_c"
FT                   /note="gene_id=mCG145992.1 transcript_id=mCT191728.0
FT                   protein_id=mCP112677.0 isoform=CRA_c"
FT                   /protein_id="EDL22298.1"
FT                   /translation="AQKVQCGPAESRRERCGAARRVEFSRCKRNQSGVNIYRKSLKWTP
FT                   VTLLDSSTIQIRKPRTCLVGTLGTMDPPGYNCFVDKDKMDASIQDLGPKELNCTELQEL
FT                   KQLARQGYWAQSHTLRGKVYQRLIRDIPCRTVTPDASVYSDIVGKIVGKHSSSSLPLPE
FT                   FVDNTQVPTYCLNTRGEGAVRKILLCIANQFPDISFCPALPAVVALLLHYSIDEAECFE
FT                   KACRILSCNDPTKKLIDQSFLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQVYSDW
FT                   QRWLFGELPLNYFARVFDVFLVEGYKVLYRVALAILKFFHKVRAGQPLESDNVKQDIRM
FT                   FVKDIAKTVSPEKLLEKAFAIRLFSRKEIQLLQMANEKALRQKGITVKQKRQFVHLAVH
FT                   AENFHSEIVSVKEMRDIWSWIPERFALCQPLLLFSSLQHGYSLSRFYFQCEGHEPTLLL
FT                   IKTTQKEVCGAYLSTDWSERTKFGGKLGFFGTGECFVFRLQPEVQRYEWVVIKHPELTK
FT                   ATSLKSSEAAGSSSLIGHCSSDPADRLSPFLAARHFNLPSKTESMFMAGGNDCLIIGGG
FT                   GGQALYVDGDLNRGRTGHCDTFNNQPLCSENFLIAAVEAWGFQDPDTE"
FT   CDS             complement(join(1021442..1021596,1021957..1022185,
FT                   1022651..1022746,1022987..1023050,1023895..1024053,
FT                   1025403..>1026460))
FT                   /codon_start=1
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /product="TBC1 domain family, member 24, isoform CRA_a"
FT                   /note="gene_id=mCG145992.1 transcript_id=mCT186100.0
FT                   protein_id=mCP107360.0 isoform=CRA_a"
FT                   /protein_id="EDL22295.1"
FT                   /translation="QKTPEAGAAGFSCFLFPSWQPRTCLVGTLGTMDPPGYNCFVDKDK
FT                   MDASIQDLGPKELNCTELQELKQLARQGYWAQSHTLRGKVYQRLIRDIPCRTVTPDASV
FT                   YSDIVGKIVGKHSSSSLPLPEFVDNTQVPTYCLNTRGEGAVRKILLCIANQFPDISFCP
FT                   ALPAVVALLLHYSIDEAECFEKACRILSCNDPTKKLIDQSFLAFESSCMTFGDLVNKYC
FT                   QAAHKLMVAVSEDVLQVYSDWQRWLFGELPLNYFARVFDVFLVEGYKVLYRVALAILKF
FT                   FHKVRAGQPLESDNVKQDIRMFVKDIAKTVSPEKLLEKAFAIRLFSRKEIQLLQMANEK
FT                   ALRQKGITVKQKRQFVHLAVHAENFHSEIVSVKEMRDIWSWIPERFALCQPLLLFSSLQ
FT                   HGYSLSRFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERTKFGGKLGFFGTGECFVF
FT                   RLQPEVQRYEWVVIKHPELTKATSLKSSEAAGSSSLIGHCSSDPADRLSPFLAARHFNL
FT                   PSKTESMFMAGGNDCLIIGGGGGQALYVDGDLNRGRTGHCDTFNNQPLCSENFLIAAVE
FT                   AWGFQDPDTE"
FT   CDS             complement(join(1021442..1021596,1021957..1022185,
FT                   1022651..1022746,1022987..1023050,1023895..1024053,
FT                   1025403..>1026460))
FT                   /codon_start=1
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /product="TBC1 domain family, member 24, isoform CRA_a"
FT                   /note="gene_id=mCG145992.1 transcript_id=mCT191726.0
FT                   protein_id=mCP112675.0 isoform=CRA_a"
FT                   /protein_id="EDL22296.1"
FT                   /translation="QKTPEAGAAGFSCFLFPSWQPRTCLVGTLGTMDPPGYNCFVDKDK
FT                   MDASIQDLGPKELNCTELQELKQLARQGYWAQSHTLRGKVYQRLIRDIPCRTVTPDASV
FT                   YSDIVGKIVGKHSSSSLPLPEFVDNTQVPTYCLNTRGEGAVRKILLCIANQFPDISFCP
FT                   ALPAVVALLLHYSIDEAECFEKACRILSCNDPTKKLIDQSFLAFESSCMTFGDLVNKYC
FT                   QAAHKLMVAVSEDVLQVYSDWQRWLFGELPLNYFARVFDVFLVEGYKVLYRVALAILKF
FT                   FHKVRAGQPLESDNVKQDIRMFVKDIAKTVSPEKLLEKAFAIRLFSRKEIQLLQMANEK
FT                   ALRQKGITVKQKRQFVHLAVHAENFHSEIVSVKEMRDIWSWIPERFALCQPLLLFSSLQ
FT                   HGYSLSRFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERTKFGGKLGFFGTGECFVF
FT                   RLQPEVQRYEWVVIKHPELTKATSLKSSEAAGSSSLIGHCSSDPADRLSPFLAARHFNL
FT                   PSKTESMFMAGGNDCLIIGGGGGQALYVDGDLNRGRTGHCDTFNNQPLCSENFLIAAVE
FT                   AWGFQDPDTE"
FT   CDS             complement(join(1024037..1024049,1025403..1026400,
FT                   1030101..1030210,1045637..>1045688))
FT                   /codon_start=1
FT                   /gene="Tbc1d24"
FT                   /locus_tag="mCG_145992"
FT                   /product="TBC1 domain family, member 24, isoform CRA_b"
FT                   /note="gene_id=mCG145992.1 transcript_id=mCT191727.0
FT                   protein_id=mCP112676.0 isoform=CRA_b"
FT                   /protein_id="EDL22297.1"
FT                   /translation="QCGPAESRRERCGAARRVEFSRCKRNQSGVNIYRKSLKWTPVTLL
FT                   DSSTIQIRKPRTCLVGTLGTMDPPGYNCFVDKDKMDASIQDLGPKELNCTELQELKQLA
FT                   RQGYWAQSHTLRGKVYQRLIRDIPCRTVTPDASVYSDIVGKIVGKHSSSSLPLPEFVDN
FT                   TQVPTYCLNTRGEGAVRKILLCIANQFPDISFCPALPAVVALLLHYSIDEAECFEKACR
FT                   ILSCNDPTKKLIDQSFLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQVYSDWQRWL
FT                   FGELPLNYFARVFDVFLVEGYKVLYRVALAILKFFHKVRAGQPLESDNVKQDIRMFVKD
FT                   IAKTVSPEKLLEKAFAIRLFSRKEIQLLQMANEKALRQKGITVKQKSLCT"
FT   assembly_gap    1028650..1028838
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    1031610..1031629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1046250..>1049676)
FT                   /gene="Ntn2l"
FT                   /locus_tag="mCG_12798"
FT                   /note="gene_id=mCG12798.1"
FT   mRNA            complement(join(1046250..1047110,1047374..1047448,
FT                   1047559..1047609,1047732..1047881,1047965..1048587,
FT                   1048678..>1049676))
FT                   /gene="Ntn2l"
FT                   /locus_tag="mCG_12798"
FT                   /product="netrin 2-like (chicken), transcript variant
FT                   mCT191634"
FT                   /note="gene_id=mCG12798.1 transcript_id=mCT191634.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1046620..1047110,1047374..1047448,
FT                   1047559..1047609,1047732..1047881,1047965..1048153,
FT                   1048225..1049308))
FT                   /gene="Ntn2l"
FT                   /locus_tag="mCG_12798"
FT                   /product="netrin 2-like (chicken), transcript variant
FT                   mCT13666"
FT                   /note="gene_id=mCG12798.1 transcript_id=mCT13666.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(1046761..1047110,1047374..1047448,
FT                   1047559..1047609,1047732..1047881,1047965..1048153,
FT                   1048225..1049152))
FT                   /codon_start=1
FT                   /gene="Ntn2l"
FT                   /locus_tag="mCG_12798"
FT                   /product="netrin 2-like (chicken), isoform CRA_a"
FT                   /note="gene_id=mCG12798.1 transcript_id=mCT13666.0
FT                   protein_id=mCP23148.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q52KG2"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR008211"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KG2"
FT                   /protein_id="EDL22299.1"
FT                   /translation="MPTWLWGLLLTAGTLSAALSPGLPASADPCYDEAREPRSCIPGLV
FT                   NAALGREVLASSTCGRSANRVCDSSDPQRAHSADLLTSAPGTASPLCWRSDLLQQAPFN
FT                   VTLTVPLGKAFELVFVSLRFCSAPPTSVALLKSQDHGRSWVPLGFFSSSCTLDYGRLPA
FT                   PADGPSGPGPEALCFPAPQAQPDGGGLLAFSVQDGSPQGLDLDNSPVLQDWVTATDIRI
FT                   VLTRPAIQGDTRDGGVTVPYSYSATELQVGGRCKCNGHASRCLLDTHGHLVCDCQHGTE
FT                   GPDCSRCKPFYCDRPWQRATGQEAHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLN
FT                   CRHNTAGRHCHYCREGFYRDPGRVLSDRRACRACDCHPVGAAGKTCNQTTGQCPCKDGV
FT                   TGLTCNRCAPGFQQSRSPVAPCVKTPVPGPTEESSPVEPQDCESHCRPARGSYRISLKK
FT                   FCRKDYAVQVAVGARGEARGSWTRFPVAVLAVFRSGEERARRGSSALWVPTLDAACGCP
FT                   RLLPGRRYLLLGGGPGAAAGSTAGRGQGLSAARGSLVLPWRDAWTRRLRRLQRRERRGR
FT                   CGTA"
FT   CDS             complement(join(1047986..1048587,1048678..>1049170))
FT                   /codon_start=1
FT                   /gene="Ntn2l"
FT                   /locus_tag="mCG_12798"
FT                   /product="netrin 2-like (chicken), isoform CRA_b"
FT                   /note="gene_id=mCG12798.1 transcript_id=mCT191634.0
FT                   protein_id=mCP112619.0 isoform=CRA_b"
FT                   /protein_id="EDL22300.1"
FT                   /translation="LTAATAMPTWLWGLLLTAGTLSAALSPGLPASADPCYDEAREPRS
FT                   CIPGLVNAALGREVLASSTCGRSANRVCDSSDPQRAHSADLLTSAPGTASPLCWRSDLL
FT                   QQAPFNVTLTVPLGKAFELVFVSLRFCSAPPTSVALLKSQDHGRSWVPLGFFSSSCTLD
FT                   YGLLAFSVQDGSPQGLDLDNSPVLQDWVTATDIRIVLTRPAIQGDTRDGGVTVPYSYSA
FT                   TELQVGGRCKCNGHASRCLLDTHGHLVCDCQHGTEGPDCSRCKPFYCDRPWQRATGQEA
FT                   HACLGEALEGSLGTSDQAGLPLTDPSLQLAPATAMREDAASTWSSTDCLAAAVGACAST
FT                   AGTIQLVVTATTAGRASIVIQAVS"
FT   gene            <1052672..1061889
FT                   /locus_tag="mCG_146227"
FT                   /note="gene_id=mCG146227.0"
FT   mRNA            join(<1052672..1052766,1060589..1060783,1061195..1061889)
FT                   /locus_tag="mCG_146227"
FT                   /product="mCG146227"
FT                   /note="gene_id=mCG146227.0 transcript_id=mCT186330.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<1052736..1052766,1060589..1060783,1061195..1061256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146227"
FT                   /product="mCG146227"
FT                   /note="gene_id=mCG146227.0 transcript_id=mCT186330.0
FT                   protein_id=mCP107361.0"
FT                   /protein_id="EDL22301.1"
FT                   /translation="ALRTLGWTLPVVFGLLGPGTLHNPDGPRRDWPGGPGSAYQTCSSL
FT                   LETRRLRSNCRCRSAQESKAPCSSATSLRTGFAEPTLKAEISGLADSRMT"
FT   gene            complement(1055227..>1061009)
FT                   /gene="1600002H07Rik"
FT                   /locus_tag="mCG_12845"
FT                   /note="gene_id=mCG12845.2"
FT   mRNA            complement(join(1055227..1056176,1056429..1056619,
FT                   1057859..1057960,1058067..1058158,1059311..1059364,
FT                   1059889..1060291,1060410..1060468,1060675..1060773,
FT                   1060849..1061008))
FT                   /gene="1600002H07Rik"
FT                   /locus_tag="mCG_12845"
FT                   /product="RIKEN cDNA 1600002H07, transcript variant
FT                   mCT13713"
FT                   /note="gene_id=mCG12845.2 transcript_id=mCT13713.1 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(1055409..1056176,1056429..1056619,
FT                   1057859..1057960,1058067..1058178,1058348..1058441,
FT                   1059311..1059364,1059889..1060468,1060675..1060773,
FT                   1060849..>1061009))
FT                   /gene="1600002H07Rik"
FT                   /locus_tag="mCG_12845"
FT                   /product="RIKEN cDNA 1600002H07, transcript variant
FT                   mCT191722"
FT                   /note="gene_id=mCG12845.2 transcript_id=mCT191722.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1055717..1056176,1056429..1056619,
FT                   1057859..1057960,1058067..1058178,1058348..1058441,
FT                   1059311..1059364,1059889..1060291,1060410..1060468,
FT                   1060680..>1060776))
FT                   /gene="1600002H07Rik"
FT                   /locus_tag="mCG_12845"
FT                   /product="RIKEN cDNA 1600002H07, transcript variant
FT                   mCT191721"
FT                   /note="gene_id=mCG12845.2 transcript_id=mCT191721.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1056030..1056176,1056429..1056619,
FT                   1057859..1057960,1058067..1058158,1059311..1059364,
FT                   1059889..1060291,1060410..1060468,1060675..1060773,
FT                   1060849..1060898))
FT                   /codon_start=1
FT                   /gene="1600002H07Rik"
FT                   /locus_tag="mCG_12845"
FT                   /product="RIKEN cDNA 1600002H07, isoform CRA_a"
FT                   /note="gene_id=mCG12845.2 transcript_id=mCT13713.1
FT                   protein_id=mCP23220.1 isoform=CRA_a"
FT                   /protein_id="EDL22302.1"
FT                   /translation="MLGVKGNYLLPADCAHRLVAELQGALDSCADRQRQLERSLRVSRR
FT                   LLQVWEPARTPSPVPETKEEDPSPACAPSSQDLEELELLTQALEKAVRVRKGVSNAGQR
FT                   DRTPTLTSKAATSGAAAASHPRAPSRGGSRVLGTRSTKGIQRATAPAKDYPEHRLRSKG
FT                   DKTHVRTQDQTTGYGPDLRDQQMTPSSAHHTTELFTLKEKGTLLQLPEDFRKAVSRNSW
FT                   PSATEVEVHAQILRKACMLLRLRMQKELATAPTDWMQEYRCLLTLEGLQTVVGQCLHRI
FT                   QVLQAAVTEQLPGECLAETRTQASSVCGGEVDSACSPELLLYASTEELQTLATLKLQVA
FT                   LLHQQIHLEKVLMAELLPLINTQDPGGPPWLALCRATYSLLCEGGERFLTVLRDDPAD"
FT   CDS             complement(join(1056030..1056176,1056429..1056619,
FT                   1057859..1057960,1058067..1058178,1058348..1058441,
FT                   1059311..1059364,1059889..1060291,1060410..1060468,
FT                   1060680..>1060765))
FT                   /codon_start=1
FT                   /gene="1600002H07Rik"
FT                   /locus_tag="mCG_12845"
FT                   /product="RIKEN cDNA 1600002H07, isoform CRA_b"
FT                   /note="gene_id=mCG12845.2 transcript_id=mCT191721.0
FT                   protein_id=mCP112667.0 isoform=CRA_b"
FT                   /protein_id="EDL22303.1"
FT                   /translation="RSCRAPWTPAPIGSGSWSGACAFPGGCCREPARTPSPVPETKEED
FT                   PSPACAPSSQDLEELELLTQALEKAVRVRKGVSNAGQRDRTPTLTSKAATSGAAAASHP
FT                   RAPSRGGSRVLGTRSTKGIQRATAPAKDYPEHRLRSKGDKTHVRTQDQTTGYGPDLRDQ
FT                   QMTPSSAHHTTELFTLKEKGTLLQLPEDFRKAVSRNSCLWAQLNSARTNDSTDATRAAK
FT                   TQFLHKLQMASGCSSHRPSATEVEVHAQILRKACMLLRLRMQKELATAPTDWMQEYRCL
FT                   LTLEGLQTVVGQCLHRIQVLQAAVTEQLPGECLAETRTQASSVCGGEVDSACSPELLLY
FT                   ASTEELQTLATLKLQVALLHQQIHLEKVLMAELLPLINTQDPGGPPWLALCRATYSLLC
FT                   EGGERFLTVLRDDPAD"
FT   CDS             complement(join(1056030..1056176,1056429..1056619,
FT                   1057859..1057960,1058067..1058178,1058348..1058441,
FT                   1059311..1059364,1059889..>1060325))
FT                   /codon_start=1
FT                   /gene="1600002H07Rik"
FT                   /locus_tag="mCG_12845"
FT                   /product="RIKEN cDNA 1600002H07, isoform CRA_c"
FT                   /note="gene_id=mCG12845.2 transcript_id=mCT191722.0
FT                   protein_id=mCP112668.0 isoform=CRA_c"
FT                   /protein_id="EDL22304.1"
FT                   /translation="GGILAWFLTFIACAPSSQDLEELELLTQALEKAVRVRKGVSNAGQ
FT                   RDRTPTLTSKAATSGAAAASHPRAPSRGGSRVLGTRSTKGIQRATAPAKDYPEHRLRSK
FT                   GDKTHVRTQDQTTGYGPDLRDQQMTPSSAHHTTELFTLKEKGTLLQLPEDFRKAVSRNS
FT                   CLWAQLNSARTNDSTDATRAAKTQFLHKLQMASGCSSHRPSATEVEVHAQILRKACMLL
FT                   RLRMQKELATAPTDWMQEYRCLLTLEGLQTVVGQCLHRIQVLQAAVTEQLPGECLAETR
FT                   TQASSVCGGEVDSACSPELLLYASTEELQTLATLKLQVALLHQQIHLEKVLMAELLPLI
FT                   NTQDPGGPPWLALCRATYSLLCEGGERFLTVLRDDPAD"
FT   gene            complement(1063388..>1091391)
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /note="gene_id=mCG12800.2"
FT   mRNA            complement(join(1063388..1064505,1065037..1065206,
FT                   1066590..1066717,1066799..1066898,1070370..1070457,
FT                   1071359..1071539,1071818..1071941,1074292..1074456,
FT                   1077044..1077195,1079816..1079893,1081150..1081248,
FT                   1081753..1081806,1082503..1082696,1083639..1083706,
FT                   1084891..1084997,1089286..1089440,1091338..>1091370))
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /product="cyclin F, transcript variant mCT191703"
FT                   /note="gene_id=mCG12800.2 transcript_id=mCT191703.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1063487..1064505,1065037..1065206,
FT                   1066590..1066717,1066799..1066898,1070370..1070457,
FT                   1071359..1071539,1071818..1071941,1074292..1074456,
FT                   1077044..1077195,1079816..1079893,1081144..1081248,
FT                   1081753..1081806,1082503..1082696,1083639..1083706,
FT                   1084891..1084997,1089286..1089427,1091338..>1091391))
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /product="cyclin F, transcript variant mCT191702"
FT                   /note="gene_id=mCG12800.2 transcript_id=mCT191702.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1063702..1064505,1065037..1065206,
FT                   1066590..1066717,1066799..1066898,1070370..1070457,
FT                   1071359..1071539,1071818..1071941,1074292..1074456,
FT                   1077044..1077195,1079816..1079893,1081144..1081248,
FT                   1081753..1081806,1082503..1082696,1083639..1083706,
FT                   1084891..1084997,1089286..1089440,1091338..1091390))
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /product="cyclin F, transcript variant mCT13669"
FT                   /note="gene_id=mCG12800.2 transcript_id=mCT13669.0 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(1063702..1064505,1065037..1065206,
FT                   1066590..1066717,1066799..1066898,1070370..1070457,
FT                   1071359..1071539,1071818..1071941,1074292..1074456,
FT                   1077044..1077195,1079816..1079893,1081144..1081248,
FT                   1081753..1081806,1082503..1082696,1083639..1083706,
FT                   1084891..1084997,1089286..1089440,1091220..>1091390))
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /product="cyclin F, transcript variant mCT191701"
FT                   /note="gene_id=mCG12800.2 transcript_id=mCT191701.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1064057..1064505,1065037..1065206,
FT                   1066590..1066717,1066799..1066898,1070370..1070457,
FT                   1071359..1071539,1071818..1071941,1074292..1074456,
FT                   1077044..1077195,1079816..1079893,1081144..1081248,
FT                   1081753..1081806,1082503..1082696,1083639..1083706,
FT                   1084891..1084997,1089286..1089427,1091338..>1091390))
FT                   /codon_start=1
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /product="cyclin F, isoform CRA_b"
FT                   /note="gene_id=mCG12800.2 transcript_id=mCT191702.0
FT                   protein_id=mCP112621.0 isoform=CRA_b"
FT                   /protein_id="EDL22306.1"
FT                   /translation="ESGLKRQWRELGDGERRWCAKCFCYPTKRRIKRRPRNLTILSLPE
FT                   DVLFHILKWLSVGDILAVRAVHSHLKYLVDNHASVWASASFQELWPSPQNLKLFERAAE
FT                   KGNFEAAVKLGIAYLYNEGLSVSDEACAEVNGLKASRFFSMAERLNTGSEPFIWLFIRP
FT                   PWSVSGSCCKAVVHDSLRAECQLQRSHKASILHCLGRVLNLFEDEEKRKQARSLLEESS
FT                   RQGCLISSYLLWESDRKVDMSDPGRCLHSFRKLRDYAAKGCWEAQLALAKACAGGSQLG
FT                   LEGKACSESVCQLFQASQAVNKQQIFSVQKGLSDTMRYILIDWLVEVATMKDFTSLCLH
FT                   LTVECVDRYLRRRLVPRYKLQLLGIACMVICTRFISKEILTIREAVWLTDNTYKYEDLV
FT                   RVMGEIISALEGKIRIPTVVDYKEVLLTLVPVAPRTQHLCSFLCELTLLHTSLSIYAPA
FT                   RLASAALLLARLMHGQTQPWTTHLWDLTGFSYSDLVPCVLSLHKKCFHDDAPKDYRQIS
FT                   LTAVKQRFEDKCYEEISREEVLSYADLCSAIGVKQESPEPPSFPSSGEIHTFLSSPSGR
FT                   RSKRKRENSLQEDRGSFVTTPTAELSNQEETLLGSLLDWSLECCSGYEGDQESEGEKEG
FT                   DVTAPSRLLDVTVVYLNPEEHCCQESSDEEAWPEDKIHPAPGTQAPPASAPRPLLCNRG
FT                   DRAKDITTSGYSSVSSSSPISSLDGGMGGSPQSTSVLSVGSHSSTKPCHHQAKKSCLQC
FT                   RPPNSPESGVHQQPVKRQNLSVHSDKDTHLAS"
FT   CDS             complement(join(1064057..1064505,1065037..1065206,
FT                   1066590..1066717,1066799..1066898,1070370..1070457,
FT                   1071359..1071539,1071818..1071941,1074292..1074456,
FT                   1077044..1077195,1079816..1079893,1081144..1081248,
FT                   1081753..1081806,1082503..1082696,1083639..1083706,
FT                   1084891..1084997,1089286..1089440,1091220..>1091388))
FT                   /codon_start=1
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /product="cyclin F, isoform CRA_a"
FT                   /note="gene_id=mCG12800.2 transcript_id=mCT191701.0
FT                   protein_id=mCP112620.0 isoform=CRA_a"
FT                   /protein_id="EDL22305.1"
FT                   /translation="ERSKAAVEGARRWGAAVVSAGGSRVGDRSYGTEAGGAWTGAPVTR
FT                   ECASHPPKHGVVIHCRCAKCFCYPTKRRIKRRPRNLTILSLPEDVLFHILKWLSVGDIL
FT                   AVRAVHSHLKYLVDNHASVWASASFQELWPSPQNLKLFERAAEKGNFEAAVKLGIAYLY
FT                   NEGLSVSDEACAEVNGLKASRFFSMAERLNTGSEPFIWLFIRPPWSVSGSCCKAVVHDS
FT                   LRAECQLQRSHKASILHCLGRVLNLFEDEEKRKQARSLLEESSRQGCLISSYLLWESDR
FT                   KVDMSDPGRCLHSFRKLRDYAAKGCWEAQLALAKACAGGSQLGLEGKACSESVCQLFQA
FT                   SQAVNKQQIFSVQKGLSDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVP
FT                   RYKLQLLGIACMVICTRFISKEILTIREAVWLTDNTYKYEDLVRVMGEIISALEGKIRI
FT                   PTVVDYKEVLLTLVPVAPRTQHLCSFLCELTLLHTSLSIYAPARLASAALLLARLMHGQ
FT                   TQPWTTHLWDLTGFSYSDLVPCVLSLHKKCFHDDAPKDYRQISLTAVKQRFEDKCYEEI
FT                   SREEVLSYADLCSAIGVKQESPEPPSFPSSGEIHTFLSSPSGRRSKRKRENSLQEDRGS
FT                   FVTTPTAELSNQEETLLGSLLDWSLECCSGYEGDQESEGEKEGDVTAPSRLLDVTVVYL
FT                   NPEEHCCQESSDEEAWPEDKIHPAPGTQAPPASAPRPLLCNRGDRAKDITTSGYSSVSS
FT                   SSPISSLDGGMGGSPQSTSVLSVGSHSSTKPCHHQAKKSCLQCRPPNSPESGVHQQPVK
FT                   RQNLSVHSDKDTHLAS"
FT   CDS             complement(join(1064057..1064505,1065037..1065206,
FT                   1066590..1066717,1066799..1066898,1070370..1070457,
FT                   1071359..1071539,1071818..1071941,1074292..1074456,
FT                   1077044..1077195,1079816..1079893,1081150..1081248,
FT                   1081753..1081806,1082503..1082696,1083639..1083706,
FT                   1084891..1084997,1089286..1089440,1091338..>1091368))
FT                   /codon_start=1
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /product="cyclin F, isoform CRA_c"
FT                   /note="gene_id=mCG12800.2 transcript_id=mCT191703.0
FT                   protein_id=mCP112622.0 isoform=CRA_c"
FT                   /protein_id="EDL22307.1"
FT                   /translation="GGSSAMGSGGVIHCRCAKCFCYPTKRRIKRRPRNLTILSLPEDVL
FT                   FHILKWLSVGDILAVRAVHSHLKYLVDNHASVWASASFQELWPSPQNLKLFERAAEKGN
FT                   FEAAVKLGIAYLYNEGLSVSDEACAEVNGLKASRFFSMAERLNTGSEPFIWLFIRPPWS
FT                   VSGSCCKAVVHDSLRAECQLQRSHKASILHCLGRVLNLFEDEEKRKQARSLLEESSRQG
FT                   CLISSYLLWESDRKMSDPGRCLHSFRKLRDYAAKGCWEAQLALAKACAGGSQLGLEGKA
FT                   CSESVCQLFQASQAVNKQQIFSVQKGLSDTMRYILIDWLVEVATMKDFTSLCLHLTVEC
FT                   VDRYLRRRLVPRYKLQLLGIACMVICTRFISKEILTIREAVWLTDNTYKYEDLVRVMGE
FT                   IISALEGKIRIPTVVDYKEVLLTLVPVAPRTQHLCSFLCELTLLHTSLSIYAPARLASA
FT                   ALLLARLMHGQTQPWTTHLWDLTGFSYSDLVPCVLSLHKKCFHDDAPKDYRQISLTAVK
FT                   QRFEDKCYEEISREEVLSYADLCSAIGVKQESPEPPSFPSSGEIHTFLSSPSGRRSKRK
FT                   RENSLQEDRGSFVTTPTAELSNQEETLLGSLLDWSLECCSGYEGDQESEGEKEGDVTAP
FT                   SRLLDVTVVYLNPEEHCCQESSDEEAWPEDKIHPAPGTQAPPASAPRPLLCNRGDRAKD
FT                   ITTSGYSSVSSSSPISSLDGGMGGSPQSTSVLSVGSHSSTKPCHHQAKKSCLQCRPPNS
FT                   PESGVHQQPVKRQNLSVHSDKDTHLAS"
FT   CDS             complement(join(1064057..1064505,1065037..1065206,
FT                   1066590..1066717,1066799..1066898,1070370..1070457,
FT                   1071359..1071539,1071818..1071941,1074292..1074456,
FT                   1077044..1077195,1079816..1079893,1081144..1081248,
FT                   1081753..1081806,1082503..1082696,1083639..1083706,
FT                   1084891..1084997,1089286..1089440,1091338..1091353))
FT                   /codon_start=1
FT                   /gene="Ccnf"
FT                   /locus_tag="mCG_12800"
FT                   /product="cyclin F, isoform CRA_d"
FT                   /note="gene_id=mCG12800.2 transcript_id=mCT13669.0
FT                   protein_id=mCP23158.1 isoform=CRA_d"
FT                   /protein_id="EDL22308.1"
FT                   /translation="MGSGGVIHCRCAKCFCYPTKRRIKRRPRNLTILSLPEDVLFHILK
FT                   WLSVGDILAVRAVHSHLKYLVDNHASVWASASFQELWPSPQNLKLFERAAEKGNFEAAV
FT                   KLGIAYLYNEGLSVSDEACAEVNGLKASRFFSMAERLNTGSEPFIWLFIRPPWSVSGSC
FT                   CKAVVHDSLRAECQLQRSHKASILHCLGRVLNLFEDEEKRKQARSLLEESSRQGCLISS
FT                   YLLWESDRKVDMSDPGRCLHSFRKLRDYAAKGCWEAQLALAKACAGGSQLGLEGKACSE
FT                   SVCQLFQASQAVNKQQIFSVQKGLSDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDR
FT                   YLRRRLVPRYKLQLLGIACMVICTRFISKEILTIREAVWLTDNTYKYEDLVRVMGEIIS
FT                   ALEGKIRIPTVVDYKEVLLTLVPVAPRTQHLCSFLCELTLLHTSLSIYAPARLASAALL
FT                   LARLMHGQTQPWTTHLWDLTGFSYSDLVPCVLSLHKKCFHDDAPKDYRQISLTAVKQRF
FT                   EDKCYEEISREEVLSYADLCSAIGVKQESPEPPSFPSSGEIHTFLSSPSGRRSKRKREN
FT                   SLQEDRGSFVTTPTAELSNQEETLLGSLLDWSLECCSGYEGDQESEGEKEGDVTAPSRL
FT                   LDVTVVYLNPEEHCCQESSDEEAWPEDKIHPAPGTQAPPASAPRPLLCNRGDRAKDITT
FT                   SGYSSVSSSSPISSLDGGMGGSPQSTSVLSVGSHSSTKPCHHQAKKSCLQCRPPNSPES
FT                   GVHQQPVKRQNLSVHSDKDTHLAS"
FT   assembly_gap    1087228..1087247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1088309..1088328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1094955..1098022
FT                   /estimated_length=3068
FT                   /gap_type="unknown"
FT   assembly_gap    1099612..1099631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1101677..1101696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1106304..1106547
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    1107592..1107611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1109366..1117088
FT                   /estimated_length=7723
FT                   /gap_type="unknown"
FT   gene            complement(<1117422..1195277)
FT                   /locus_tag="mCG_132071"
FT                   /note="gene_id=mCG132071.1"
FT   mRNA            complement(join(<1117422..1117616,1123876..1123998,
FT                   1124656..1124843,1128945..1129103,1131009..1131228,
FT                   1132243..1132447,1132583..1132856,1134804..1135134,
FT                   1138366..1138447,1139551..1139649,1142250..1142400,
FT                   1143287..1143497,1143598..1143732,1156370..1156438,
FT                   1160207..1160332,1161252..1161424,1164106..1164279,
FT                   1169455..1169572,1170733..1170849,1171612..1171871,
FT                   1177175..1177340,1178582..1178716,1194142..1194396,
FT                   1195191..1195277))
FT                   /locus_tag="mCG_132071"
FT                   /product="mCG132071"
FT                   /note="gene_id=mCG132071.1 transcript_id=mCT133419.1
FT                   created on 28-MAY-2002"
FT   CDS             complement(join(<1117422..1117616,1123876..1123998,
FT                   1124656..1124843,1128945..1129103,1131009..1131228,
FT                   1132243..1132447,1132583..1132856,1134804..1135134,
FT                   1138366..1138447,1139551..1139649,1142250..1142400,
FT                   1143287..1143497,1143598..1143732,1156370..1156438,
FT                   1160207..1160332,1161252..1161424,1164106..1164279,
FT                   1169455..1169572,1170733..1170849,1171612..1171871,
FT                   1177175..1177340,1178582..1178716,1194142..1194396,
FT                   1195191..1195244))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132071"
FT                   /product="mCG132071"
FT                   /note="gene_id=mCG132071.1 transcript_id=mCT133419.1
FT                   protein_id=mCP84561.1"
FT                   /protein_id="EDL22309.1"
FT                   /translation="MEVLKKLKLLLWKNFILKRRKTLITLLEMLMPLLFCAIVLYLRLN
FT                   SMPRKKSSTNYPAVDVSLLPVYFYNYPLKSKFQLAYIPSKSETLKAVTEVVEQTFAVDV
FT                   LGFPSVPLFEDYIIKDPKSFYILVGIIFHHDFNSSNEPLPLVVRVKYDLRFSYVQRNFV
FT                   SPPRHLFFQEEIEGWCTAFLYPPNLSQAPREFSYADGGNPGYNKEGFLAIQHAVDKAIM
FT                   RHHAPKAALNMFKDLHVLVQRFPFGPHIQDPFLVILQNEFPLLLMLSFICVELIITNSV
FT                   LSEKERKQKEYMSMMGVESWLHWVAWFITFFISVSITVSVMTVLFCTKINRVAVFRNSN
FT                   PTLIFIFLMCFAIATIFFAFMMSTFFQRAHVGTVIGGTVFFFTYLPYMYITFSYHQRTY
FT                   TQKILSCLFSNVAMAMGVRFISLFEAEGTGIQWRNIGSVWGDFSFAQVLGMLLLDSFLY
FT                   CLIAFLVESLFPRKFGIPKSWYIFAKKPVPEIPPLLNIGDPEKPSKGNFMQDEPTNQMN
FT                   TIEIQHLYKVFYSGRSKRTAIRDLSMNLYKGQDCHEQTQEMLHLLSLKDKWNSRSRFLS
FT                   GGMKRKLSIGIALIAGSKVLILDEPTSGLDSPSRRAIWDLLQQQKGDRTVLLTTHFMDE
FT                   ADLLGDRIAILAKGELQCCGSPSFLKQKYGAGYYMTIIKTPLCDTSKLSEVIYHHIPNA
FT                   VLESNIGEEMIFTLPKKTIHRFEALFNDLELRQTELGISTFATSVTTMEEVFIRVPVDR
FT                   IKCLHSGTFSVSTEQPMRLNTGTYLLLQLQFCLLCQQFYAMLLKRITYSRRNWMLVLSV
FT                   QVLLPLAIIMLSLTFFNFKLRKLDNVPLELTLQTYGQTIVPFFIAENSHLDPQLSDDFV
FT                   KMLVAAGQVPLRIQGSVEDFLLKKAKEAPEGFDKLYVVAASFEDVNNHTTVKALFNNQA
FT                   YHSPSLALTLVDNLLFKLLSGANASITTTNYPQPQTAIEVSESILYQGPKGHYLVVNFL
FT                   FGIAFLSSSFSILTVGEKSVKSKSLQFVSGVSTAVFWLSALLWDLISFLVPTLLLVLVF
FT                   LWYKEEAFAHHESIPAVVLIMMLYGWAVIPLVYTVSFSFNTPGSACVKLVVMLTFLSIS
FT                   PVVLVTVTSEKDLGYTELSDSLDHIFLILPGHCLGMALSNLYYNFELKKFCSAKNLSDI
FT                   DCNDVLEGYVVQENIYAWESLGIGKYLTALAVLGPVYITMLFLTEANAFYVLKSRLSGF
FT                   FPSFWKEKSGMIFDVAEPEDEDVLEETEAIKHYLETLIKKNPLVVKEVSKVYKDKVPLL
FT                   AVNKVSFVVKEEECFGLLGLNGAGKTSIFNMLTSEQPITSGDAFVKGFNIKSDIAK"
FT   assembly_gap    1119672..1121532
FT                   /estimated_length=1861
FT                   /gap_type="unknown"
FT   assembly_gap    1147999..1151283
FT                   /estimated_length=3285
FT                   /gap_type="unknown"
FT   assembly_gap    1152248..1152714
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   gene            complement(1179904..>1182289)
FT                   /locus_tag="mCG_132021"
FT                   /note="gene_id=mCG132021.0"
FT   mRNA            complement(join(1179904..1180099,1180611..>1182289))
FT                   /locus_tag="mCG_132021"
FT                   /product="mCG132021"
FT                   /note="gene_id=mCG132021.0 transcript_id=mCT133379.0
FT                   created on 28-MAY-2002"
FT   assembly_gap    1180100..1180610
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   CDS             complement(1180787..>1181386)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132021"
FT                   /product="mCG132021"
FT                   /note="gene_id=mCG132021.0 transcript_id=mCT133379.0
FT                   protein_id=mCP84708.1"
FT                   /protein_id="EDL22310.1"
FT                   /translation="RCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQY
FT                   ITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQES
FT                   ESWPPEACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEK
FT                   YPLEIKPPNQPLAAIDSENVENDKLPPPLQPQVYAG"
FT   assembly_gap    1189086..1190629
FT                   /estimated_length=1544
FT                   /gap_type="unknown"
FT   gene            <1200069..1257937
FT                   /gene="Abca3"
FT                   /locus_tag="mCG_12818"
FT                   /note="gene_id=mCG12818.2"
FT   mRNA            join(<1200069..1200237,1205848..1205920,1208811..1209012,
FT                   1212410..1212519,1212626..1212890,1214015..1214142,
FT                   1214697..1214862,1221558..1221817,1223655..1223771,
FT                   1223956..1224076,1224977..1225150,1229232..1229413,
FT                   1231235..1231378,1231782..1231911,1232754..1232908,
FT                   1233173..1233328,1233538..1233748,1234789..1234939,
FT                   1240282..1240380,1243975..1244161,1244807..1245110,
FT                   1245649..1245922,1247200..1247404,1247723..1247942,
FT                   1248109..1248484)
FT                   /gene="Abca3"
FT                   /locus_tag="mCG_12818"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   3, transcript variant mCT191654"
FT                   /note="gene_id=mCG12818.2 transcript_id=mCT191654.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<1200114..1200237,1205848..1205920,1208811..1209012,
FT                   1212410..1212519,1212626..1212890,1214015..1214142,
FT                   1214697..1214862,1221558..1221817,1223655..1223771,
FT                   1223956..1224076,1224977..1225150,1229232..1229413,
FT                   1231235..1231378,1231782..1231911,1232754..1232908,
FT                   1233173..1233328,1233538..1233748,1234789..1234939,
FT                   1240282..1240380,1243975..1244161,1244807..1245110,
FT                   1245649..1245922,1247200..1247404,1247723..1247942,
FT                   1248109..1248267,1249580..1249752,1252338..1252466,
FT                   1252558..1252752,1254889..1255076,1255440..1255610,
FT                   1255868..1256058,1256156..1256229,1256600..1256939)
FT                   /gene="Abca3"
FT                   /locus_tag="mCG_12818"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   3, transcript variant mCT191653"
FT                   /note="gene_id=mCG12818.2 transcript_id=mCT191653.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1200128..1200237,1205848..1205920,1208811..1209012,
FT                   1212410..1212519,1212626..1212890,1214015..1214142,
FT                   1214697..1214862,1221558..1221817,1223655..1223771,
FT                   1223956..1224076,1224977..1225150,1229232..1229413,
FT                   1231235..1231378,1231782..1231911,1232706..1232908,
FT                   1233173..1233328,1233538..1233748,1234789..1234939,
FT                   1240282..1240380,1243975..1244161,1244807..1245110,
FT                   1245649..1245922,1247200..1247404,1247723..1247942,
FT                   1248109..1248267,1249580..1249752,1252338..1252466,
FT                   1252558..1252752,1254889..1255076,1255440..1255610,
FT                   1255868..1256058,1256156..1256229,1256600..1257937)
FT                   /gene="Abca3"
FT                   /locus_tag="mCG_12818"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   3, transcript variant mCT13686"
FT                   /note="gene_id=mCG12818.2 transcript_id=mCT13686.2 created
FT                   on 28-MAY-2002"
FT   CDS             join(<1212424..1212519,1212626..1212890,1214015..1214142,
FT                   1214697..1214862,1221558..1221817,1223655..1223771,
FT                   1223956..1224076,1224977..1225150,1229232..1229413,
FT                   1231235..1231378,1231782..1231911,1232754..1232908,
FT                   1233173..1233328,1233538..1233748,1234789..1234939,
FT                   1240282..1240380,1243975..1244161,1244807..1245110,
FT                   1245649..1245922,1247200..1247404,1247723..1247942,
FT                   1248109..1248267,1249580..1249752,1252338..1252466,
FT                   1252558..1252752,1254889..1255076,1255440..1255610,
FT                   1255868..1256058,1256156..1256229,1256600..1256731)
FT                   /codon_start=1
FT                   /gene="Abca3"
FT                   /locus_tag="mCG_12818"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   3, isoform CRA_b"
FT                   /note="gene_id=mCG12818.2 transcript_id=mCT191653.0
FT                   protein_id=mCP112624.0 isoform=CRA_b"
FT                   /protein_id="EDL22312.1"
FT                   /translation="VLISGWCWHCASRKMAVLRQLTLLLWKNYTLKKRKVLVTVLELFL
FT                   PLLFSGILIWLRLKIQSENVPNATVYPDQSIQELPLFFSFPPPGGTWELAYVPSHSDAA
FT                   RTITETVKREFMIKMRVHGFSSEKDFEDYIRYDNHSSSVLAAVVFEHSFNHSQDPLPLA
FT                   VKYHLRFSYTRRNYMWTQTGNIFLKETEGWHTTSLFPLFPSPGPREPSSPDGGEPGYIR
FT                   EGFLAMQHAVDKAIMRYHANTSAQQLFQKLMVITKRFPFPPYISDPFLIAIQYQLPLLL
FT                   MLSFTYTSLTIIRAVVQEKEKKLKEYMRMMGLNSWLHWSAWFLMFFLFFLIVVSFMTLL
FT                   FCVKVKKDIAVLSNSDPSLVLAFLLCFAISSISFSFMVSTFFSKANIAAAVGGFLYFFT
FT                   YTPYFFVAPRYNWMTLSQKLLSCLLSNVAMAMGAQLIGKFEAKGTGIQWRDLLNPVNVD
FT                   DDFCFGQVLGMLLLDSALYGLVTWYVEAVFPGQFGVPQPWHFFLMPSYWCGNPRTVVGK
FT                   EEEGSDPEKALRNEYFEAEPEDLVAGIKIKHLSKVFQVGNKDKMGIRDLTLNLYEGQIT
FT                   VLLGHNGAGKTTTMSLLTGLFPPTSGHAYIHGYEISQDMAQIRKSLGLCPQHDVLFDNL
FT                   TVAEHLYFYAQLKGLSLQKCPEEVKQMLHILSLEDKRDLRSKFLSGGMKRKLSIGIALI
FT                   AGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSDRTVLLTTHFMDEADLLGDRIAILAKG
FT                   ELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGISQLVHHHVPNAMLESHAGAELSFIL
FT                   PKESTHRFESLFAKLEKKQKELGIASFGASVTTMEEVFLRVGKLVDTSMDIQAIQLPAL
FT                   QYQHERRASDWALDSNLCGVMDPTNGIGALIEEEEVLVKLNTGLALHCQQFWAMFLKKA
FT                   AYSWREWKMVAAQVLVPLTCLTLALLAIHYTSEIFDDPLLKLSLNEYGRTVVPFSVPGT
FT                   SRLAQQLSENLRDMLQAERQEPREVLGDLEEFLVFRASVEGGGFNERCLVATSFKDRGE
FT                   LTVVTALFNNQAYHSPATALAIVDNLLFKLLCGPWASIEISNYPQPRNTLQVAKDHFNE
FT                   GRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQFVSGVHVATFWLSALLWDLIS
FT                   FLVPSLLLLVVFQAFNVHAFTRDGHMADLLLLLMLYGWAIIPLMYLMSFFFSAASTAYT
FT                   RLTIFNILSGIATFIMVTIMRIPAVKLEELSRTLDHVFLVLPNHCLGMAVSNFYENYET
FT                   RRYCTSSELAAHYCKKYNIQYQESFYAWSTPGVGKFVTSMAASGGIYLTLLFLIETNLL
FT                   WRLRTFICAFRRRWTLAELQNRTSVLPEDQDVAEERSRILVPSLDSMLDTPLIINELSK
FT                   VYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGEETITSGDAFVGGYSI
FT                   SSDIGKVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLINACVENTLRGLLLEP
FT                   HANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARARESGK
FT                   AIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRSEGKQDAL
FT                   EEFKAFVDLTFPGSILEDEHQDMVHYHLPGCDLSWAKVFGILEKAKEKYGVDDYSVSQI
FT                   SLEQVFLSFAHLQPPTTEDGR"
FT   CDS             join(<1212424..1212519,1212626..1212890,1214015..1214142,
FT                   1214697..1214862,1221558..1221817,1223655..1223771,
FT                   1223956..1224076,1224977..1225150,1229232..1229413,
FT                   1231235..1231378,1231782..1231911,1232754..1232908,
FT                   1233173..1233328,1233538..1233748,1234789..1234939,
FT                   1240282..1240380,1243975..1244161,1244807..1245110,
FT                   1245649..1245922,1247200..1247404,1247723..1247942,
FT                   1248109..1248293)
FT                   /codon_start=1
FT                   /gene="Abca3"
FT                   /locus_tag="mCG_12818"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   3, isoform CRA_c"
FT                   /note="gene_id=mCG12818.2 transcript_id=mCT191654.0
FT                   protein_id=mCP112625.0 isoform=CRA_c"
FT                   /protein_id="EDL22313.1"
FT                   /translation="VLISGWCWHCASRKMAVLRQLTLLLWKNYTLKKRKVLVTVLELFL
FT                   PLLFSGILIWLRLKIQSENVPNATVYPDQSIQELPLFFSFPPPGGTWELAYVPSHSDAA
FT                   RTITETVKREFMIKMRVHGFSSEKDFEDYIRYDNHSSSVLAAVVFEHSFNHSQDPLPLA
FT                   VKYHLRFSYTRRNYMWTQTGNIFLKETEGWHTTSLFPLFPSPGPREPSSPDGGEPGYIR
FT                   EGFLAMQHAVDKAIMRYHANTSAQQLFQKLMVITKRFPFPPYISDPFLIAIQYQLPLLL
FT                   MLSFTYTSLTIIRAVVQEKEKKLKEYMRMMGLNSWLHWSAWFLMFFLFFLIVVSFMTLL
FT                   FCVKVKKDIAVLSNSDPSLVLAFLLCFAISSISFSFMVSTFFSKANIAAAVGGFLYFFT
FT                   YTPYFFVAPRYNWMTLSQKLLSCLLSNVAMAMGAQLIGKFEAKGTGIQWRDLLNPVNVD
FT                   DDFCFGQVLGMLLLDSALYGLVTWYVEAVFPGQFGVPQPWHFFLMPSYWCGNPRTVVGK
FT                   EEEGSDPEKALRNEYFEAEPEDLVAGIKIKHLSKVFQVGNKDKMGIRDLTLNLYEGQIT
FT                   VLLGHNGAGKTTTMSLLTGLFPPTSGHAYIHGYEISQDMAQIRKSLGLCPQHDVLFDNL
FT                   TVAEHLYFYAQLKGLSLQKCPEEVKQMLHILSLEDKRDLRSKFLSGGMKRKLSIGIALI
FT                   AGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSDRTVLLTTHFMDEADLLGDRIAILAKG
FT                   ELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGISQLVHHHVPNAMLESHAGAELSFIL
FT                   PKESTHRFESLFAKLEKKQKELGIASFGASVTTMEEVFLRVGKLVDTSMDIQAIQLPAL
FT                   QYQHERRASDWALDSNLCGVMDPTNGIGALIEEEEVLVKLNTGLALHCQQFWAMFLKKA
FT                   AYSWREWKMVAAQVLVPLTCLTLALLAIHYTSEIFDDPLLKLSLNEYGRTVVPFSVPGT
FT                   SRLAQQLSENLRDMLQAERQEPREVLGDLEEFLVFRASVEGGGFNERCLVATSFKDRGE
FT                   LTVVTALFNNQAYHSPATALAIVDNLLFKLLCGPWASIEISNYPQPRNTLQVAKDHFNE
FT                   GRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQFVSGVHVATFWLSALLWDLIS
FT                   FLVPSLLLLVVFQAFNVHAFTRDGHMADLLLLLMLYGWAIIPLMYLMSFFFSAASTAYT
FT                   RLTIFNILSGIATFIMVTIMRIPAVKLEELSRTLDHVFLVLPNHCLGMAVSNFYENYET
FT                   RRYCTSSELAAHYCKKYSECPDGPF"
FT   CDS             join(1212466..1212519,1212626..1212890,1214015..1214142,
FT                   1214697..1214862,1221558..1221817,1223655..1223771,
FT                   1223956..1224076,1224977..1225150,1229232..1229413,
FT                   1231235..1231378,1231782..1231911,1232706..1232908,
FT                   1233173..1233328,1233538..1233748,1234789..1234939,
FT                   1240282..1240380,1243975..1244161,1244807..1245110,
FT                   1245649..1245922,1247200..1247404,1247723..1247942,
FT                   1248109..1248267,1249580..1249752,1252338..1252466,
FT                   1252558..1252752,1254889..1255076,1255440..1255610,
FT                   1255868..1256058,1256156..1256229,1256600..1256731)
FT                   /codon_start=1
FT                   /gene="Abca3"
FT                   /locus_tag="mCG_12818"
FT                   /product="ATP-binding cassette, sub-family A (ABC1), member
FT                   3, isoform CRA_a"
FT                   /note="gene_id=mCG12818.2 transcript_id=mCT13686.2
FT                   protein_id=mCP23254.2 isoform=CRA_a"
FT                   /protein_id="EDL22311.1"
FT                   /translation="MAVLRQLTLLLWKNYTLKKRKVLVTVLELFLPLLFSGILIWLRLK
FT                   IQSENVPNATVYPDQSIQELPLFFSFPPPGGTWELAYVPSHSDAARTITETVKREFMIK
FT                   MRVHGFSSEKDFEDYIRYDNHSSSVLAAVVFEHSFNHSQDPLPLAVKYHLRFSYTRRNY
FT                   MWTQTGNIFLKETEGWHTTSLFPLFPSPGPREPSSPDGGEPGYIREGFLAMQHAVDKAI
FT                   MRYHANTSAQQLFQKLMVITKRFPFPPYISDPFLIAIQYQLPLLLMLSFTYTSLTIIRA
FT                   VVQEKEKKLKEYMRMMGLNSWLHWSAWFLMFFLFFLIVVSFMTLLFCVKVKKDIAVLSN
FT                   SDPSLVLAFLLCFAISSISFSFMVSTFFSKANIAAAVGGFLYFFTYTPYFFVAPRYNWM
FT                   TLSQKLLSCLLSNVAMAMGAQLIGKFEAKGTGIQWRDLLNPVNVDDDFCFGQVLGMLLL
FT                   DSALYGLVTWYVEAVFPGQFGVPQPWHFFLMPSYWCGNPRTVVGKEEEGSDPEKALRNE
FT                   YFEAEPEDLVAGIKIKHLSKVFQVGNKDKMGIRDLTLNLYEGQITVLLGHNGAGKTTTM
FT                   SLLTGEQDFHNELGVSDSTAGLFPPTSGHAYIHGYEISQDMAQIRKSLGLCPQHDVLFD
FT                   NLTVAEHLYFYAQLKGLSLQKCPEEVKQMLHILSLEDKRDLRSKFLSGGMKRKLSIGIA
FT                   LIAGSKVLMLDEPTSGMDAVSRRAIWDLLQQQKSDRTVLLTTHFMDEADLLGDRIAILA
FT                   KGELQCCGSSLFLKQKYGAGYHMTLVKEPHCNPEGISQLVHHHVPNAMLESHAGAELSF
FT                   ILPKESTHRFESLFAKLEKKQKELGIASFGASVTTMEEVFLRVGKLVDTSMDIQAIQLP
FT                   ALQYQHERRASDWALDSNLCGVMDPTNGIGALIEEEEVLVKLNTGLALHCQQFWAMFLK
FT                   KAAYSWREWKMVAAQVLVPLTCLTLALLAIHYTSEIFDDPLLKLSLNEYGRTVVPFSVP
FT                   GTSRLAQQLSENLRDMLQAERQEPREVLGDLEEFLVFRASVEGGGFNERCLVATSFKDR
FT                   GELTVVTALFNNQAYHSPATALAIVDNLLFKLLCGPWASIEISNYPQPRNTLQVAKDHF
FT                   NEGRKGFDIALNLLIAMAFLASTFSILAVSERAVQAKHVQFVSGVHVATFWLSALLWDL
FT                   ISFLVPSLLLLVVFQAFNVHAFTRDGHMADLLLLLMLYGWAIIPLMYLMSFFFSAASTA
FT                   YTRLTIFNILSGIATFIMVTIMRIPAVKLEELSRTLDHVFLVLPNHCLGMAVSNFYENY
FT                   ETRRYCTSSELAAHYCKKYNIQYQESFYAWSTPGVGKFVTSMAASGGIYLTLLFLIETN
FT                   LLWRLRTFICAFRRRWTLAELQNRTSVLPEDQDVAEERSRILVPSLDSMLDTPLIINEL
FT                   SKVYDQRAPLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGEETITSGDAFVGGY
FT                   SISSDIGKVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLINACVENTLRGLLL
FT                   EPHANKLVKTYSGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWDTVARARES
FT                   GKAIVITSHSMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRSEGKQD
FT                   ALEEFKAFVDLTFPGSILEDEHQDMVHYHLPGCDLSWAKVFGILEKAKEKYGVDDYSVS
FT                   QISLEQVFLSFAHLQPPTTEDGR"
FT   assembly_gap    1239036..1239083
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    1240873..1240929
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   gene            complement(1256828..1262005)
FT                   /locus_tag="mCG_1051026"
FT                   /note="gene_id=mCG1051026.0"
FT   mRNA            complement(join(1256828..1257006,1257022..1257523,
FT                   1257610..1257705,1259378..1259536,1260059..1260167,
FT                   1261305..1261530,1261911..1262005))
FT                   /locus_tag="mCG_1051026"
FT                   /product="mCG1051026"
FT                   /note="gene_id=mCG1051026.0 transcript_id=mCT194815.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(1257042..1257287)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051026"
FT                   /product="mCG1051026"
FT                   /note="gene_id=mCG1051026.0 transcript_id=mCT194815.0
FT                   protein_id=mCP115844.0"
FT                   /protein_id="EDL22314.1"
FT                   /translation="MPLQLHWEPTVSAPSHSQYLPFMKVFATLLLIPGSLEVLIAAQPC
FT                   WLSSPPPQGSLVSYVNIDRSLGSLWISTGKKLNPPG"
FT   assembly_gap    1259712..1259984
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   gene            1262265..1273135
FT                   /locus_tag="mCG_12830"
FT                   /note="gene_id=mCG12830.2"
FT   mRNA            join(1262265..1262327,1265449..1265629,1265869..1266024,
FT                   1267620..1267811,1269166..1269268,1269567..1269720,
FT                   1271639..1271780,1272326..1273133)
FT                   /locus_tag="mCG_12830"
FT                   /product="mCG12830, transcript variant mCT169679"
FT                   /note="gene_id=mCG12830.2 transcript_id=mCT169679.0 created
FT                   on 28-MAY-2002"
FT   mRNA            join(1262686..1262755,1265449..1265629,1265869..1266024,
FT                   1267620..1267811,1269166..1269268,1269567..1269720,
FT                   1271639..1271780,1272326..1273135)
FT                   /locus_tag="mCG_12830"
FT                   /product="mCG12830, transcript variant mCT13699"
FT                   /note="gene_id=mCG12830.2 transcript_id=mCT13699.0 created
FT                   on 28-MAY-2002"
FT   assembly_gap    1264212..1264429
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   CDS             join(1265559..1265629,1265869..1266024,1267620..1267811,
FT                   1269166..1269268,1269567..1269720,1271639..1271780,
FT                   1272326..1272425)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12830"
FT                   /product="mCG12830, isoform CRA_a"
FT                   /note="gene_id=mCG12830.2 transcript_id=mCT13699.0
FT                   protein_id=mCP23184.1 isoform=CRA_a"
FT                   /protein_id="EDL22315.1"
FT                   /translation="MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKD
FT                   KGATKESSEKDRGRDKTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASS
FT                   RSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKV
FT                   HIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKH
FT                   MDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRS
FT                   PVRRRSRSPGRRRHRSRSSSNSSR"
FT   CDS             join(1265559..1265629,1265869..1266024,1267620..1267811,
FT                   1269166..1269268,1269567..1269720,1271639..1271780,
FT                   1272326..1272425)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12830"
FT                   /product="mCG12830, isoform CRA_a"
FT                   /note="gene_id=mCG12830.2 transcript_id=mCT169679.0
FT                   protein_id=mCP92677.0 isoform=CRA_a"
FT                   /protein_id="EDL22316.1"
FT                   /translation="MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKD
FT                   KGATKESSEKDRGRDKTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASS
FT                   RSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKV
FT                   HIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKH
FT                   MDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRS
FT                   PVRRRSRSPGRRRHRSRSSSNSSR"
FT   gene            1273920..1288013
FT                   /gene="Dci"
FT                   /locus_tag="mCG_12836"
FT                   /note="gene_id=mCG12836.3"
FT   mRNA            join(1273920..1273981,1274092..1274178,1281733..1281860,
FT                   1284775..1284921,1286008..1286129,1286220..1286398,
FT                   1287737..1288013)
FT                   /gene="Dci"
FT                   /locus_tag="mCG_12836"
FT                   /product="dodecenoyl-Coenzyme A delta isomerase (3,2
FT                   trans-enoyl-Coenyme A isomerase)"
FT                   /note="gene_id=mCG12836.3 transcript_id=mCT13704.2 created
FT                   on 17-JUN-2003"
FT   CDS             join(1273942..1273981,1274092..1274178,1281733..1281860,
FT                   1284775..1284921,1286008..1286129,1286220..1286398,
FT                   1287737..1287903)
FT                   /codon_start=1
FT                   /gene="Dci"
FT                   /locus_tag="mCG_12836"
FT                   /product="dodecenoyl-Coenzyme A delta isomerase (3,2
FT                   trans-enoyl-Coenyme A isomerase)"
FT                   /note="gene_id=mCG12836.3 transcript_id=mCT13704.2
FT                   protein_id=mCP23223.0"
FT                   /db_xref="GOA:P42125"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:94871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42125"
FT                   /protein_id="EDL22317.1"
FT                   /translation="MALAAARRLLLHAGSRLGRREAVDGARRFANKRVLVETEGPAGVA
FT                   VMKLRNPPVNSLSLECLTEFTISLEKLENDKSIRGVILTSECPGIFSAGLDLLEMYGRN
FT                   PAHYAEYWKNVQELWLRLYTSNMILVSAINGASPAGGCLLALCCDYRVMADNPKYTIGL
FT                   NESLLGIVAPFWFKDMYVNTIGHREAERALQLGTLFSPAEALKVGVVDEVVPEDQVHSK
FT                   ARSVMTKWLAIPDHSRQLTKNMMRKATADNLIKQREADIQNFTSFISKDSIQKSLHMYL
FT                   EKLKQKKG"
FT   assembly_gap    1289320..1289339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1289983..1292326)
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /note="gene_id=mCG12809.3"
FT   mRNA            complement(join(1289983..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291373,1291454..1291537,
FT                   1291626..1291714,1291860..1292305))
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, transcript variant
FT                   mCT13677"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT13677.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1289983..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291373,1291454..1291537,
FT                   1291626..1291921))
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, transcript variant
FT                   mCT185349"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT185349.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1289983..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291400))
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, transcript variant
FT                   mCT185348"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT185348.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1290008..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291373,1291454..1291537,
FT                   1291679..1291714,1291860..1292019,1292227..1292326))
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, transcript variant
FT                   mCT185347"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT185347.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(1290168..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291373,1291454..1291537,
FT                   1291626..1291714,1291860..1292019,1292227..1292322))
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, transcript variant
FT                   mCT181614"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT181614.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(1290362..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291373,1291454..1291537,
FT                   1291626..1291714,1291860..1292003))
FT                   /codon_start=1
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT13677.1
FT                   protein_id=mCP23310.2 isoform=CRA_a"
FT                   /protein_id="EDL22318.1"
FT                   /translation="MGWPWAPLTAVWALGVMGATALRIGAFNVQSFGDNKVSDPDCGSV
FT                   IAQILAGYDIALVQEVRDPDLSAVSLLMEQINRVSKHEYGFVSSKPLGRDQYKEMYLFV
FT                   YRKDVASVVSTYQYPDPEDAFSREPFVVKFSVPSCATKELVLIPLHAAPHQAVAEIDAL
FT                   YDVYLDVIDKWNTDDMLFLGDFNADCKYVKAHDWPSIRLRSSEVFKWLIPDSADTTVGN
FT                   SDCAYDRIVVSGAHLRRSLKPHSASVHNFQEEFDLDQTQGLRICHLQTITTRNGTTVNH
FT                   SGGRPPTH"
FT   CDS             complement(join(1290362..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291373,1291454..1291537,
FT                   1291626..1291714,1291860..1292003))
FT                   /codon_start=1
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT181614.0
FT                   protein_id=mCP104536.0 isoform=CRA_a"
FT                   /protein_id="EDL22321.1"
FT                   /translation="MGWPWAPLTAVWALGVMGATALRIGAFNVQSFGDNKVSDPDCGSV
FT                   IAQILAGYDIALVQEVRDPDLSAVSLLMEQINRVSKHEYGFVSSKPLGRDQYKEMYLFV
FT                   YRKDVASVVSTYQYPDPEDAFSREPFVVKFSVPSCATKELVLIPLHAAPHQAVAEIDAL
FT                   YDVYLDVIDKWNTDDMLFLGDFNADCKYVKAHDWPSIRLRSSEVFKWLIPDSADTTVGN
FT                   SDCAYDRIVVSGAHLRRSLKPHSASVHNFQEEFDLDQTQGLRICHLQTITTRNGTTVNH
FT                   SGGRPPTH"
FT   CDS             complement(join(1290362..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291373,1291454..1291537,
FT                   1291679..1291701))
FT                   /codon_start=1
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT185347.0
FT                   protein_id=mCP106607.0 isoform=CRA_b"
FT                   /protein_id="EDL22319.1"
FT                   /translation="MISPWCKRVSKHEYGFVSSKPLGRDQYKEMYLFVYRKDVASVVST
FT                   YQYPDPEDAFSREPFVVKFSVPSCATKELVLIPLHAAPHQAVAEIDALYDVYLDVIDKW
FT                   NTDDMLFLGDFNADCKYVKAHDWPSIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVVS
FT                   GAHLRRSLKPHSASVHNFQEEFDLDQTQGLRICHLQTITTRNGTTVNHSGGRPPTH"
FT   CDS             complement(join(1290362..1290447,1290718..1290970,
FT                   1291079..1291191,1291273..1291373,1291454..1291537,
FT                   1291626..1291642))
FT                   /codon_start=1
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, isoform CRA_c"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT185349.0
FT                   protein_id=mCP106605.0 isoform=CRA_c"
FT                   /protein_id="EDL22320.1"
FT                   /translation="MEQINRVSKHEYGFVSSKPLGRDQYKEMYLFVYRKDVASVVSTYQ
FT                   YPDPEDAFSREPFVVKFSVPSCATKELVLIPLHAAPHQAVAEIDALYDVYLDVIDKWNT
FT                   DDMLFLGDFNADCKYVKAHDWPSIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVVSGA
FT                   HLRRSLKPHSASVHNFQEEFDLDQTQGLRICHLQTITTRNGTTVNHSGGRPPTH"
FT   CDS             complement(join(1290362..1290447,1290718..1290967))
FT                   /codon_start=1
FT                   /gene="Dnase1l2"
FT                   /locus_tag="mCG_12809"
FT                   /product="deoxyribonuclease 1-like 2, isoform CRA_d"
FT                   /note="gene_id=mCG12809.3 transcript_id=mCT185348.0
FT                   protein_id=mCP106606.0 isoform=CRA_d"
FT                   /protein_id="EDL22322.1"
FT                   /translation="MLFLGDFNADCKYVKAHDWPSIRLRSSEVFKWLIPDSADTTVGNS
FT                   DCAYDRIVVSGAHLRRSLKPHSASVHNFQEEFDLDQTQGLRICHLQTITTRNGTTVNHS
FT                   GGRPPTH"
FT   assembly_gap    1290448..1290467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1293013..>1304758)
FT                   /gene="E4f1"
FT                   /locus_tag="mCG_12813"
FT                   /note="gene_id=mCG12813.2"
FT   mRNA            complement(join(1293013..1293533,1293610..1293672,
FT                   1293743..1293885,1293972..1294170,1294318..1294535,
FT                   1294642..1294750,1295132..1295341,1295700..1295866,
FT                   1295968..1296120,1296277..1296397,1296485..1296678,
FT                   1298811..1298922,1300597..1300748,1304520..1304757))
FT                   /gene="E4f1"
FT                   /locus_tag="mCG_12813"
FT                   /product="E4F transcription factor 1, transcript variant
FT                   mCT13681"
FT                   /note="gene_id=mCG12813.2 transcript_id=mCT13681.1 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(1293017..1293672,1293743..1293885,
FT                   1293972..1294170,1294318..1294535,1294642..1294750,
FT                   1295132..1295341,1295700..1295866,1295968..1296120,
FT                   1296277..1296397,1296485..1296678,1298811..1298922,
FT                   1300597..1300748,1304520..>1304758))
FT                   /gene="E4f1"
FT                   /locus_tag="mCG_12813"
FT                   /product="E4F transcription factor 1, transcript variant
FT                   mCT191652"
FT                   /note="gene_id=mCG12813.2 transcript_id=mCT191652.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1293177..1293533,1293610..1293672,
FT                   1293743..1293885,1293972..1294170,1294318..1294535,
FT                   1294642..1294750,1295132..1295341,1295700..1295866,
FT                   1295968..1296120,1296277..1296397,1296485..1296678,
FT                   1298811..1298922,1300597..1300748,1304520..1304676))
FT                   /codon_start=1
FT                   /gene="E4f1"
FT                   /locus_tag="mCG_12813"
FT                   /product="E4F transcription factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG12813.2 transcript_id=mCT13681.1
FT                   protein_id=mCP23327.1 isoform=CRA_b"
FT                   /protein_id="EDL22324.1"
FT                   /translation="MEGAMAVRVTAAHTAEAGAEAGREAGEGGVAAAAAALSSGGFLGL
FT                   PAPFSEEDEDDVHRCGRCQVEFTALEDFVQHKIQKTCHRAPQEALPTTPAATALLDQEV
FT                   VPTAAEGGPDEPITVAHIVVEATSLAEDISHAPDLVGSGHIKEVVVAAEAEPGDGEMAE
FT                   APGSPNHQELGLLGEGEQAHVKLLVNKEGRYVCMLCHKTFKTGSILKAHMVTHSSRKDH
FT                   ECKLCGASFRTKGSLIRHHRRHTDERPYKCAKCGKSFRESGALTRHLKSLTPCTEKIRF
FT                   SISKDTAVGKEEVPAGSSASTVGTVTSSVAGDPMETSPVIHLVTDAKGTVIHEVHVQMQ
FT                   ELPLGMKALTPESPDSEELPCSSENSRENLLHQAMQNSGIVLERVAGEESALEPAPPSG
FT                   SSPQCLGDGSPELPLLKVEQIETQVASEAATVPRTHPCPQCSETFPTAATLEAHKRGHI
FT                   APRPFTCTQCGKAFPKAYLLKKHQEVHVHERRFRCGDCGKLYKTIAHVRGHRRVHSDER
FT                   PFPCPQCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFK
FT                   CYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEESPSAAATVLAEDPHTVLVQFSSV
FT                   VADTQEYIIEATADDTETSEATEIIEGTQTEVDSHIMKVVQQIVHQAGAGHQIIVQNVT
FT                   MDQETALGSEAAAADTITIATPESLTEQVAMTLASAISEGTVLTARAGPNSTEQATVTM
FT                   VSSEDIEILEHGGELVIASPEGQLEVQTVIV"
FT   CDS             complement(join(1293550..1293672,1293743..1293885,
FT                   1293972..1294170,1294318..1294535,1294642..1294750,
FT                   1295132..1295341,1295700..1295866,1295968..1296120,
FT                   1296277..1296397,1296485..1296678,1298811..1298922,
FT                   1300597..1300748,1304520..>1304706))
FT                   /codon_start=1
FT                   /gene="E4f1"
FT                   /locus_tag="mCG_12813"
FT                   /product="E4F transcription factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG12813.2 transcript_id=mCT191652.0
FT                   protein_id=mCP112623.0 isoform=CRA_a"
FT                   /protein_id="EDL22323.1"
FT                   /translation="IRHLPVVRCDMEGAMAVRVTAAHTAEAGAEAGREAGEGGVAAAAA
FT                   ALSSGGFLGLPAPFSEEDEDDVHRCGRCQVEFTALEDFVQHKIQKTCHRAPQEALPTTP
FT                   AATALLDQEVVPTAAEGGPDEPITVAHIVVEATSLAEDISHAPDLVGSGHIKEVVVAAE
FT                   AEPGDGEMAEAPGSPNHQELGLLGEGEQAHVKLLVNKEGRYVCMLCHKTFKTGSILKAH
FT                   MVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCAKCGKSFRESGALTRHLKS
FT                   LTPCTEKIRFSISKDTAVGKEEVPAGSSASTVGTVTSSVAGDPMETSPVIHLVTDAKGT
FT                   VIHEVHVQMQELPLGMKALTPESPDSEELPCSSENSRENLLHQAMQNSGIVLERVAGEE
FT                   SALEPAPPSGSSPQCLGDGSPELPLLKVEQIETQVASEAATVPRTHPCPQCSETFPTAA
FT                   TLEAHKRGHIAPRPFTCTQCGKAFPKAYLLKKHQEVHVHERRFRCGDCGKLYKTIAHVR
FT                   GHRRVHSDERPFPCPQCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHV
FT                   RHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEESPSAAATVLAEDP
FT                   HTVLVQFSSVVADTQEYIIEATADDTETSEATEIIEGTQTEVRVWVRDGRITGLLGSPS
FT                   G"
FT   gene            complement(1314782..1320697)
FT                   /locus_tag="mCG_147767"
FT                   /note="gene_id=mCG147767.0"
FT   mRNA            complement(join(1314782..1316054,1320593..1320697))
FT                   /locus_tag="mCG_147767"
FT                   /product="mCG147767"
FT                   /note="gene_id=mCG147767.0 transcript_id=mCT188030.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1315554..1315742)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147767"
FT                   /product="mCG147767"
FT                   /note="gene_id=mCG147767.0 transcript_id=mCT188030.0
FT                   protein_id=mCP108945.0"
FT                   /protein_id="EDL22325.1"
FT                   /translation="MERRWLWRGPARVWGDCGLHGGVALWMIRSPFPCVPHTQLVLSID
FT                   LLVDGTSVMSSQVRNMP"
FT   assembly_gap    1317318..1317337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1320914..1322113
FT                   /gene="1700012G19Rik"
FT                   /locus_tag="mCG_12804"
FT                   /note="gene_id=mCG12804.2"
FT   mRNA            join(1320914..1321652,1321745..1322113)
FT                   /gene="1700012G19Rik"
FT                   /locus_tag="mCG_12804"
FT                   /product="RIKEN cDNA 1700012G19"
FT                   /note="gene_id=mCG12804.2 transcript_id=mCT13672.2 created
FT                   on 28-MAY-2002"
FT   CDS             join(1321013..1321652,1321745..1322070)
FT                   /codon_start=1
FT                   /gene="1700012G19Rik"
FT                   /locus_tag="mCG_12804"
FT                   /product="RIKEN cDNA 1700012G19"
FT                   /note="gene_id=mCG12804.2 transcript_id=mCT13672.2
FT                   protein_id=mCP23219.2"
FT                   /protein_id="EDL22326.1"
FT                   /translation="MAEAEAGGDEARCVRLSAERAKLLLAEVDTLLFDCDGVLWRGETA
FT                   VPGAPETLRALRARGKRLGFITNNSSKTRTAYAEKLRRLGFGGPVGPEAGLEVFGTAYC
FT                   SALYLRQRLAGVPDPKAYVLGSPALAAELEAVGVTSVGVGPDVLHGDGPSDWLAVPLEP
FT                   DVRAVVVGFDPHFSYMKLTKAVRYLQQPDCLLVGTNMDNRLPLENGRFIAGTGCLVRAV
FT                   EMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGSTCSLKTILTLT
FT                   GVSSLEDVKSNQESDCMFKKKMVPDFYVDSIADLLPALQG"
FT   gene            1324051..1325974
FT                   /gene="9930021D14Rik"
FT                   /locus_tag="mCG_12852"
FT                   /note="gene_id=mCG12852.2"
FT   mRNA            join(1324051..1324492,1324624..1324743,1324910..1325065,
FT                   1325144..1325245,1325450..1325648,1325745..1325974)
FT                   /gene="9930021D14Rik"
FT                   /locus_tag="mCG_12852"
FT                   /product="RIKEN cDNA 9930021D14, transcript variant
FT                   mCT13720"
FT                   /note="gene_id=mCG12852.2 transcript_id=mCT13720.2 created
FT                   on 28-MAY-2002"
FT   mRNA            join(<1324388..1324743,1324910..1325065,1325144..1325245,
FT                   1325495..1325648,1325745..1325974)
FT                   /gene="9930021D14Rik"
FT                   /locus_tag="mCG_12852"
FT                   /product="RIKEN cDNA 9930021D14, transcript variant
FT                   mCT191655"
FT                   /note="gene_id=mCG12852.2 transcript_id=mCT191655.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(1324442..1324492,1324624..1324743,1324910..1325065,
FT                   1325144..1325245,1325450..1325648,1325745..1325839)
FT                   /codon_start=1
FT                   /gene="9930021D14Rik"
FT                   /locus_tag="mCG_12852"
FT                   /product="RIKEN cDNA 9930021D14, isoform CRA_a"
FT                   /note="gene_id=mCG12852.2 transcript_id=mCT13720.2
FT                   protein_id=mCP23205.2 isoform=CRA_a"
FT                   /protein_id="EDL22327.1"
FT                   /translation="MKQGRIHTESLRSKPAEVKTKPCHRGWRAAGLLLLLTLLTAGAVA
FT                   GGLLGFMYSSPKPLLQMLRKTFPSSRVPWPNQTTLVDVAQNMATIVVTPFQSNHSWAVL
FT                   FDGQNGYICYRPAEHQACFLRLMEAQDWETLQLLLNTSREQGSTIRWSTRVFLQAQESH
FT                   VPGRDTHYAQELLAVLGGHTVDPTQVGVSVQHLCADTPIYWTQWAEGPQRQRLIYLCID
FT                   ICFPSNICVSVCFYYLPD"
FT   CDS             join(<1324582..1324743,1324910..1325065,1325144..1325245,
FT                   1325495..1325648,1325745..1325839)
FT                   /codon_start=1
FT                   /gene="9930021D14Rik"
FT                   /locus_tag="mCG_12852"
FT                   /product="RIKEN cDNA 9930021D14, isoform CRA_b"
FT                   /note="gene_id=mCG12852.2 transcript_id=mCT191655.0
FT                   protein_id=mCP112631.0 isoform=CRA_b"
FT                   /protein_id="EDL22328.1"
FT                   /translation="VSKPEAPRPVLCPQVKTKPCHRGWRAAGLLLLLTLLTAGAVAGGL
FT                   LGFMYSSPKPLLQMLRKTFPSSRVPWPNQTTLVDVAQNMATIVVTPFQSNHSWAVLFDG
FT                   QNGYICYRPAEHQACFLRLMEAQDWETLQLLLNTSRAQESHVPGRDTHYAQELLAVLGG
FT                   HTVDPTQVGVSVQHLCADTPIYWTQWAEGPQRQRLIYLCIDICFPSNICVSVCFYYLPD
FT                   "
FT   gene            complement(1325807..>1329565)
FT                   /gene="Gbl"
FT                   /locus_tag="mCG_12821"
FT                   /note="gene_id=mCG12821.2"
FT   mRNA            complement(join(1325807..1326456,1326551..1326714,
FT                   1326830..1326954,1327686..1327838,1327935..1328010,
FT                   1328368..1328530,1328616..1328667,1328825..1328988,
FT                   1329517..1329544))
FT                   /gene="Gbl"
FT                   /locus_tag="mCG_12821"
FT                   /product="G protein beta subunit-like, transcript variant
FT                   mCT13689"
FT                   /note="gene_id=mCG12821.2 transcript_id=mCT13689.1 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(1326323..1326456,1326551..1326714,
FT                   1326830..1326954,1327686..1327838,1327935..1328010,
FT                   1328368..1328530,1328616..1328667,1328825..1328963,
FT                   1329517..1329535))
FT                   /gene="Gbl"
FT                   /locus_tag="mCG_12821"
FT                   /product="G protein beta subunit-like, transcript variant
FT                   mCT133393"
FT                   /note="gene_id=mCG12821.2 transcript_id=mCT133393.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(1326338..1326456,1326551..1326714,
FT                   1326830..1326954,1327686..1327838,1327935..1328010,
FT                   1328368..1328530,1328616..1328667,1328825..1328953))
FT                   /codon_start=1
FT                   /gene="Gbl"
FT                   /locus_tag="mCG_12821"
FT                   /product="G protein beta subunit-like, isoform CRA_a"
FT                   /note="gene_id=mCG12821.2 transcript_id=mCT133393.0
FT                   protein_id=mCP84725.1 isoform=CRA_a"
FT                   /protein_id="EDL22329.1"
FT                   /translation="MNTTPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQV
FT                   NALEITPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVSKNIASVGFHEDGRWMYTGG
FT                   EDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNE
FT                   QLIPEPESSITSAHIDPDASYMAAVNSAGNCYVWNLTGGIGDDVTQLIPKTKIPAHTRY
FT                   ALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGD
FT                   SQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG"
FT   CDS             complement(join(1326338..1326456,1326551..1326714,
FT                   1326830..1326954,1327686..1327838,1327935..1328010,
FT                   1328368..1328530,1328616..1328667,1328825..1328953))
FT                   /codon_start=1
FT                   /gene="Gbl"
FT                   /locus_tag="mCG_12821"
FT                   /product="G protein beta subunit-like, isoform CRA_a"
FT                   /note="gene_id=mCG12821.2 transcript_id=mCT13689.1
FT                   protein_id=mCP23147.2 isoform=CRA_a"
FT                   /protein_id="EDL22330.1"
FT                   /translation="MNTTPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQV
FT                   NALEITPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVSKNIASVGFHEDGRWMYTGG
FT                   EDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNE
FT                   QLIPEPESSITSAHIDPDASYMAAVNSAGNCYVWNLTGGIGDDVTQLIPKTKIPAHTRY
FT                   ALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGD
FT                   SQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG"
FT   mRNA            complement(join(<1326423..1326456,1326551..1326714,
FT                   1326830..1326954,1327686..1327838,1327935..1328010,
FT                   1328368..1328530,1329517..>1329565))
FT                   /gene="Gbl"
FT                   /locus_tag="mCG_12821"
FT                   /product="G protein beta subunit-like, transcript variant
FT                   mCT191706"
FT                   /note="gene_id=mCG12821.2 transcript_id=mCT191706.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<1326423..1326456,1326551..1326714,
FT                   1326830..1326954,1327686..1327838,1327935..1328010,
FT                   1328368..1328530,1329517..>1329517))
FT                   /codon_start=1
FT                   /gene="Gbl"
FT                   /locus_tag="mCG_12821"
FT                   /product="G protein beta subunit-like, isoform CRA_b"
FT                   /note="gene_id=mCG12821.2 transcript_id=mCT191706.0
FT                   protein_id=mCP112664.0 isoform=CRA_b"
FT                   /protein_id="EDL22331.1"
FT                   /translation="GYQHIRMYDLNSNNPNPIISYDGVSKNIASVGFHEDGRWMYTGGE
FT                   DCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQ
FT                   LIPEPESSITSAHIDPDASYMAAVNSAGNCYVWNLTGGIGDDVTQLIPKTKIPAHTRYA
FT                   LQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGDS
FT                   QYIVTASSDNLARLWCV"
FT   assembly_gap    1333385..1333586
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    1339071..1339249
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            1339250..>1357920
FT                   /gene="Caskin1"
FT                   /locus_tag="mCG_12844"
FT                   /note="gene_id=mCG12844.2"
FT   mRNA            join(1339250..1339613,1346570..1346621,1346724..1346830,
FT                   1347030..1347175,1347258..1347353,1347467..1347597,
FT                   1349556..1349697,1349759..1349867,1349951..1350045,
FT                   1350201..1350318,1351395..1351496,1351589..1351677,
FT                   1351758..1351842,1351927..1352030,1352815..1352925,
FT                   1353016..1353117,1354500..1354638,1354720..1356720,
FT                   1357362..1357641,1357821..>1357920)
FT                   /gene="Caskin1"
FT                   /locus_tag="mCG_12844"
FT                   /product="CASK interacting protein 1, transcript variant
FT                   mCT13712"
FT                   /note="gene_id=mCG12844.2 transcript_id=mCT13712.2 created
FT                   on 26-AUG-2002"
FT   mRNA            join(1339250..1339613,1346570..1346621,1346724..1346821,
FT                   1347030..1347175,1347258..1347353,1347467..1347597,
FT                   1349556..1349664,1349759..1349867,1349951..1350045,
FT                   1350201..1350975)
FT                   /gene="Caskin1"
FT                   /locus_tag="mCG_12844"
FT                   /product="CASK interacting protein 1, transcript variant
FT                   mCT169685"
FT                   /note="gene_id=mCG12844.2 transcript_id=mCT169685.0 created
FT                   on 26-AUG-2002"
FT   CDS             join(1339520..1339613,1346570..1346621,1346724..1346830,
FT                   1347030..1347175,1347258..1347353,1347467..1347597,
FT                   1349556..1349697,1349759..1349867,1349951..1350045,
FT                   1350201..1350318,1351395..1351496,1351589..1351677,
FT                   1351758..1351842,1351927..1352030,1352815..1352925,
FT                   1353016..1353117,1354500..1354638,1354720..1356720,
FT                   1357362..1357641,1357821..1357920)
FT                   /codon_start=1
FT                   /gene="Caskin1"
FT                   /locus_tag="mCG_12844"
FT                   /product="CASK interacting protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG12844.2 transcript_id=mCT13712.2
FT                   protein_id=mCP23163.2 isoform=CRA_a"
FT                   /protein_id="EDL22332.1"
FT                   /translation="MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQ
FT                   DPDGFSALHHAALNGNTELISLLLEAQAAVDIKDNKGKPGMRPLHYAAWQGRKEPMKLV
FT                   LKAGSAVNVPSDEGHIPLHLAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGR
FT                   VGVVQLLLSSNMCAALLEPRPGDTTDPNGTSPLHLAAKNGHIDIIRLLLQAGIDINRQT
FT                   KSGTALHEAALCGKTEVVRLLLDVSLVTQDTERKSGINAQVRNTYSQTALDIVHQFTTS
FT                   QASKEIKQLLREASAALQVRATKDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKGCIHD
FT                   NRTGNDRVGYFPSSLGEAIVKRAGSRTGSEPSPPQGGGSLGPSAPPEEIWVLRKPFAGG
FT                   DRSGSLSNVAGGRSTGGHALHAGSEGVKLLATVLSQKSVSESSPGDSPVKPPEGSSGAA
FT                   RSQPPAAHAGQVYGEQPPKKLESASASASEGKSAEAVSQWLATFQLQLYAPNFTSAGYD
FT                   LPTISRMTPEDLTAIGVTKPGHRKKITAEISGLNIPDWLPEHKPANLAVWLSMIGLAQY
FT                   YKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYSKYEGGP
FT                   LRRKTPQSLEMMAIESPPPSEPAAAECQSPKMTTFQDSELSGELQAALSGPAEAGAAAV
FT                   EKSSNHLPPTPRTTSRESSLSGRARHISSSQELLGDGPPGPGSPMSRSQEYLLDEGMAP
FT                   GTPPKEVRSSRHGHSVKRASVPPVPGKPRQVLPSGASHFTPPQTPTKAQPGSPQALGGP
FT                   HGPATAKVKPTPQLLPPTDRPMSPRSLPQSPTHRGFAYVLPQPVEGEVGPPAPGPAPPP
FT                   VPAAVPTLCLPPETDVEPGRPKKRAHSLNRYAASDSEPERDELLVPAAAGPYATVQRRV
FT                   GRSHSVRAPAGTDKNVNRSQSFAVRPRKKGPPPPPPKRSSSAMASANLADEPAPDVEAE
FT                   DGRLGVRAQRRRASDLAGSVDTGSAGSVKSIAAMLELSSIGGGGRAIRRPPEGHPTPRP
FT                   ASPEPGRVATVLASVKHKEAIGPDGEVVNRRRTLSGPVTGLLATARRGSGEPAEQSHFM
FT                   EDGTARQRLRGPAKGEASAEGPPLARVEASATLKRRIRAKQSQQENVKFILTESDTVKR
FT                   RPKAKEPDTGPEPPPPLSVYQNGTATVRRRPTSEQAGPPELPPPPPPAEPPPADLMQLP
FT                   PLPLPDGNARKPVKPPVSPKPILAQPVSKIQGSPTPASKKVPLPGPGSPARQPPAALIK
FT                   PASSPPSQSASPVKPPSPGTPALHVPAKPPRAAASVVSGPPVASDCASPGDSARQKLEE
FT                   TSACLAAALQAVEEKIRQEDGQGPRPSSIEEKSTGSILEDIGSMFDDLADQLDAMLE"
FT   CDS             join(1339520..1339613,1346570..1346621,1346724..1346821,
FT                   1347030..1347175,1347258..1347353,1347467..1347597,
FT                   1349556..1349664,1349759..1349867,1349951..1350045,
FT                   1350201..1350368)
FT                   /codon_start=1
FT                   /gene="Caskin1"
FT                   /locus_tag="mCG_12844"
FT                   /product="CASK interacting protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG12844.2 transcript_id=mCT169685.0
FT                   protein_id=mCP92684.0 isoform=CRA_b"
FT                   /protein_id="EDL22333.1"
FT                   /translation="MGKEQELVQAVKAEDVGTAQRLLQRPRPGKAKLLGSTKKINVNFQ
FT                   DPDGFSALHHAALNGNTELISLLLEAQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKA
FT                   GSAVNVPSDEGHIPLHLAAQHGHYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGV
FT                   VQLLLSSNMCAALLEPRPGDTTDPNGTSPLHLAAKNGHIDIIRLLLQAGIDINRQTKSG
FT                   TALHEAALCGKTEVVRLLLDSGINAQVRNTYSQTALDIVHQFTTSQASKEIKQLLREAS
FT                   AALQVRATKDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKGCIHDNRTGNDRVGYFPSS
FT                   LGEAIVKRAGKSTPLWREASRGHSA"
FT   assembly_gap    1342782..1343836
FT                   /estimated_length=1055
FT                   /gap_type="unknown"
FT   gene            complement(1359554..1378749)
FT                   /gene="Traf7"
FT                   /locus_tag="mCG_12855"
FT                   /note="gene_id=mCG12855.3"
FT   mRNA            complement(join(1359554..1360062,1360236..1360355,
FT                   1360440..1360571,1360660..1360779,1360953..1361075,
FT                   1361160..1361276,1361363..1361402,1362018..1362100,
FT                   1362275..1362402,1362479..1362527,1362716..1362789,
FT                   1362872..1363089,1363679..1363807,1363916..1364099,
FT                   1364622..1364655,1364848..1364940,1367233..1367327,
FT                   1369473..1369530,1369862..1369977,1378667..>1378748))
FT                   /gene="Traf7"
FT                   /locus_tag="mCG_12855"
FT                   /product="Tnf receptor-associated factor 7, transcript
FT                   variant mCT191666"
FT                   /note="gene_id=mCG12855.3 transcript_id=mCT191666.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1359554..1360062,1360236..1360355,
FT                   1360440..1360571,1360660..1360779,1360953..1361075,
FT                   1361160..1361276,1361363..1361402,1362018..1362100,
FT                   1362275..1362402,1362479..1362527,1362716..1362789,
FT                   1362872..1363089,1363673..1363807,1363916..1364099,
FT                   1364622..1364655,1364848..1364940,1365437..1365553,
FT                   1367233..1367327,1369473..1369530,1369845..1369977,
FT                   1378667..>1378736))
FT                   /gene="Traf7"
FT                   /locus_tag="mCG_12855"
FT                   /product="Tnf receptor-associated factor 7, transcript
FT                   variant mCT191667"
FT                   /note="gene_id=mCG12855.3 transcript_id=mCT191667.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1359576..1360062,1360235..1360355,
FT                   1360440..1360571,1360660..1360779,1360953..1361075,
FT                   1361160..1361276,1361348..1361402,1362018..1362100,
FT                   1362275..1362402,1362479..1362527,1362716..1362789,
FT                   1362872..1363089,1363673..1363807,1363916..1364099,
FT                   1364622..1364655,1364848..1364940,1365437..1365553,
FT                   1367233..1367360,1369473..1369530,1369862..1369977,
FT                   1378667..1378749))
FT                   /gene="Traf7"
FT                   /locus_tag="mCG_12855"
FT                   /product="Tnf receptor-associated factor 7, transcript
FT                   variant mCT13723"
FT                   /note="gene_id=mCG12855.3 transcript_id=mCT13723.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1359959..1360062,1360235..1360355,
FT                   1360440..1360571,1360660..1360779,1360953..1361075,
FT                   1361160..1361276,1361348..1361402,1362018..1362100,
FT                   1362275..1362402,1362479..1362527,1362716..1362789,
FT                   1362872..1363089,1363673..1363807,1363916..1364099,
FT                   1364622..1364655,1364848..1364940,1365437..1365553,
FT                   1367233..1367360,1369473..1369530,1369862..1369939))
FT                   /codon_start=1
FT                   /gene="Traf7"
FT                   /locus_tag="mCG_12855"
FT                   /product="Tnf receptor-associated factor 7, isoform CRA_a"
FT                   /note="gene_id=mCG12855.3 transcript_id=mCT13723.2
FT                   protein_id=mCP23271.2 isoform=CRA_a"
FT                   /protein_id="EDL22334.1"
FT                   /translation="MSSAKSARYDRFSGGPANLPSSDSSGTRMETTFGPTFSTVTTITK
FT                   ASSSTDSHVFSAADGTGTYKQHRRTPSSSSTLAYSPRDEEDGMPPINTPRRSDSAISVR
FT                   SLHSESSMSLRSTFSLPEEEEEPEPLVFAEQPSVKLCCQLCCSVFKDPVITTCGHTFCR
FT                   RCALKSEKCPVDNAKLTVVVNNIAVAEQIGELFIHCRHGCHAAGTGKPGVFEVDPRGCP
FT                   FTIKLSARKDHESSCDYRPVRCPNNPSCPPLLKMNLEAHLKECEHIKCPHSKYGCTFIG
FT                   NQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQL
FT                   EKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKC
FT                   KGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYKCQKTLEGHDGIVLALCI
FT                   QGCKLYSGSADCTIIVSGHRVWDIQNLQKVNTIRAHDNPVCTLVSSHNMLFSGSLKAIK
FT                   VWDIVGTELKLKKELTGLNHWVRALVAAQSYLYSGSYQTIKIWDIRTLDCIHVLQTSGG
FT                   SVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVGTVYALAVISTPDQTKVFSA
FT                   SYDRSLRVWSMDNMICTQTLLRHQGSVTALAVSRGRLFSGAVDSTVKGLDMLTESRPGL
FT                   APSGSVSQAGPPLECLPVCGDR"
FT   CDS             complement(join(1360048..1360062,1360236..1360355,
FT                   1360440..1360571,1360660..1360779,1360953..1361075,
FT                   1361160..1361276,1361363..1361402,1362018..1362100,
FT                   1362275..1362402,1362479..1362527,1362716..1362789,
FT                   1362872..1363089,1363679..1363807,1363916..1364099,
FT                   1364622..1364655,1364848..1364940,1367233..1367327,
FT                   1369473..1369530,1369862..>1369942))
FT                   /codon_start=1
FT                   /gene="Traf7"
FT                   /locus_tag="mCG_12855"
FT                   /product="Tnf receptor-associated factor 7, isoform CRA_b"
FT                   /note="gene_id=mCG12855.3 transcript_id=mCT191666.0
FT                   protein_id=mCP112637.0 isoform=CRA_b"
FT                   /protein_id="EDL22335.1"
FT                   /translation="SMSSAKSARYDRFSGGPANLPSSDSSGTRMETTFGPTFSTVTTIT
FT                   KAADGTGTYKQHRRTPSSSSTLAYSPRDEEDGMEPLVFAEQPSVKLCCQLCCSVFKDPV
FT                   ITTCGHTFCRRCALKSEKCPVDNAKLTVVVNNIAVAEQIGELFIHCRHGCHAAGTGKPG
FT                   VFEVDPRGCPFTIKLSARKDHESSCDYRPVRCPNNPSCPPLLKMNLEAHLKECEHIKCP
FT                   HSKCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGK
FT                   LSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSY
FT                   DPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYKCQKTLEGHD
FT                   GIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHDNPVCTLVSSHNMLFSGSLK
FT                   AIKVWDIVGTELKLKKELTGLNHWVRALVAAQSYLYSGSYQTIKIWDIRTLDCIHVLQT
FT                   SGGSVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVGTVYALAVISTPDQTKV
FT                   FSASYDRSLRVWSMDNMICTQTLLRHQGSVTALAVSRGRLFSGAVDSTVKVWTC"
FT   CDS             complement(join(1360048..1360062,1360236..1360355,
FT                   1360440..1360571,1360660..1360779,1360953..1361075,
FT                   1361160..1361276,1361363..1361402,1362018..1362100,
FT                   1362275..1362402,1362479..1362527,1362716..1362789,
FT                   1362872..1363089,1363673..1363807,1363916..1364099,
FT                   1364622..1364655,1364848..1364940,1365437..1365553,
FT                   1367233..1367327,1369473..>1369530))
FT                   /codon_start=1
FT                   /gene="Traf7"
FT                   /locus_tag="mCG_12855"
FT                   /product="Tnf receptor-associated factor 7, isoform CRA_c"
FT                   /note="gene_id=mCG12855.3 transcript_id=mCT191667.0
FT                   protein_id=mCP112638.0 isoform=CRA_c"
FT                   /protein_id="EDL22336.1"
FT                   /translation="TRMETTFGPTFSTVTTITKAADGTGTYKQHRRTPSSSSTLAYSPR
FT                   DEEDGMPPINTPRRSDSAISVRSLHSESSMSLRSTFSLPEEEEEPEPLVFAEQPSVKLC
FT                   CQLCCSVFKDPVITTCGHTFCRRCALKSEKCPVDNAKLTVVVNNIAVAEQIGELFIHCR
FT                   HGCHAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRPVRCPNNPSCPPLLKMNLE
FT                   AHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQ
FT                   KDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELS
FT                   HINARLNMGILGSYDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDT
FT                   CTTYKCQKTLEGHDGIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHDNPVCT
FT                   LVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAAQSYLYSGSYQTIKI
FT                   WDIRTLDCIHVLQTSGGSVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVGTV
FT                   YALAVISTPDQTKVFSASYDRSLRVWSMDNMICTQTLLRHQGSVTALAVSRGRLFSGAV
FT                   DSTVKVWTC"
FT   assembly_gap    1363287..1363346
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            1379150..1379648
FT                   /locus_tag="mCG_147764"
FT                   /note="gene_id=mCG147764.0"
FT   mRNA            join(1379150..1379337,1379541..1379648)
FT                   /locus_tag="mCG_147764"
FT                   /product="mCG147764"
FT                   /note="gene_id=mCG147764.0 transcript_id=mCT188027.0
FT                   created on 13-JAN-2004"
FT   CDS             join(1379229..1379337,1379541..1379596)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147764"
FT                   /product="mCG147764"
FT                   /note="gene_id=mCG147764.0 transcript_id=mCT188027.0
FT                   protein_id=mCP108941.0"
FT                   /protein_id="EDL22337.1"
FT                   /translation="MELKGPLLQICLPPELKCFSPKGLTLPHFSSDSIFAGHVESAASR
FT                   DPTSRSVGW"
FT   gene            complement(1379995..>1384647)
FT                   /locus_tag="mCG_12848"
FT                   /note="gene_id=mCG12848.3"
FT   mRNA            complement(join(1379995..1380586,1380684..1380760,
FT                   1380857..1380913,1380998..1381063,1381334..1381386,
FT                   1381586..1381652,1381727..1381768,1383154..1383264,
FT                   1384312..1384573))
FT                   /locus_tag="mCG_12848"
FT                   /product="mCG12848, transcript variant mCT13716"
FT                   /note="gene_id=mCG12848.3 transcript_id=mCT13716.2 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1380006..1380586,1380684..1380760,
FT                   1380857..1380913,1380998..1381386,1381586..1381652,
FT                   1381727..1381768,1383154..1383264,1384312..>1384647))
FT                   /locus_tag="mCG_12848"
FT                   /product="mCG12848, transcript variant mCT191725"
FT                   /note="gene_id=mCG12848.3 transcript_id=mCT191725.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1380484..1380586,1380684..1380760,
FT                   1380857..1380913,1380998..1381063,1381334..1381386,
FT                   1381586..1381652,1381727..1381768,1383154..1383264,
FT                   1384312..1384518))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12848"
FT                   /product="mCG12848, isoform CRA_a"
FT                   /note="gene_id=mCG12848.3 transcript_id=mCT13716.2
FT                   protein_id=mCP23191.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q148R0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2443284"
FT                   /db_xref="UniProtKB/TrEMBL:Q148R0"
FT                   /protein_id="EDL22338.1"
FT                   /translation="MSRKKTPKSKGGSEPATSTLPAAAAATNGPRLAHPRTVRPGPEAP
FT                   PNGPPQSIRPSLGSTGDFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGID
FT                   FRNKVLDVDGMKVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDITNKDSFDNIQAWL
FT                   TEIQEYAQQDVVLMLLGNKVDSTQDRVVKREDGEKLAKEYGLPFMETSARTGLNVDLAF
FT                   TAIAKELKQRSAKAPSEPRFRLHDYVKREGRGVSCCRL"
FT   CDS             complement(join(1381262..1381386,1381586..1381652,
FT                   1381727..1381768,1383154..1383264,1384312..>1384647))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12848"
FT                   /product="mCG12848, isoform CRA_b"
FT                   /note="gene_id=mCG12848.3 transcript_id=mCT191725.0
FT                   protein_id=mCP112669.0 isoform=CRA_b"
FT                   /protein_id="EDL22339.1"
FT                   /translation="GDAAATAAAAAAAGRVRVRVGLGGHGAWDNPGHGGSSRSTLRTMS
FT                   RKKTPKSKGGSEPATSTLPAAAAATNGPRLAHPRTVRPGPEAPPNGPPQSIRPSLGSTG
FT                   DFYDVAFKVMLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGMKVKLQ
FT                   IWDTAGQERFRSVTHAYYRDAHALLLLYDITNKDSFDNIQVSGLGGGMNQDCLNGIRSP
FT                   SPVT"
FT   assembly_gap    1392234..1392253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1402164..1449207
FT                   /gene="Pkd1"
FT                   /locus_tag="mCG_12835"
FT                   /note="gene_id=mCG12835.1"
FT   mRNA            join(1402164..1402693,1416699..1416770,1416885..1416956,
FT                   1417128..1417297,1417560..1418231,1418336..1418519,
FT                   1419676..1419893,1420146..1420261,1420762..1420888,
FT                   1421175..1421410,1421900..1422652,1423730..1423861,
FT                   1424071..1424246,1424526..1424659,1425168..1428793,
FT                   1428988..1429137,1430069..1430212,1430300..1430579,
FT                   1430646..1430859,1430929..1431088,1431361..1431510,
FT                   1432271..1432415,1432505..1433125,1433425..1433581,
FT                   1433741..1433993,1434113..1434308,1438430..1438600,
FT                   1438676..1438819,1438917..1439127,1439215..1439341,
FT                   1439932..1440045,1440153..1440202,1440407..1440591,
FT                   1440685..1440778,1443535..1443653,1443731..1443933,
FT                   1444003..1444197,1444554..1444693,1445327..1445439,
FT                   1445921..1446062,1446192..1446317,1446523..1446697,
FT                   1446812..1447102,1447185..1447319,1447396..1447701,
FT                   1447796..1449207)
FT                   /gene="Pkd1"
FT                   /locus_tag="mCG_12835"
FT                   /product="polycystic kidney disease 1 homolog"
FT                   /note="gene_id=mCG12835.1 transcript_id=mCT13702.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(1402479..1402693,1416699..1416770,1416885..1416956,
FT                   1417128..1417297,1417560..1418231,1418336..1418519,
FT                   1419676..1419893,1420146..1420261,1420762..1420888,
FT                   1421175..1421410,1421900..1422652,1423730..1423861,
FT                   1424071..1424246,1424526..1424659,1425168..1428793,
FT                   1428988..1429137,1430069..1430212,1430300..1430579,
FT                   1430646..1430859,1430929..1431088,1431361..1431510,
FT                   1432271..1432415,1432505..1433125,1433425..1433581,
FT                   1433741..1433993,1434113..1434308,1438430..1438600,
FT                   1438676..1438819,1438917..1439127,1439215..1439341,
FT                   1439932..1440045,1440153..1440202,1440407..1440591,
FT                   1440685..1440778,1443535..1443653,1443731..1443933,
FT                   1444003..1444197,1444554..1444693,1445327..1445439,
FT                   1445921..1446062,1446192..1446317,1446523..1446697,
FT                   1446812..1447102,1447185..1447319,1447396..1447701,
FT                   1447796..1448263)
FT                   /codon_start=1
FT                   /gene="Pkd1"
FT                   /locus_tag="mCG_12835"
FT                   /product="polycystic kidney disease 1 homolog"
FT                   /note="gene_id=mCG12835.1 transcript_id=mCT13702.1
FT                   protein_id=mCP23174.2"
FT                   /protein_id="EDL22340.1"
FT                   /translation="MPPGAPALLALALGLGLWLGALAGDPGRGCGPCPLPCFCGPAPDA
FT                   ACRVNCSGRWLQTLGPSLRIPADATALDLSHNLLQTLDIGLLVNLSALVELDLSNNRIS
FT                   TLEEGVFANLFNLSEINLSGNPFECNCGLAWLPRWAKEHQVHVVQSEATTCRGPIPLAG
FT                   QPLLSIPLLDNACGEEYVACLPDNSSGAVAAVPFYFAHEGPLETEACSAFCFSAGEGLA
FT                   ALSEQNQCLCGAGQASNSSAACSSWCSSISLSLNSACGGPTLLQHTFPASPGATLVGPH
FT                   GPLASGQPADFHITSSLPISSTRWNFGDGSPEVDMASPAATHFYVLPGSYHMTVVLALG
FT                   AGSALLETEVQVEATPTVLELVCPSFVHSNESLELGIRHRGGSALEVTYSILALDKEPA
FT                   QVVHPLCPLDTEIFPGNGHCYRLVAEKAPWLQAQEQCRTWAGAALAMVDSPAIQHFLVS
FT                   KVTRSLDVWIGFSSVEGTEGLDPRGEAFSLESCQNWLPGEPHPATAEHCVRLGPAGQCN
FT                   TDLCSAPHSYVCELRPGGPVWDTENFVMGMSGGGLSGPLHPLAQQETVQGPLRPVEVMV
FT                   FPGLSPSREAFLTAAEFSTQKLEEPAQMRLQVYRPSGGAAAVPEGSSEPDNRTEPAPKC
FT                   VPEELWCPGANVCIPFDASCNSHVCINGSVSRLGLSRASYTLWKEFFFSVPAGPPTQYL
FT                   VTLHSQDVPMLPGDLIGLQHDAGPGTLLQCPLASSCPGQALYLSTNASDWMTNLPVHLE
FT                   EAWAGPVCSLQLLLVTEQLTPLLGLGPNPGLQHPGHYEVRATVGNSVSRQNLSCSFSVV
FT                   SPIAGLRVIHPIPLDGHIYVPTNGSVLVLQVDSGANATATAQWFGGNISAPFEDACPPD
FT                   VDFLKQDCTEEANGTLFSVLMLPRLKEGDHTVEIVAQNGASQANLSLRVTAEEPICGLR
FT                   AVPSPEARVLQGILVRYSPMVEAGSDVAFRWTIDDKQSLTFHNTVFNVIYQSAAVFKLS
FT                   LTASNHVSNITVNYNVTVERMNKMHGLWVSAVPTVLPPNATLALTGGVLVDSAVEVAFL
FT                   WNFGDGEQVLRQFKPPYDESFQVPDPTVAQVLVEHNTTHIYTTPGEYNLTVLVSNTYEN
FT                   LTQQVTVSVRTVLPNVAIGMSSNVLVAGQPITFSPYPLPSTDGVLYTWDFGDGSPVLIQ
FT                   SQPVLNHTYSMTGTYRITLEVNNTVSSVTAHADIRVFQELHGLTVYLSPSVEQGAPMVV
FT                   SASVESGDNITWTFDMGDGTVFTGPEATVQHVYLRAQNFTVTVEAANPAGHLSQSLHVQ
FT                   VFVLEVLHIEPSTCIPTQPSAQLMAHVTGDPVHYLFDWTFGDGSSNVTVHGHPSVTHNF
FT                   TRSGIFPLALVLSSHVNKAHYFTSICVEPEIRNITLQPERQFVKLGDEARLVAYSWPPF
FT                   PYRYTWDFGTEDTTHTQTGGSEVKFIYREPGSYLVIVTVSNNISSTNDSAFVEVQEPVL
FT                   VTGIRINGSHVLELQQPYLLSAMGSGSPATYLWELGDGSQSEGPEVTHIYSSTGDFTVR
FT                   VSGWNEVSRSEAQLNITVKQRVRGLTINASRTVVPLNGSVSFSTLLEVGSDVHYSWVLC
FT                   DRCTPIPGGPTISYTFRSVGTFNIIVTAENEVGSAQDSIFIYVLQFIEGLQVAGGDNGC
FT                   CFPTNYTLQLQAAVRDGTNISYSWTAQQEGSLITLFGSGKCFSLTSLKASTYYVHLRAT
FT                   NMLGSAAANRTIDFVEPVESLILSASPNPAAVNMSLTLCAELAGGSGVVYTWYLEEGLS
FT                   WKTSMPSTTHTFATPGLHLVRVTAENQLGSVNATVEVAIQVPVGGLSIRTSEPDSIFVA
FT                   AGSTLPFWGQLAEGTNVTWCWTLPGGSKDSQYIAVRFSTAGSFSLQLNASNAVSWVSAM
FT                   YNLTVEEPIVNLMLWASSKVVAPGQPVHFEILLAAGSALTFRLQVGGSVPEVLPSPHFS
FT                   HSFFRVGDHLVNVQAENHVSHAQAQVRILVLEAVVGLQVPNCCEPGMATGTEKNFTARV
FT                   QRGSRVAYAWYFSLQKVQGDSLVILSGRDVTYTPVAAGLLEIHVRAFNELGGVNLTLMV
FT                   EVQDIIQYVTLQSGRCFTNRSARFEAATSPSPRCVTYHWDFGDGTPVQKTEEFWADHYY
FT                   LRPGDYHVEVNATNLVSFFVAQATVTVQVLACREPEVEVALPLQVLMRRSQRNYLEAHV
FT                   DLRNCVSYQTEYRWEIYRTASCQRPGRMAQMVLPGVDVSRPQLVVPRLALPVGHYCFVF
FT                   VVSFGDTPLARSIQANVTVAAERLVPIIEGGSYRVWSDTQDLVLDGSKSYDPNLEDGDQ
FT                   TPLNFHWACVASTQSETGGCVLNFGPRGSSVVTIPLERLEAGVEYTFNLIVWKAGRKEE
FT                   ATNQTVLIRSGRVPIVSLECVSCKAQAVYEVSRSSYVYLEGHCHNCSRGYKQGCWAART
FT                   FSNKTLVLNETTTSTGSTGMNLVVRPGALRDGEGYIFTLTVLGHSGEEEGCASIRLSPN
FT                   RPPLGGSCRLFPLDSVRGLTTKVHFECTGWRDAEDGGAPLVYALLLKRCRQSYCENFCI
FT                   YKGSLSTYGAVLPPGFQPLFVVSLAVVVQDQLGAAVVALNRSLTIVLPEPSGNPADLVP
FT                   WLHSLTASVLPGLLKQADPQHVIEYSLALITVLNEYEQAPDVSEPNVEQQLRAQMRKNI
FT                   TETLISLRVNTVDDIQQITAALAQCMVSSRELMCRSCLKKMLQKLEGMMRILQAETTEG
FT                   TLTPTTIADSILNITGDLIHLASLDMQGPQPLELGVEPPSLMVASKAYNLSSALMRILM
FT                   RSRVLNEEPLTLAGEEIVALGKRSDPLSLLCYGKALGPSCHFSIPEAFSGALSNLSDVV
FT                   QLIFLVDSNPFPFGYISNYTVSTKVASMAFQTQTGTQIPIEQLAAERAITVKVPNNSDQ
FT                   AAQSSHNPVGSTIVQPQTSVSAVVTADNSNPQAGLHLRITYTVLNERYLSAEPEPYLAV
FT                   YLHSVSQPNEYNCSASRRISLEVLEGADHRLYTFFIAPGTGTLDRSYYLNLTSHFHWSA
FT                   LEVSVGLYTSLCQYFSEEMMMWRTEGIVPLEETSPSQAVCLTRHLTAFGASLFVPPSHV
FT                   QFIFPEPSASINYIVLLTCVICLVTYVVMAMILRKLDQLDVSRVRVIPFCGKGGRFKYE
FT                   ILVKTGWSRGSGTTAHVGIMLYGEDNRSGHRHLDGDRAFHRNSLDIFQIATPHSLGSVW
FT                   KIRVWHDNKGLSPAWFLQHIIVRDLQSARSTFFLVNDWLSVETEANGGLVEKEVLAANE
FT                   AALWQFQRLLVAELQRGFFDKHIWLSIWDRPPRSRFTRVQRVTCCVLLLCLFLAANAVW
FT                   YGVVRDTTYSMGPVSSLISPGVDTVAIGLVSSVVVYPVYLAVLFLFRMSRSKVSGDQNP
FT                   TPTGQQALDVDSYLDPSVLDSSLLTLSGLTEAFAGQVKNDLFLEDAKSLVCWPSSEGTL
FT                   SWPDLLSDPSVVSSTLQRLTQGRPGCMLGSEEDGASLVSPSLPAKYLSASDEDLIHQVL
FT                   ADGANNLVPTQDTLLETDLLTSLSSVPGEKTETLILQTVGEERPASMGLSWEQSPVTRL
FT                   SRTGLVEGFQKRLLPAWCAPLAHGLSLLLVAVAVAVSGWIGASFPPSVSVMWLLSSSSS
FT                   FLASFLGWEPLKVLLEALYFSLVAKRLHPDEDDTLVESPAVTPVSERVPRVRPPHGFAL
FT                   FLAKEEARKVKRLHDMLKRLLVYMLFLLVTLLANYGDASCHGHAYRLQSAIKQELDSQA
FT                   FLAITRSDEFWPWMSHVFLPYVHGNQSSPELGPPRLRQVRLQEAFCPDPSSSEHMCSAA
FT                   GSLSTSDYGIGWQSVVQNGSETWAYSAPDLLGAWYWGYCAVYDSGGYIQELGLSLEESR
FT                   ARLGFLQLHNWLDSRSRAVFVELTRYSPAVGLHAAVTLRLEFPVAGHALAAFSVRPFAL
FT                   RRLSTGLSLPLLTSVCLLLFALYFSMAEVQTWRKDGCACTARPDTWARCLLVILTAATG
FT                   LVRLAQLGIADRQWTHFVQDHPHHFTSFDQVAQLGSVARGLAASLLFLLLVKAAQQLRF
FT                   VRQWSVFGKTLCRALPELMGATLGLVLLGVAYAQMAILLISSGADTLYNMARAFLVLCP
FT                   GARVPTLCPSESWYLSPLLCVGLWALRVWGALRLGAILLRWRYHALRGELYRPAWEPQD
FT                   YEMVELFLRRLRLWMGFSKVKEFRHKVRFEGMDPLPSRSSRGSKSSPVVLPPSSGSEAS
FT                   HPSTSSSQPDGPSASLSRSTLKLEPEPSRLHAVFESLLVQFDRLNQATEDVYQLEQQLQ
FT                   SLRGHGHNGPPSSPSPGCFPGSQPALPSRLSRASQGLDQTVGPNRVSLWPNNKVHPSST
FT                   "
FT   assembly_gap    1442808..1442893
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            complement(1449213..1489755)
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /note="gene_id=mCG12837.2"
FT   mRNA            complement(join(1449213..1449490,1449579..1449677,
FT                   1449770..1449861,1449929..1450007,1450637..1450776,
FT                   1450916..1451102,1451762..1451848,1452017..1452092,
FT                   1452294..1452784,1453072..1453202,1454126..1454194,
FT                   1454831..1455034,1455823..1456035,1457043..1457155,
FT                   1457243..1457395,1457565..1457729,1458954..1459082,
FT                   1460167..1460261,1460429..1460531,1460826..1460919,
FT                   1461697..1461886,1463142..1463276,1464018..1464140,
FT                   1465184..1465334,1465516..1465622,1466309..1466431,
FT                   1469606..1469722,1470155..1470310,1471487..1471568,
FT                   1471797..1471900,1472340..1472477,1473240..1473383,
FT                   1474203..1474329,1476849..1476922,1477827..1477952,
FT                   1478268..1478316,1479582..1479699,1486097..1486241,
FT                   1487024..1487134,1488068..1488154,1489075..1489241,
FT                   1489668..1489755))
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, transcript variant
FT                   mCT169684"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT169684.0 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1449238..1449490,1449579..1449677,
FT                   1449770..1449861,1449929..1450007,1450637..1450776,
FT                   1450916..1451102,1451762..1451848,1452017..1452092,
FT                   1452294..1452784,1453072..1453202,1454831..1455034,
FT                   1455823..1456035,1457043..1457155,1457243..1457395,
FT                   1457565..1457729,1458954..1459082,1460167..1460261,
FT                   1460429..1460531,1460826..1460919,1461697..1461886,
FT                   1463142..1463276,1464018..1464140,1465184..1465334,
FT                   1465516..1465622,1466309..1466431,1469606..1469722,
FT                   1470155..1470310,1471487..1471568,1471797..1471900,
FT                   1472340..1472477,1473240..1473383,1474203..1474329,
FT                   1476849..1476922,1483401..1483526,1483850..1483898,
FT                   1485146..1485260,1486097..1486241,1487024..1487134,
FT                   1488068..1488154,1489075..>1489246))
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, transcript variant
FT                   mCT191658"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT191658.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1449245..1449490,1449579..1449677,
FT                   1449770..1449861,1449929..1450007,1450637..1450776,
FT                   1450916..1451102,1451762..1451848,1452017..1452092,
FT                   1452294..1452784,1453072..1453202,1454831..1455034,
FT                   1455823..1456035,1457043..1457155,1457243..1457395,
FT                   1457565..1457729,1460167..1460261,1460429..1460531,
FT                   1460826..1460919,1461697..1461886,1463142..1463276,
FT                   1464018..1464140,1465184..1465334,1465516..1465622,
FT                   1466309..1466431,1469606..1469722,1470155..1470310,
FT                   1471487..1471568,1471797..1471900,1472340..1472477,
FT                   1473240..1473383,1474203..1474329,1482423..1482496,
FT                   1483401..1483526,1483850..1483898,1485146..1485263,
FT                   1486097..1486241,1487024..1487134,1488068..1488154,
FT                   1489075..1489236,1489668..>1489738))
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, transcript variant
FT                   mCT191659"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT191659.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1449245..1449490,1449579..1449787,
FT                   1449929..1450007,1450637..1450776,1450916..1451102,
FT                   1451762..1451848,1452017..1452092,1452294..1452784,
FT                   1453072..1453202,1454126..1454194,1454831..1455034,
FT                   1455823..1456035,1457043..1457155,1457243..1457395,
FT                   1457565..1457729,1458954..1459082,1460167..1460261,
FT                   1460429..1460531,1460826..1460919,1461697..1461886,
FT                   1463142..1463276,1464018..1464140,1465184..1465334,
FT                   1465516..1465622,1466309..1466431,1469606..1469722,
FT                   1470155..1470310,1471487..1471568,1471797..1471900,
FT                   1472340..1472477,1473240..1473383,1474203..1474329,
FT                   1476849..1476922,1483401..1483526,1483850..1483898,
FT                   1485146..1485263,1486097..1486241,1487024..1487134,
FT                   1488068..1488154,1489075..1489241,1489668..1489728))
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, transcript variant
FT                   mCT13705"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT13705.2 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1449245..1449490,1449579..1449787,
FT                   1449929..1450007,1450633..1450776,1450916..1451102,
FT                   1451762..1451848,1452017..1452092,1452294..1452784,
FT                   1453072..1453202,1454126..1454194,1454831..1455034,
FT                   1455823..1456035,1457043..1457155,1457243..1457395,
FT                   1457565..1457729,1458954..1459082,1460167..1460261,
FT                   1460429..1460531,1460826..1460919,1461697..1461886,
FT                   1463142..1463276,1464018..1464140,1465184..1465334,
FT                   1465516..1465622,1466309..1466431,1469606..1469722,
FT                   1470155..1470310,1471487..1471568,1471797..1471900,
FT                   1472340..1472477,1473240..1473383,1474203..1474329,
FT                   1476849..1476922,1483401..1483526,1483850..1483898,
FT                   1485146..1485263,1486097..1486241,1487024..1487134,
FT                   1488068..1488154,1489075..1489241,1489668..>1489728))
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, transcript variant
FT                   mCT191657"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT191657.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1449329..1449490,1449579..1449677,
FT                   1449770..1449861,1449929..1450007,1450637..1450776,
FT                   1450916..1451102,1451762..1451848,1452017..1452092,
FT                   1452294..1452784,1453072..1453202,1454831..1455034,
FT                   1455823..1456035,1457043..1457155,1457243..1457395,
FT                   1457565..1457729,1460167..1460261,1460429..1460531,
FT                   1460826..1460919,1461697..1461886,1463142..1463276,
FT                   1464018..1464140,1465184..1465334,1465516..1465622,
FT                   1466309..1466431,1469606..1469722,1470155..1470310,
FT                   1471487..1471568,1471797..1471900,1472340..1472477,
FT                   1473240..1473383,1474203..1474329,1482423..1482496,
FT                   1483401..1483526,1483850..1483898,1485146..1485263,
FT                   1486097..1486241,1487024..1487134,1488068..1488154,
FT                   1489075..1489236,1489668..>1489736))
FT                   /codon_start=1
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, isoform CRA_d"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT191659.0
FT                   protein_id=mCP112628.0 isoform=CRA_d"
FT                   /protein_id="EDL22344.1"
FT                   /translation="CPGSGVCALPWVQEDLRAKGARGFSSTALPTMAKPTSKDSGLKEK
FT                   FKILLGLGTSRPNPRCAEGKQTEFIITSEILRELSGECGLNNRIRMIGQICDVAKTKKL
FT                   EEHAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQGDRLGVLRALFFKVIKDYPS
FT                   NEDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLSSEFLLVLVNLVKFNSCYL
FT                   DEYIASMVHMICLLCIRTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFIITLCRTINVK
FT                   ELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRSYMEDAPLLRGAVFFVGMALWGAHRL
FT                   YSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDILLDIIERL
FT                   LQQLQNLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRPESSLLNLI
FT                   SYRAQSIHPAKDGWIQNLQLLMERFFRNECRSAVRIKVLDVLSFVLLINRQFYEEELIN
FT                   SVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLSPPPEL
FT                   EERDLAVHSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYESLISHIQLHYKHGYSL
FT                   PIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCMELDRASEKKASGPL
FT                   SPPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQESDWKVLKLVLSRLPESLRYKVL
FT                   IFTSPCSVDQLSSALCSMLSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLD
FT                   KTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMA
FT                   IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIR
FT                   CRLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSRIQTSLTSASLG
FT                   SADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTW
FT                   LVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSSSDPSTHVRQTKEAPAKLESQAGQQ
FT                   VSRGARDRVRSMSGGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKPEKPPAGAQLPTA
FT                   EKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMA
FT                   AERFKEHRDTALYKSLSVPAAGTAKPPTLPRSNTDSAMVLEEGSPGETQVPVEPPELED
FT                   FEAALGTDRHCQRPDTYSRSSSASSQEEKSHLEELAAGGIPIERAISSEGARPAVDLSF
FT                   QPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGE
FT                   ESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKV
FT                   PGINPSFVFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEG
FT                   QSSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHD
FT                   DIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIKGQFNFVHV
FT                   IITPLDYKCNLLTLQCRKDMEGLVDTSVAKIVSDRNLSFVARQMALHANMASQVHHSRS
FT                   NPTDIYPSKWIARLRHIKRLRQRIREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYET
FT                   GQRKRLISSVDDFTEFV"
FT   CDS             complement(join(1449329..1449490,1449579..1449677,
FT                   1449770..1449861,1449929..1450007,1450637..1450776,
FT                   1450916..1451102,1451762..1451848,1452017..1452092,
FT                   1452294..1452784,1453072..1453202,1454831..1455034,
FT                   1455823..1456035,1457043..1457155,1457243..1457395,
FT                   1457565..1457729,1458954..1459082,1460167..1460261,
FT                   1460429..1460531,1460826..1460919,1461697..1461886,
FT                   1463142..1463276,1464018..1464140,1465184..1465334,
FT                   1465516..1465622,1466309..1466431,1469606..1469722,
FT                   1470155..1470310,1471487..1471568,1471797..1471900,
FT                   1472340..1472477,1473240..1473383,1474203..1474329,
FT                   1476849..1476922,1483401..1483526,1483850..1483898,
FT                   1485146..1485260,1486097..1486241,1487024..1487134,
FT                   1488068..1488154,1489075..>1489245))
FT                   /codon_start=1
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, isoform CRA_c"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT191658.0
FT                   protein_id=mCP112627.0 isoform=CRA_c"
FT                   /protein_id="EDL22343.1"
FT                   /translation="TEQFSSTALPTMAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGK
FT                   QTEFIITSEILRELSGECGLNNRIRMIGQICDVAKTKKLEEHAVEALWKAVSDLLQPER
FT                   PPEARHAVLTLLKAIVQGQGDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRH
FT                   ITYLEEELEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVHMICLLCIRTVSS
FT                   VDIEVSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKELCEPCWKLMRNLLGTHLGHS
FT                   AIYNMCRIMEDRSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEAMTCP
FT                   NEVVSYEIVLSITRLIKKYRKELQAVTWDILLDIIERLLQQLQNLDSPELKTIVHDLLT
FT                   TVEELCDQNEFHGSQERYYELVESYADQRPESSLLNLISYRAQSIHPAKDGWIQNLQLL
FT                   MERFFRNECRSAVRIKVLDVLSFVLLINRQFYEEELINSVVISQLSHIPEDKDHQVRKL
FT                   ATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLSPPPELEERDLAVHSASLEDVKTAVLG
FT                   LLVILQTKLYTLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQAFDFLLLLRADS
FT                   LHRLGLPNKDGVVRFSPYCLCDCMELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYL
FT                   PYSLLFRVLLQCLKQESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSALCSMLSA
FT                   PKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQREMVYCLEQGLIYRCAS
FT                   QCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMAIPLLEFLSTLARLPHLYRNFA
FT                   AEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITKGLRSNV
FT                   LLSFDDTPEKDSFRARSTSLNERPKSLRIARAPKQGLNNSPPVKEFKESCAAEAFRCRS
FT                   ISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNF
FT                   TAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSSSD
FT                   PSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGVLDTSAPYSPGGSASL
FT                   GPQTAVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENP
FT                   LSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAGTAKPPTLPRSNTDSA
FT                   MVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSRSSSASSQEEKSHLEELAA
FT                   GGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPE
FT                   AKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSR
FT                   RGKRVERDNFKSRAAASSAEKVPGINPSFVFLQLYHSPFFGDESNKPILLPNESFERSV
FT                   QLLDQIPSYDTHKIAVLYVGEGQSSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPD
FT                   KVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSII
FT                   YNDSGEDFKLGTIKGQFNFVHVIITPLDYKCNLLTLQCRKDMEGLVDTSVAKIVSDRNL
FT                   SFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRIREEVHYSNPSLPL
FT                   MHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV"
FT   CDS             complement(join(1449329..1449490,1449579..1449677,
FT                   1449770..1449861,1449929..1450007,1450637..1450776,
FT                   1450916..1451102,1451762..1451848,1452017..1452092,
FT                   1452294..1452784,1453072..1453202,1454126..1454194,
FT                   1454831..1455034,1455823..1456035,1457043..1457155,
FT                   1457243..1457395,1457565..1457729,1458954..1459082,
FT                   1460167..1460261,1460429..1460531,1460826..1460919,
FT                   1461697..1461886,1463142..1463276,1464018..1464140,
FT                   1465184..1465334,1465516..1465622,1466309..1466431,
FT                   1469606..1469722,1470155..1470310,1471487..1471568,
FT                   1471797..1471900,1472340..1472477,1473240..1473383,
FT                   1474203..1474329,1476849..1476922,1477827..1477952,
FT                   1478268..1478316,1479582..1479699,1486097..1486241,
FT                   1487024..1487134,1488068..1488154,1489075..1489212))
FT                   /codon_start=1
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, isoform CRA_a"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT169684.0
FT                   protein_id=mCP92695.0 isoform=CRA_a"
FT                   /protein_id="EDL22341.1"
FT                   /translation="MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEIL
FT                   RELSGECGLNNRIRMIGQICDVAKTKKLEEHAVEALWKAVSDLLQPERPPEARHAVLTL
FT                   LKAIVQGQGDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEF
FT                   VLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVHMICLLCIRTVSSVDIEVSLQVL
FT                   DAVVCYNCLPAESLPLFIITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIME
FT                   DRSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVL
FT                   SITRLIKKYRKELQAVTWDILLDIIERLLQQLQNLDSPELKTIVHDLLTTVEELCDQNE
FT                   FHGSQERYYELVESYADQRPESSLLNLISYRAQSIHPAKDGWIQNLQLLMERFFRNECR
FT                   SAVRIKVLDVLSFVLLINRQFYEEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAE
FT                   GCHTHHFNSLLDIIEKVMARSLSPPPELEERDLAVHSASLEDVKTAVLGLLVILQTKLY
FT                   TLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQAFDFLLLLRADSLHRLGLPNKD
FT                   GVVRFSPYCLCDCMELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLL
FT                   QCLKQESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSALCSMLSAPKTLERLRGT
FT                   PEGFSRTDLHLAVVPVLTALISYHNYLDKTRQREMVYCLEQGLIYRCASQCVVALAICS
FT                   VEMPDIIIKALPVLVVKLTHISATASMAIPLLEFLSTLARLPHLYRNFAAEQYASVFAI
FT                   SLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITKGLRSNVLLSFDDTPEK
FT                   DSFRARSTSLNERPKSLRIARAPKQGLNNSPPVKEFKESCAAEAFRCRSISVSEHVVRS
FT                   RIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVG
FT                   EFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSSSDPSTHVRQTKE
FT                   APAKLESQAGQQVSRGARDRVRSMSGGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKP
FT                   EKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINN
FT                   MPLQELSNALMAAERFKEHRDTALYKSLSVPAAGTAKPPTLPRSNTVASFSSLYQPSCQ
FT                   GQLHRSVSWADSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSRSSSAS
FT                   SQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGD
FT                   LGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPSGLR
FT                   PRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPSFVFLQLYHSPFFGDESNK
FT                   PILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSSSELAILSNEHGSYRYTEFLTG
FT                   LGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCD
FT                   KKRHLGNDFVSIIYNDSGEDFKLGTIKGQFNFVHVIITPLDYKCNLLTLQCRKDMEGLV
FT                   DTSVAKIVSDRNLSFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRI
FT                   REEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV"
FT   CDS             complement(join(1449329..1449490,1449579..1449787,
FT                   1449929..1450007,1450637..1450776,1450916..1451102,
FT                   1451762..1451848,1452017..1452092,1452294..1452784,
FT                   1453072..1453202,1454126..1454194,1454831..1455034,
FT                   1455823..1456035,1457043..1457155,1457243..1457395,
FT                   1457565..1457729,1458954..1459082,1460167..1460261,
FT                   1460429..1460531,1460826..1460919,1461697..1461886,
FT                   1463142..1463276,1464018..1464140,1465184..1465334,
FT                   1465516..1465622,1466309..1466431,1469606..1469722,
FT                   1470155..1470310,1471487..1471568,1471797..1471900,
FT                   1472340..1472477,1473240..1473383,1474203..1474329,
FT                   1476849..1476922,1483401..1483526,1483850..1483898,
FT                   1485146..1485263,1486097..1486241,1487024..1487134,
FT                   1488068..1488154,1489075..1489212))
FT                   /codon_start=1
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, isoform CRA_e"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT13705.2
FT                   protein_id=mCP23137.2 isoform=CRA_e"
FT                   /protein_id="EDL22345.1"
FT                   /translation="MAKPTSKDSGLKEKFKILLGLGTSRPNPRCAEGKQTEFIITSEIL
FT                   RELSGECGLNNRIRMIGQICDVAKTKKLEEHAVEALWKAVSDLLQPERPPEARHAVLTL
FT                   LKAIVQGQGDRLGVLRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAEF
FT                   VLQWMDVGLSSEFLLVLVNLVKFNSCYLDEYIASMVHMICLLCIRTVSSVDIEVSLQVL
FT                   DAVVCYNCLPAESLPLFIITLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIME
FT                   DRSYMEDAPLLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVL
FT                   SITRLIKKYRKELQAVTWDILLDIIERLLQQLQNLDSPELKTIVHDLLTTVEELCDQNE
FT                   FHGSQERYYELVESYADQRPESSLLNLISYRAQSIHPAKDGWIQNLQLLMERFFRNECR
FT                   SAVRIKVLDVLSFVLLINRQFYEEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAE
FT                   GCHTHHFNSLLDIIEKVMARSLSPPPELEERDLAVHSASLEDVKTAVLGLLVILQTKLY
FT                   TLPASHATRVYESLISHIQLHYKHGYSLPIASSIRLQAFDFLLLLRADSLHRLGLPNKD
FT                   GVVRFSPYCLCDCMELDRASEKKASGPLSPPTGPPSPVPMGPAVRLGYLPYSLLFRVLL
FT                   QCLKQESDWKVLKLVLSRLPESLRYKVLIFTSPCSVDQLSSALCSMLSAPKTLERLRGT
FT                   PEGFSRTDLHLAVVPVLTALISYHNYLDKTRQREMVYCLEQGLIYRCASQCVVALAICS
FT                   VEMPDIIIKALPVLVVKLTHISATASMAIPLLEFLSTLARLPHLYRNFAAEQYASVFAI
FT                   SLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPYITKGLRSNVLLSFDDTPEK
FT                   DSFRARSTSLNERPKSLRIARAPKQGLNNSPPVKEFKESCAAEAFRCRSISVSEHVVRS
FT                   RIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVG
FT                   EFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGDLQGGSDSSSDPSTHVRQTKE
FT                   APAKLESQAGQQVSRGARDRVRSMSGGHGLRVGVLDTSAPYSPGGSASLGPQTAVAAKP
FT                   EKPPAGAQLPTAEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINN
FT                   MPLQELSNALMAAERFKEHRDTALYKSLSVPAAGTAKPPTLPRSNTVASFSSLYQPSCQ
FT                   GQLHRSVSWADSAMVLEEGSPGETQVPVEPPELEDFEAALGTDRHCQRPDTYSRSSSAS
FT                   SQEEKSHLEELAAGGIPIERAISSEGARPAVDLSFQPSQPLSKSSSSPELQTLQDILGD
FT                   LGDKIDIGRLSPEAKVRSQSGILDGEAATWSATGEESRITVPPEGPLPSSSPRSPSGLR
FT                   PRGYTISDSAPSRRGKRVERDNFKSRAAASSAEKVPGINPSFVFLQLYHSPFFGDESNK
FT                   PILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSSSELAILSNEHGSYRYTEFLTG
FT                   LGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCD
FT                   KKRHLGNDFVSIIYNDSGEDFKLGTIKGQFNFVHVIITPLDYKCNLLTLQCRKDGPACK
FT                   CEWWRQPGEIVVWALPVVMELTVTILLCHLQMASQVHHSRSNPTDIYPSKWIARLRHIK
FT                   RLRQRIREEVHYSNPSLPLMHPPAHTKAPAQAPEATPTYETGQRKRLISSVDDFTEFV"
FT   CDS             complement(join(1449766..1449787,1449929..1450007,
FT                   1450633..1450776,1450916..1451102,1451762..1451848,
FT                   1452017..1452092,1452294..1452784,1453072..1453202,
FT                   1454126..1454194,1454831..1455034,1455823..1456035,
FT                   1457043..1457155,1457243..1457395,1457565..1457729,
FT                   1458954..1459082,1460167..1460261,1460429..1460531,
FT                   1460826..1460919,1461697..1461886,1463142..1463276,
FT                   1464018..1464140,1465184..1465334,1465516..1465622,
FT                   1466309..1466431,1469606..1469722,1470155..1470310,
FT                   1471487..1471568,1471797..1471900,1472340..1472477,
FT                   1473240..1473383,1474203..1474329,1476849..1476922,
FT                   1483401..1483526,1483850..1483898,1485146..1485263,
FT                   1486097..1486241,1487024..1487134,1488068..1488154,
FT                   1489075..1489241,1489668..>1489728))
FT                   /codon_start=1
FT                   /gene="Tsc2"
FT                   /locus_tag="mCG_12837"
FT                   /product="tuberous sclerosis 2, isoform CRA_b"
FT                   /note="gene_id=mCG12837.2 transcript_id=mCT191657.0
FT                   protein_id=mCP112626.0 isoform=CRA_b"
FT                   /protein_id="EDL22342.1"
FT                   /translation="VGGVRPSLGAGGPARERRAREQFSSTALPTMAKPTSKDSGLKEKF
FT                   KILLGLGTSRPNPRCAEGKQTEFIITSEILRELSGECGLNNRIRMIGQICDVAKTKKLE
FT                   EHAVEALWKAVSDLLQPERPPEARHAVLTLLKAIVQGQGDRLGVLRALFFKVIKDYPSN
FT                   EDLHERLEVFKALTDNGRHITYLEEELAEFVLQWMDVGLSSEFLLVLVNLVKFNSCYLD
FT                   EYIASMVHMICLLCIRTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFIITLCRTINVKE
FT                   LCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRSYMEDAPLLRGAVFFVGMALWGAHRLY
FT                   SLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRKELQAVTWDILLDIIERLL
FT                   QQLQNLDSPELKTIVHDLLTTVEELCDQNEFHGSQERYYELVESYADQRPESSLLNLIS
FT                   YRAQSIHPAKDGWIQNLQLLMERFFRNECRSAVRIKVLDVLSFVLLINRQFYEEELINS
FT                   VVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLSPPPELE
FT                   ERDLAVHSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYESLISHIQLHYKHGYSLP
FT                   IASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCLCDCMELDRASEKKASGPLS
FT                   PPTGPPSPVPMGPAVRLGYLPYSLLFRVLLQCLKQESDWKVLKLVLSRLPESLRYKVLI
FT                   FTSPCSVDQLSSALCSMLSAPKTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDK
FT                   TRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMAI
FT                   PLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
FT                   RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARAPKQGLNN
FT                   SPPVKEFKESCAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNL
FT                   HLELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGT
FT                   RSLLGLDSGDLQGGSDSSSDPSTHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHG
FT                   LRVGVLDTSAPYSPGGSASLGPQTAVAAKPEKPPAGAQLPTAEKTNLAAYVPLLTQGWA
FT                   EILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLS
FT                   VPAAGTAKPPTLPRSNTVASFSSLYQPSCQGQLHRSVSWADSAMVLEEGSPGETQVPVE
FT                   PPELEDFEAALGTDRHCQRPDTYSRSSSASSQEEKSHLEELAAGGIPIERAISSEGARP
FT                   AVDLSFQPSQPLSKSSSSPELQTLQDILGDLGDKIDIGRLSPEAKVRSQSGILDGEAAT
FT                   WSATGEESRITVPPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDNFKSRAAA
FT                   SSAEKVPGINPSFVFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAV
FT                   LYVGEGQSSSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQF
FT                   TYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIIYNDSGEDFKLGTIKVR
FT                   PVQLCPCDHHTAGLQVQPIDPAVQERWPCMQM"
FT   assembly_gap    1480638..1480657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1489808..1495955
FT                   /gene="Nthl1"
FT                   /locus_tag="mCG_12840"
FT                   /note="gene_id=mCG12840.2"
FT   mRNA            join(<1489808..1490988,1491057..1491295,1491855..1492025,
FT                   1492718..1492877,1495542..1495647,1495726..1495954)
FT                   /gene="Nthl1"
FT                   /locus_tag="mCG_12840"
FT                   /product="nth (endonuclease III)-like 1 (E.coli),
FT                   transcript variant mCT191711"
FT                   /note="gene_id=mCG12840.2 transcript_id=mCT191711.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1489840..1489984,1491057..1491295,1491855..1492025,
FT                   1492718..1492877,1495542..1495647,1495726..1495955)
FT                   /gene="Nthl1"
FT                   /locus_tag="mCG_12840"
FT                   /product="nth (endonuclease III)-like 1 (E.coli),
FT                   transcript variant mCT13708"
FT                   /note="gene_id=mCG12840.2 transcript_id=mCT13708.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(1489882..1489984,1491057..1491295,1491855..1492025,
FT                   1492718..1492877,1495542..1495647,1495726..1495849)
FT                   /codon_start=1
FT                   /gene="Nthl1"
FT                   /locus_tag="mCG_12840"
FT                   /product="nth (endonuclease III)-like 1 (E.coli), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG12840.2 transcript_id=mCT13708.1
FT                   protein_id=mCP23196.1 isoform=CRA_b"
FT                   /db_xref="GOA:B2RSG2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR030841"
FT                   /db_xref="MGI:MGI:1313275"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSG2"
FT                   /protein_id="EDL22347.1"
FT                   /translation="MNSGVRMVTRSRSRATRIASEGCREELAPREAAAEGRKSHRPVRH
FT                   PRRTQKTHVAYEAANGEEGEDAEPLKVPVWEPQNWQQQLANIRIMRSKKDAPVDQLGAE
FT                   HCYDASAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVESILQTDDDTLGRL
FT                   IYPVGFWRNKVKYIKQTTAILQQRYEGDIPASVAELVALPGVGPKMAHLAMAVAWGTIS
FT                   GIAVDTHVHRIANRLRWTKKMTKTPEETRKNLEEWLPRVLWSEVNGLLVGFGQQICLPV
FT                   HPRCQACLNKALCPAAQDL"
FT   CDS             join(<1490955..1490988,1491057..1491295,1491855..1492025,
FT                   1492718..1492877,1495542..1495647,1495726..1495849)
FT                   /codon_start=1
FT                   /gene="Nthl1"
FT                   /locus_tag="mCG_12840"
FT                   /product="nth (endonuclease III)-like 1 (E.coli), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12840.2 transcript_id=mCT191711.0
FT                   protein_id=mCP112665.0 isoform=CRA_a"
FT                   /protein_id="EDL22346.1"
FT                   /translation="LHKQVWGCGLAEGRKSHRPVRHPRRTQKTHVAYEAANGEEGEDAE
FT                   PLKVPVWEPQNWQQQLANIRIMRSKKDAPVDQLGAEHCYDASAPPKVRRYQVLLSLMLS
FT                   SQTKDQVTAGAMQRLRARGLTVESILQTDDDTLGRLIYPVGFWRNKVKYIKQTTAILQQ
FT                   RYEGDIPASVAELVALPGVGPKMAHLAMAVAWGTISGIAVDTHVHRIANRLRWTKKMTK
FT                   TPEETRKNLEEWLPRVLWSEVNGLLVGFGQQICLPVHPRCQACLNKALCPAAQDL"
FT   gene            complement(1496406..>1507283)
FT                   /gene="Slc9a3r2"
FT                   /locus_tag="mCG_12829"
FT                   /note="gene_id=mCG12829.1"
FT   mRNA            complement(join(1496406..1497507,1497713..1497775,
FT                   1498737..1498780,1498847..1499000,1499219..1499398,
FT                   1504555..1504755,1506943..>1507283))
FT                   /gene="Slc9a3r2"
FT                   /locus_tag="mCG_12829"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 3 regulator 2, transcript variant
FT                   mCT13698"
FT                   /note="gene_id=mCG12829.1 transcript_id=mCT13698.1 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1496891..1497507,1497713..1497775,
FT                   1498737..1498780,1498847..1499000,1499219..1499398,
FT                   1501847..1501986))
FT                   /gene="Slc9a3r2"
FT                   /locus_tag="mCG_12829"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 3 regulator 2, transcript variant
FT                   mCT169682"
FT                   /note="gene_id=mCG12829.1 transcript_id=mCT169682.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1497349..1497507,1497713..1497775,
FT                   1498737..1498780,1498847..1499000,1499219..1499398,
FT                   1504555..1504755,1506943..>1507281))
FT                   /codon_start=1
FT                   /gene="Slc9a3r2"
FT                   /locus_tag="mCG_12829"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 3 regulator 2, isoform CRA_b"
FT                   /note="gene_id=mCG12829.1 transcript_id=mCT13698.1
FT                   protein_id=mCP23171.0 isoform=CRA_b"
FT                   /protein_id="EDL22349.1"
FT                   /translation="ELSRSHRGRCLLSRPRLRRLRTPACGWCEPWPVAAGQGAAGAMAA
FT                   PESLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGV
FT                   NVEGETHHQVVQRIKAVEGQTQLLVVDKETDEELCRRQLTCTEEMAHRGLPPAHNPWEP
FT                   KPDWACSGSLGSDTGQKDVNGSPRELRPRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVD
FT                   PGSPASHSGLRAQDRLIEVNGQNVEGLRHAEVVARIKAQEDEARLLVVDPETDEHFKRL
FT                   RVVPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEKDNEDGSTWKRDPFQES
FT                   GLHLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF"
FT   CDS             complement(join(1497349..1497507,1497713..1497775,
FT                   1498737..1498780,1498847..1499000,1499219..1499398,
FT                   1501847..1501927))
FT                   /codon_start=1
FT                   /gene="Slc9a3r2"
FT                   /locus_tag="mCG_12829"
FT                   /product="solute carrier family 9 (sodium/hydrogen
FT                   exchanger), isoform 3 regulator 2, isoform CRA_a"
FT                   /note="gene_id=mCG12829.1 transcript_id=mCT169682.0
FT                   protein_id=mCP92668.0 isoform=CRA_a"
FT                   /protein_id="EDL22348.1"
FT                   /translation="MARSRTSMLPASAPGAPPVNSQLGLTQDVNGSPRELRPRLCHLRR
FT                   GPQGYGFNLHSDKSRPGQYIRSVDPGSPASHSGLRAQDRLIEVNGQNVEGLRHAEVVAR
FT                   IKAQEDEARLLVVDPETDEHFKRLRVVPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSR
FT                   SDLPGSEKDNEDGSTWKRDPFQESGLHLSPTAAEAKEKARATRVNKRAPQMDWNRKREI
FT                   FSNF"
FT   gene            complement(1514357..>1515179)
FT                   /locus_tag="mCG_12814"
FT                   /note="gene_id=mCG12814.0"
FT   mRNA            complement(join(1514357..1514533,1515032..>1515179))
FT                   /locus_tag="mCG_12814"
FT                   /product="mCG12814"
FT                   /note="gene_id=mCG12814.0 transcript_id=mCT13682.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1514434..1514533,1515032..>1515177))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12814"
FT                   /product="mCG12814"
FT                   /note="gene_id=mCG12814.0 transcript_id=mCT13682.0
FT                   protein_id=mCP23298.0"
FT                   /protein_id="EDL22350.1"
FT                   /translation="QELWEVRSRSSPAGLPVHAPWSPRDLEGVRQPEQSLSLHSWISEE
FT                   PAARAFGETLRAQPWFLQQVIFADPVRPKNRWRPHA"
FT   assembly_gap    1522231..1523647
FT                   /estimated_length=1417
FT                   /gap_type="unknown"
FT   gene            1526554..1538722
FT                   /gene="Zfp598"
FT                   /locus_tag="mCG_12846"
FT                   /note="gene_id=mCG12846.2"
FT   mRNA            join(1526554..1526694,1533254..1533366,1533756..1533885,
FT                   1534110..1534321,1534554..1534771,1535302..1535410,
FT                   1535743..1535930,1536027..1536105,1536209..1536975,
FT                   1537326..1537506,1537589..1537739,1537817..1538722)
FT                   /gene="Zfp598"
FT                   /locus_tag="mCG_12846"
FT                   /product="zinc finger protein 598"
FT                   /note="gene_id=mCG12846.2 transcript_id=mCT13714.2 created
FT                   on 29-MAY-2002"
FT   CDS             join(1526638..1526694,1533254..1533366,1533756..1533885,
FT                   1534110..1534321,1534554..1534771,1535302..1535410,
FT                   1535743..1535930,1536027..1536105,1536209..1536975,
FT                   1537326..1537506,1537589..1537739,1537817..1538170)
FT                   /codon_start=1
FT                   /gene="Zfp598"
FT                   /locus_tag="mCG_12846"
FT                   /product="zinc finger protein 598"
FT                   /note="gene_id=mCG12846.2 transcript_id=mCT13714.2
FT                   protein_id=mCP23179.2"
FT                   /protein_id="EDL22351.1"
FT                   /translation="MRVLCEQRYCAVCREELRQVVFGKKLPAFALIPIHQLQHEKKYDI
FT                   YFADGKVFALYRQLLQHECPRCPHLPPFSLFGDLEQHMRKQHELFCCKLCLKHLKIFTY
FT                   ERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDS
FT                   DGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHKTACHSRSRAEA
FT                   RQNRQIDLQFSFAPRHSRRSEGVVSGEDYEEVDRYNRQGRAGRASGRGAQQNRRGSWRE
FT                   EEDREVAAAIRASVAAQQQEETQRVEDREEGSRPKKEEAAARVPEEPRGHRRLPRAQGE
FT                   GSGSKEASANGPVSQEAFPATGPVVALSNTLPPPSPELKEEDFPSLCASTSSCCTAVTP
FT                   GSVGLALAYPGPPRGKNTFQEEDFPALVSSAPKPSSAPSSLISAWNSGCSKKGNLPTPG
FT                   SQAVVGGSQPPRKAGKGSRGGRKGGPAPVDEEDSGGLTVQGLRSVPTTVAVSSLLAPAT
FT                   NQSSAKVGKKKKVGSEKPGATSSPLLPPDHTPKPSGAEQVLEAPLSKAEVPVTIVVNGH
FT                   SEGSALVRSAPKEPPGLPRPLGPLPCPIPQEDFPALGGPCPPRMPPPPGFSTVVLLKGT
FT                   PPPPPPPPGLVPPISKPPPGFSSLLPSSHSACAPSPTTTTTTTTTTTTKTPRLAPTPQA
FT                   YLVPENFRERNLQLIQSIKDFLQSDEACFSKFKSHSGEFRQGMISAAQYYKSCRDLLGE
FT                   SFQKIFSELLALLPDTAKQQELLSAHTDFCSREKPPNSRSKKNKKNVWQTSTQQLGLDC
FT                   CVCPTCQQVLAHGDVSSHQALHAARDDDFPSLQAIARIIT"
FT   assembly_gap    1541023..1542676
FT                   /estimated_length=1654
FT                   /gap_type="unknown"
FT   gene            complement(1543402..1547589)
FT                   /gene="Syngr3"
FT                   /locus_tag="mCG_12834"
FT                   /note="gene_id=mCG12834.1"
FT   mRNA            complement(join(1543402..1544082,1544161..1544303,
FT                   1545145..1545382,1547369..1547589))
FT                   /gene="Syngr3"
FT                   /locus_tag="mCG_12834"
FT                   /product="synaptogyrin 3"
FT                   /note="gene_id=mCG12834.1 transcript_id=mCT13703.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1543873..1544082,1544161..1544303,
FT                   1545145..1545382,1547369..1547467))
FT                   /codon_start=1
FT                   /gene="Syngr3"
FT                   /locus_tag="mCG_12834"
FT                   /product="synaptogyrin 3"
FT                   /note="gene_id=mCG12834.1 transcript_id=mCT13703.0
FT                   protein_id=mCP23217.1"
FT                   /protein_id="EDL22352.1"
FT                   /translation="MEGASFGAGRAGAAFDPVSFARRPQTLLRVVSWVFSIAVFGPIVN
FT                   EGYVNSDSGPELRCVFNGNAGACRFGVVLGLGAFIACVAFLLLDVRFQQISSVRDRRRA
FT                   VLLDLGFSGVWSFLWFVGFCFLTNQWQRTTPGPGTAQAGDAARAAIAFSFFSILSWVAL
FT                   TVKALQRFRLGTDMSLFATDQLGTGAAQAYPGYPVGSGVEGTETYQSPPFTETLDTSSK
FT                   GYQVPAY"
FT   gene            complement(1550836..1553810)
FT                   /locus_tag="mCG_12842"
FT                   /note="gene_id=mCG12842.3"
FT   mRNA            complement(join(1550836..1552087,1552892..1553088,
FT                   1553475..>1553717))
FT                   /locus_tag="mCG_12842"
FT                   /product="mCG12842, transcript variant mCT191716"
FT                   /note="gene_id=mCG12842.3 transcript_id=mCT191716.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1550990..1551263,1551832..1552087,
FT                   1552892..1553088,1553475..1553810))
FT                   /locus_tag="mCG_12842"
FT                   /product="mCG12842, transcript variant mCT13710"
FT                   /note="gene_id=mCG12842.3 transcript_id=mCT13710.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1551925..1552087,1552892..1553088,
FT                   1553475..>1553717))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12842"
FT                   /product="mCG12842, isoform CRA_a"
FT                   /note="gene_id=mCG12842.3 transcript_id=mCT191716.0
FT                   protein_id=mCP112666.0 isoform=CRA_a"
FT                   /protein_id="EDL22353.1"
FT                   /translation="SKMAAPSEPAGFPRGSRFSFLPGGARSEMTDDLVTDARGRGARHR
FT                   DDTTPAAAPAPQGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRHTWAF
FT                   LHTLAAYYPDRPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIGRNQPDTSTRVSFSQ
FT                   WLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD"
FT   CDS             complement(join(1551925..1552087,1552892..1553088,
FT                   1553475..1553711))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12842"
FT                   /product="mCG12842, isoform CRA_b"
FT                   /note="gene_id=mCG12842.3 transcript_id=mCT13710.2
FT                   protein_id=mCP23243.2 isoform=CRA_b"
FT                   /db_xref="GOA:P56213"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="MGI:MGI:107757"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56213"
FT                   /protein_id="EDL22354.1"
FT                   /translation="MAAPSEPAGFPRGSRFSFLPGGARSEMTDDLVTDARGRGARHRDD
FT                   TTPAAAPAPQGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRHTWAFLH
FT                   TLAAYYPDRPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIGRNQPDTSTRVSFSQWL
FT                   CRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD"
FT   gene            <1553918..1558225
FT                   /gene="Noxo1"
FT                   /locus_tag="mCG_12853"
FT                   /note="gene_id=mCG12853.2"
FT   mRNA            join(<1553918..1554768,1555868..1556056,1556166..1556246,
FT                   1556434..1556509,1556593..1556770,1556917..1557098,
FT                   1557192..1557305,1557548..1557665,1557771..1558177)
FT                   /gene="Noxo1"
FT                   /locus_tag="mCG_12853"
FT                   /product="NADPH oxidase organizer 1, transcript variant
FT                   mCT191656"
FT                   /note="gene_id=mCG12853.2 transcript_id=mCT191656.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1554443..1554768,1555868..1556056,1556166..1556246,
FT                   1556434..1556509,1556593..1556770,1556917..1557098,
FT                   1557192..1557665,1557771..1558225)
FT                   /gene="Noxo1"
FT                   /locus_tag="mCG_12853"
FT                   /product="NADPH oxidase organizer 1, transcript variant
FT                   mCT13721"
FT                   /note="gene_id=mCG12853.2 transcript_id=mCT13721.2 created
FT                   on 29-MAY-2002"
FT   CDS             join(<1555925..1556056,1556166..1556246,1556434..1556509,
FT                   1556593..1556770,1556917..1557098,1557192..1557305,
FT                   1557548..1557665,1557771..1558005)
FT                   /codon_start=1
FT                   /gene="Noxo1"
FT                   /locus_tag="mCG_12853"
FT                   /product="NADPH oxidase organizer 1, isoform CRA_b"
FT                   /note="gene_id=mCG12853.2 transcript_id=mCT191656.0
FT                   protein_id=mCP112632.0 isoform=CRA_b"
FT                   /protein_id="EDL22356.1"
FT                   /translation="GSVGEFHFTSSGCSELLQASIVMASPRHPVSAHAVALVQMDRLQT
FT                   FAFSVCWSDNSDTFVRRSWDEFRQLQKTLKKTFPVEAGLLRRSEQVLPKLPDAPLLTRR
FT                   GHTGRGLVRLRLLDTYVQALLATSEHILRSSALHGFFVPKPLDLEPMLPPGSLVILPTP
FT                   EEPLSQPRGSLDIHSLEAQSIPCVQPFHTLDIRDRPFHTKAQEILDILLRHPSGWWLVE
FT                   NKDQQVAWFPAPYLEEVATCQGQESGLALQGSGRQFCTTQAYEGSRSDELSVPSGARVH
FT                   VLETSDRGWWLCRYNGRTGLLPAMSLQPEGLGSLLGRPGFPDSAGADKVAEDRTIPPVV
FT                   PTRPCMSAIQSRCCSITRRALGQEQGTRVPR"
FT   CDS             join(1555991..1556056,1556166..1556246,1556434..1556509,
FT                   1556593..1556770,1556917..1557098,1557192..1557328)
FT                   /codon_start=1
FT                   /gene="Noxo1"
FT                   /locus_tag="mCG_12853"
FT                   /product="NADPH oxidase organizer 1, isoform CRA_a"
FT                   /note="gene_id=mCG12853.2 transcript_id=mCT13721.2
FT                   protein_id=mCP23216.2 isoform=CRA_a"
FT                   /protein_id="EDL22355.1"
FT                   /translation="MASPRHPVSAHAVALVQMDRLQTFAFSVCWSDNSDTFVRRSWDEF
FT                   RQLQKTLKKTFPVEAGLLRRSEQVLPKLPDAPLLTRRGHTGRGLVRLRLLDTYVQALLA
FT                   TSEHILRSSALHGFFVPKPLDLEPMLPPGSLVILPTPEEPLSQPRGSLDIHSLEAQSIP
FT                   CVQPFHTLDIRDRPFHTKAQEILDILLRHPSGWWLVENKDQQVAWFPAPYLEEVATCQG
FT                   QESGLALQGSGMSPSLL"
FT   gene            complement(1558097..1565310)
FT                   /gene="Tbl3"
FT                   /locus_tag="mCG_12838"
FT                   /note="gene_id=mCG12838.1"
FT   mRNA            complement(join(1558097..1558436,1558527..1558685,
FT                   1558931..1559034,1559254..1559312,1559393..1559549,
FT                   1559628..1559698,1559796..1560026,1560127..1560277,
FT                   1560893..1560996,1561647..1561705,1561791..1561932,
FT                   1562022..1562203,1562287..1562380,1562466..1562541,
FT                   1562802..1562972,1563052..1563136,1563220..1563361,
FT                   1563590..1563685,1563770..1563821,1565179..1565310))
FT                   /gene="Tbl3"
FT                   /locus_tag="mCG_12838"
FT                   /product="transducin (beta)-like 3, transcript variant
FT                   mCT13706"
FT                   /note="gene_id=mCG12838.1 transcript_id=mCT13706.1 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1558108..1558436,1558527..1558685,
FT                   1558771..1558842,1558931..1559034,1559254..1559312,
FT                   1559393..1559549,1559628..1559698,1559796..1560026,
FT                   1560127..1560277,1560893..1560996,1561647..1561705,
FT                   1561791..1561932,1562022..1562203,1562287..1562380,
FT                   1562466..1562541,1562802..1563136,1563220..1563361,
FT                   1563456..1563503,1563590..1563685,1563770..1563821,
FT                   1565179..>1565287))
FT                   /gene="Tbl3"
FT                   /locus_tag="mCG_12838"
FT                   /product="transducin (beta)-like 3, transcript variant
FT                   mCT191665"
FT                   /note="gene_id=mCG12838.1 transcript_id=mCT191665.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1558297..1558436,1558527..1558685,
FT                   1558771..1558842,1558931..1559034,1559254..1559312,
FT                   1559393..1559549,1559628..1559698,1559796..1560026,
FT                   1560127..1560277,1560893..1560996,1561647..1561705,
FT                   1561791..1561932,1562022..1562203,1562287..1562380,
FT                   1562466..1562541,1562802..1562972,1563052..1563136,
FT                   1563220..1563361,1563456..1563503,1563590..1563685,
FT                   1563770..1563821,1565179..>1565261))
FT                   /gene="Tbl3"
FT                   /locus_tag="mCG_12838"
FT                   /product="transducin (beta)-like 3, transcript variant
FT                   mCT191664"
FT                   /note="gene_id=mCG12838.1 transcript_id=mCT191664.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1558324..1558436,1558527..1558685,
FT                   1558771..1558842,1558931..1559034,1559254..1559312,
FT                   1559393..1559549,1559628..1559698,1559796..1560026,
FT                   1560127..1560277,1560893..1560996,1561647..1561705,
FT                   1561791..1561932,1562022..1562203,1562287..1562380,
FT                   1562466..1562541,1562802..1562972,1563052..1563136,
FT                   1563220..1563361,1563456..1563503,1563590..1563685,
FT                   1563770..1563821,1565179..>1565261))
FT                   /codon_start=1
FT                   /gene="Tbl3"
FT                   /locus_tag="mCG_12838"
FT                   /product="transducin (beta)-like 3, isoform CRA_b"
FT                   /note="gene_id=mCG12838.1 transcript_id=mCT191664.0
FT                   protein_id=mCP112629.0 isoform=CRA_b"
FT                   /protein_id="EDL22358.1"
FT                   /translation="RGERLLNLEALPWDMAETAAGLCRFKANYAVERKIEPFYKGGKAQ
FT                   LDQTGHYLFCVCGTKVNILDVASGALLRSLEQEDQEDITSFDLSPDDEVLVTASRALLL
FT                   AQWAWREGTVTRLWKAIHTAPVASMAFDATSTLLATGGCDGAVRVWDIVQHYGTHHFRG
FT                   SPGVVHLVAFHPDPTRLLLFSSAVDTSIRVWSLQDRSCLAVLTAHYSAVTSLSFSEGGH
FT                   TMLSSGRDKICIVWDLQSYQTTRTVPVFESVEASVLLPEQPAPALGVKSSGLHFLTAGD
FT                   QGILRVWEAASGQCVYTQPQMPGLRQELTHCTLARAADLLLTVTADHNLLLYEAHSLQL
FT                   QKQFAGYSEEVLDVRFLGPSDSHIVVASNSPCLKVFELQTLACQILHGHTDIVLALDVF
FT                   RKGWLFASCAKDQSIRIWKMNKAGQVACVAQGSGHTHSVGTICCSRLKESFLVTGSQDC
FT                   TVKLWPLPEALLANKSTAADSGPVLLQAQTTQRCHDKDINSLAVSPNDKLLATGSQDRT
FT                   AKLWALPQCQLLGVFTGHRRGLWNVQFSPTDQVLATASADGTIKLWALQDFSCLKTFEG
FT                   HDASVLKVAFVSRGSQLLSSGSDGLLKLWTIKSNECVRTLDAHEDKVWGLHCSQLDDHA
FT                   ITGGSDSRIILWKDVTEAEQAEEQAKREEQVIKQQELDNLLHEKRYLRALGLAISLDRP
FT                   HTVLTVIQAIRRDPEACEKLETTVLRLRRDQKEALLRFCVTWNTNSRHCHEAQAVLGVL
FT                   LRHEAPEELLAYDGVRGSLEALLPYTERHFQRLSRTLQAATFLDFLWHNMKLSPCPAAA
FT                   PPAL"
FT   CDS             complement(join(1558324..1558436,1558527..1558685,
FT                   1558931..1559034,1559254..1559312,1559393..1559549,
FT                   1559628..1559698,1559796..1560026,1560127..1560277,
FT                   1560893..1560996,1561647..1561705,1561791..1561932,
FT                   1562022..1562203,1562287..1562380,1562466..1562541,
FT                   1562802..1562972,1563052..1563136,1563220..1563361,
FT                   1563590..1563685,1563770..1563821,1565179..1565219))
FT                   /codon_start=1
FT                   /gene="Tbl3"
FT                   /locus_tag="mCG_12838"
FT                   /product="transducin (beta)-like 3, isoform CRA_a"
FT                   /note="gene_id=mCG12838.1 transcript_id=mCT13706.1
FT                   protein_id=mCP23322.1 isoform=CRA_a"
FT                   /protein_id="EDL22357.1"
FT                   /translation="MAETAAGLCRFKANYAVERKIEPFYKGGKAQLDQTGHYLFCVCGT
FT                   KVNILDVASGALLRSLEQVLVTASRALLLAQWAWREGTVTRLWKAIHTAPVASMAFDAT
FT                   STLLATGGCDGAVRVWDIVQHYGTHHFRGSPGVVHLVAFHPDPTRLLLFSSAVDTSIRV
FT                   WSLQDRSCLAVLTAHYSAVTSLSFSEGGHTMLSSGRDKICIVWDLQSYQTTRTVPVFES
FT                   VEASVLLPEQPAPALGVKSSGLHFLTAGDQGILRVWEAASGQCVYTQPQMPGLRQELTH
FT                   CTLARAADLLLTVTADHNLLLYEAHSLQLQKQFAGYSEEVLDVRFLGPSDSHIVVASNS
FT                   PCLKVFELQTLACQILHGHTDIVLALDVFRKGWLFASCAKDQSIRIWKMNKAGQVACVA
FT                   QGSGHTHSVGTICCSRLKESFLVTGSQDCTVKLWPLPEALLANKSTAADSGPVLLQAQT
FT                   TQRCHDKDINSLAVSPNDKLLATGSQDRTAKLWALPQCQLLGVFTGHRRGLWNVQFSPT
FT                   DQVLATASADGTIKLWALQDFSCLKTFEGHDASVLKVAFVSRGSQLLSSGSDGLLKLWT
FT                   IKSNECVRTLDAHEDKVWGLHCSQLDDHAITGGSDSRIILWKDVTEAEQAEEQAKREEQ
FT                   VIKQQELDNLLHEKRYLRALGLAISLDRPHTVLTVIQEALLRFCVTWNTNSRHCHEAQA
FT                   VLGVLLRHEAPEELLAYDGVRGSLEALLPYTERHFQRLSRTLQAATFLDFLWHNMKLSP
FT                   CPAAAPPAL"
FT   CDS             complement(join(1558324..1558436,1558527..1558685,
FT                   1558771..1558842,1558931..1559034,1559254..1559312,
FT                   1559393..1559549,1559628..1559698,1559796..1560026,
FT                   1560127..1560277,1560893..1560996,1561647..1561705,
FT                   1561791..1561932,1562022..1562203,1562287..1562380,
FT                   1562466..1562541,1562802..>1563043))
FT                   /codon_start=1
FT                   /gene="Tbl3"
FT                   /locus_tag="mCG_12838"
FT                   /product="transducin (beta)-like 3, isoform CRA_c"
FT                   /note="gene_id=mCG12838.1 transcript_id=mCT191665.0
FT                   protein_id=mCP112630.0 isoform=CRA_c"
FT                   /protein_id="EDL22359.1"
FT                   /translation="GGGGRMGGGTTLGSPAHLSVPAFSLVAFHPDPTRLLLFSSAVDTS
FT                   IRVWSLQDRSCLAVLTAHYSAVTSLSFSEGGHTMLSSGRDKICIVWDLQSYQTTRTVPV
FT                   FESVEASVLLPEQPAPALGVKSSGLHFLTAGDQGILRVWEAASGQCVYTQPQMPGLRQE
FT                   LTHCTLARAADLLLTVTADHNLLLYEAHSLQLQKQFAGYSEEVLDVRFLGPSDSHIVVA
FT                   SNSPCLKVFELQTLACQILHGHTDIVLALDVFRKGWLFASCAKDQSIRIWKMNKAGQVA
FT                   CVAQGSGHTHSVGTICCSRLKESFLVTGSQDCTVKLWPLPEALLANKSTAADSGPVLLQ
FT                   AQTTQRCHDKDINSLAVSPNDKLLATGSQDRTAKLWALPQCQLLGVFTGHRRGLWNVQF
FT                   SPTDQVLATASADGTIKLWALQDFSCLKTFEGHDASVLKVAFVSRGSQLLSSGSDGLLK
FT                   LWTIKSNECVRTLDAHEDKVWGLHCSQLDDHAITGGSDSRIILWKDVTEAEQAEEQAKR
FT                   EEQVIKQQELDNLLHEKRYLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLETTVLRL
FT                   RRDQKEALLRFCVTWNTNSRHCHEAQAVLGVLLRHEAPEELLAYDGVRGSLEALLPYTE
FT                   RHFQRLSRTLQAATFLDFLWHNMKLSPCPAAAPPAL"
FT   gene            complement(1573699..1575870)
FT                   /gene="Rnf151"
FT                   /locus_tag="mCG_12806"
FT                   /note="gene_id=mCG12806.0"
FT   mRNA            complement(join(1573699..1574562,1574919..1575015,
FT                   1575316..1575461,1575835..1575870))
FT                   /gene="Rnf151"
FT                   /locus_tag="mCG_12806"
FT                   /product="ring finger protein 151"
FT                   /note="gene_id=mCG12806.0 transcript_id=mCT13674.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1574089..1574562,1574919..1575015,
FT                   1575316..1575461,1575835..1575837))
FT                   /codon_start=1
FT                   /gene="Rnf151"
FT                   /locus_tag="mCG_12806"
FT                   /product="ring finger protein 151"
FT                   /note="gene_id=mCG12806.0 transcript_id=mCT13674.0
FT                   protein_id=mCP23188.1"
FT                   /protein_id="EDL22360.1"
FT                   /translation="MSGGYDLNLFASPPDCKFLCSVCHGVLKRPTRLPCSHIFCKKCIF
FT                   RWLARQNTCPCCRKEVTRRKMVEVNKLRKTIGRLQVKCKNAAAGCLDTHPLAHRKEHQD
FT                   SCPFELMACPNEGCTVQVLRGVLDEHRQHCQQNGQQRCPLGCGSTLAALEGEHHNCYRE
FT                   LRDAWVQRHERNRTLLLGLLGRVRRVHLTTSIIHQQLAQLSNFLEDDDNLLLNAQVQET
FT                   EVTPEAEMRGTQGQSVL"
FT   gene            1577954..1579783
FT                   /locus_tag="mCG_12811"
FT                   /note="gene_id=mCG12811.2"
FT   mRNA            join(1577954..1577988,1578129..1578308,1578390..1578587,
FT                   1578825..1579158,1579479..1579570,1579659..1579779)
FT                   /locus_tag="mCG_12811"
FT                   /product="mCG12811, transcript variant mCT13679"
FT                   /note="gene_id=mCG12811.2 transcript_id=mCT13679.1 created
FT                   on 29-MAY-2002"
FT   mRNA            join(1577965..1577988,1578129..1578308,1578390..1578587,
FT                   1578999..1579158,1579479..1579570,1579659..1579783)
FT                   /locus_tag="mCG_12811"
FT                   /product="mCG12811, transcript variant mCT169681"
FT                   /note="gene_id=mCG12811.2 transcript_id=mCT169681.0 created
FT                   on 29-MAY-2002"
FT   CDS             join(1578132..1578308,1578390..1578587,1578825..1579158,
FT                   1579479..1579570,1579659..1579739)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12811"
FT                   /product="mCG12811, isoform CRA_b"
FT                   /note="gene_id=mCG12811.2 transcript_id=mCT13679.1
FT                   protein_id=mCP23313.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q58EU3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="MGI:MGI:105110"
FT                   /db_xref="UniProtKB/TrEMBL:Q58EU3"
FT                   /protein_id="EDL22362.1"
FT                   /translation="MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGRGRG
FT                   RGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKD
FT                   EVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIV
FT                   PVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDDC
FT                   YTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVS
FT                   VQRTQAPAVATT"
FT   CDS             join(1578132..1578308,1578390..1578587,1578999..1579158,
FT                   1579479..1579570,1579659..1579739)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12811"
FT                   /product="mCG12811, isoform CRA_a"
FT                   /note="gene_id=mCG12811.2 transcript_id=mCT169681.0
FT                   protein_id=mCP92688.0 isoform=CRA_a"
FT                   /protein_id="EDL22361.1"
FT                   /translation="MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGRGRG
FT                   RGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKD
FT                   EVLKIMPVQKQTRAGQRTRFKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGIDD
FT                   CYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRV
FT                   SVQRTQAPAVATT"
FT   gene            complement(1579916..1582282)
FT                   /gene="Ndufb10"
FT                   /locus_tag="mCG_12849"
FT                   /note="gene_id=mCG12849.1"
FT   mRNA            complement(join(1579916..1580077,1580238..1580377,
FT                   1580512..1580650,1582044..1582282))
FT                   /gene="Ndufb10"
FT                   /locus_tag="mCG_12849"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 10"
FT                   /note="gene_id=mCG12849.1 transcript_id=mCT13717.1 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1579974..1580077,1580238..1580377,
FT                   1580512..1580650,1582044..1582191))
FT                   /codon_start=1
FT                   /gene="Ndufb10"
FT                   /locus_tag="mCG_12849"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 beta
FT                   subcomplex, 10"
FT                   /note="gene_id=mCG12849.1 transcript_id=mCT13717.1
FT                   protein_id=mCP23203.2"
FT                   /protein_id="EDL22363.1"
FT                   /translation="MPDSWDKDVYPEPPSRTPAPSPQTSLPNPITYLTKAYDLVVDWPV
FT                   TLVREFIERQHAKNRTYYYHRQYRRVPDITECKEGDVLCIYEAEMQWRRDFKVDQEIMN
FT                   IIQERLKACQQREGENYQQNCAKELEQFTKVTKAYQDRYLDLGAYYSARKCLAKQKQRM
FT                   LEERKAARQEAAA"
FT   assembly_gap    1587876..1588280
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   gene            1590771..1594231
FT                   /gene="Rpl3l"
FT                   /locus_tag="mCG_12816"
FT                   /note="gene_id=mCG12816.1"
FT   mRNA            join(1590771..1590994,1591396..1591582,1591671..1591831,
FT                   1592004..1592105,1593503..1593598,1593808..1593927,
FT                   1594086..1594231)
FT                   /gene="Rpl3l"
FT                   /locus_tag="mCG_12816"
FT                   /product="ribosomal protein L3-like"
FT                   /note="gene_id=mCG12816.1 transcript_id=mCT13684.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(1591396..1591582,1591671..1591831,1592004..1592105,
FT                   1593503..1593598,1593808..1593927,1594086..1594142)
FT                   /codon_start=1
FT                   /gene="Rpl3l"
FT                   /locus_tag="mCG_12816"
FT                   /product="ribosomal protein L3-like"
FT                   /note="gene_id=mCG12816.1 transcript_id=mCT13684.1
FT                   protein_id=mCP23138.1"
FT                   /db_xref="GOA:Q9CQ09"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="MGI:MGI:1913461"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQ09"
FT                   /protein_id="EDL22364.1"
FT                   /translation="MKLLPFRQKKAHIMEIQLNGGTVAEKVAWVQARMEKQVPVHSVFS
FT                   QSEVIDVIAVTKGRGVKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPARVGCSIARAGQ
FT                   KGYHHRTELNKKIYRIGRGLHMEDGKMVRNNASTSYDVTDKSITPLGGFPHYGEVNNDF
FT                   IMLKGCIAGTKKRVITLRKSLLVHHSRRALENIELKFIDTTSKFGHGCFQTAQEKRAFM
FT                   GPQKKHLEKEKPETLGNM"
FT   gene            1594753..1600869
FT                   /gene="Sepx1"
FT                   /locus_tag="mCG_12831"
FT                   /note="gene_id=mCG12831.1"
FT   mRNA            join(1594753..1594848,1597586..1597734,1598168..1598282,
FT                   1599997..1600028,1600401..1600869)
FT                   /gene="Sepx1"
FT                   /locus_tag="mCG_12831"
FT                   /product="selenoprotein X 1, transcript variant mCT13697"
FT                   /note="gene_id=mCG12831.1 transcript_id=mCT13697.1 created
FT                   on 29-MAY-2002"
FT   mRNA            join(1594768..1594848,1597586..1597734,1598168..1598282,
FT                   1599997..1600862)
FT                   /gene="Sepx1"
FT                   /locus_tag="mCG_12831"
FT                   /product="selenoprotein X 1, transcript variant mCT169683"
FT                   /note="gene_id=mCG12831.1 transcript_id=mCT169683.0 created
FT                   on 29-MAY-2002"
FT   CDS             join(1594794..1594848,1597586..1597734,1598168..1598248)
FT                   /codon_start=1
FT                   /gene="Sepx1"
FT                   /locus_tag="mCG_12831"
FT                   /product="selenoprotein X 1, isoform CRA_a"
FT                   /note="gene_id=mCG12831.1 transcript_id=mCT13697.1
FT                   protein_id=mCP23160.2 isoform=CRA_a"
FT                   /protein_id="EDL22365.1"
FT                   /translation="MSFCSFFGGEVFQNHFEPGVYVCAKCSYELFSSHSKYAHSSPWPA
FT                   FTETIHPDSVTKCPEKNRPEALKVSCGKCGNGLGHEFLNDGPKRGQSRF"
FT   CDS             join(1594794..1594848,1597586..1597734,1598168..1598248)
FT                   /codon_start=1
FT                   /gene="Sepx1"
FT                   /locus_tag="mCG_12831"
FT                   /product="selenoprotein X 1, isoform CRA_a"
FT                   /note="gene_id=mCG12831.1 transcript_id=mCT169683.0
FT                   protein_id=mCP92691.0 isoform=CRA_a"
FT                   /protein_id="EDL22366.1"
FT                   /translation="MSFCSFFGGEVFQNHFEPGVYVCAKCSYELFSSHSKYAHSSPWPA
FT                   FTETIHPDSVTKCPEKNRPEALKVSCGKCGNGLGHEFLNDGPKRGQSRF"
FT   gene            1611050..1618404
FT                   /gene="Hs3st6"
FT                   /locus_tag="mCG_12823"
FT                   /note="gene_id=mCG12823.1"
FT   mRNA            join(1611050..1611557,1617682..1618404)
FT                   /gene="Hs3st6"
FT                   /locus_tag="mCG_12823"
FT                   /product="heparan sulfate (glucosamine)
FT                   3-O-sulfotransferase 6"
FT                   /note="gene_id=mCG12823.1 transcript_id=mCT13691.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(1611145..1611557,1617682..1618297)
FT                   /codon_start=1
FT                   /gene="Hs3st6"
FT                   /locus_tag="mCG_12823"
FT                   /product="heparan sulfate (glucosamine)
FT                   3-O-sulfotransferase 6"
FT                   /note="gene_id=mCG12823.1 transcript_id=mCT13691.1
FT                   protein_id=mCP23291.1"
FT                   /db_xref="GOA:A2RTI7"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3580487"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTI7"
FT                   /protein_id="EDL22367.1"
FT                   /translation="MAGSGGLGGGAGDLQGAGTGQGTALRALRAPLALVVLLLSAYCLF
FT                   ALPGRCPPAARAPAPVPAPAEPPHTSLRLRAPGLPVASGPGRRRFPQALIVGVKKGGTR
FT                   ALLEFLRLHPDVRALGSEPHFFDRCYDRGLAWYRGLMPRTLDGQITMEKTPSYFVTQEA
FT                   PRRIHGMSPDTKLIVVVRNPVTRAISDYAQTLSKTPGLPSFRALAFRHGLGPVDTAWSA
FT                   VRIGLYAQHLDNWLRYFPLSHFLFVSGERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFN
FT                   ATKGFPCLKKAQGSGRPRCLGKSKGRPHPRVPEAVVQRLQAFYRPFNRKFYQMTGQDFG
FT                   WD"
FT   assembly_gap    1615046..1615065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1625356..1625375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1629400..1629419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1633281..1634502
FT                   /estimated_length=1222
FT                   /gap_type="unknown"
FT   assembly_gap    1653843..1653862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1656417..1656436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1657642..1657661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1660942..1660961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1676120..1676618
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    1677242..1677686
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   gene            <1680751..1701346
FT                   /locus_tag="mCG_132051"
FT                   /note="gene_id=mCG132051.0"
FT   mRNA            join(<1680751..1680882,1682337..1682409,1685844..1686039,
FT                   1690543..1690564,1690650..1690745,1693983..1694081,
FT                   1695452..1695605,1696553..1696736,1697998..1698084,
FT                   1700987..1701346)
FT                   /locus_tag="mCG_132051"
FT                   /product="mCG132051"
FT                   /note="gene_id=mCG132051.0 transcript_id=mCT133399.1
FT                   created on 29-MAY-2002"
FT   CDS             join(<1680753..1680882,1682337..1682409,1685844..1686039,
FT                   1690543..1690564,1690650..1690745,1693983..1694081,
FT                   1695452..1695605,1696553..1696736,1697998..1698084,
FT                   1700987..1701097)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132051"
FT                   /product="mCG132051"
FT                   /note="gene_id=mCG132051.0 transcript_id=mCT133399.1
FT                   protein_id=mCP84747.1"
FT                   /protein_id="EDL22368.1"
FT                   /translation="IGSERYTFSFTIRDSPCHFVNVSSWGSEDYIRSLSESFRVAECVI
FT                   IENPLIQRKDTEREEKFSPATPSNYKLLLSENHSMVKVCSPYEVDTKLLSLIHLPVKES
FT                   RDYYSLADIVANGHSLDGRIINVLAAVRSSWMARETVIFASDVRINFNKFQNCMAATVI
FT                   SKTIITVNPDTPEANILLNYIRENKETNVADEIDSYLKESVNLNTIVDVYTVEQLKVKA
FT                   LKSEGKADPFYGILYAYISTLNIDDETTKVVRNRCSSCGYIVNEASNTCTICNQDSSRL
FT                   KSFFLSFDVLVDLTDHTGTLHSCSLSGSIAEETLGCTINEFLTMTSEQKTKLKWQLLLE
FT                   RSKIYLKLILSHRARGGLKVTILSCKLADPTEASRNLARQGHT"
FT   gene            complement(1710594..1711831)
FT                   /gene="Fahd1"
FT                   /locus_tag="mCG_12833"
FT                   /note="gene_id=mCG12833.1"
FT   mRNA            complement(1710594..1711831)
FT                   /gene="Fahd1"
FT                   /locus_tag="mCG_12833"
FT                   /product="fumarylacetoacetate hydrolase domain containing
FT                   1"
FT                   /note="gene_id=mCG12833.1 transcript_id=mCT13701.1 created
FT                   on 29-MAY-2002"
FT   CDS             complement(1711112..1711795)
FT                   /codon_start=1
FT                   /gene="Fahd1"
FT                   /locus_tag="mCG_12833"
FT                   /product="fumarylacetoacetate hydrolase domain containing
FT                   1"
FT                   /note="gene_id=mCG12833.1 transcript_id=mCT13701.1
FT                   protein_id=mCP23173.1"
FT                   /protein_id="EDL22369.1"
FT                   /translation="MTQSCTMASTKPLSRFWEWGKNIVCVGRNYADHVKEMRSTVLSEP
FT                   VLFLKPSTAYAPEGSPVLMPAYCRNLHHEVELGVLLGKRGEAIPEAAAMDYVAGYALCL
FT                   DMTARDVQEECKKKGLPWTLAKSFTSSCPVSAFVPKEKIPDPHALRLWLKVNGELRQEG
FT                   KTSSMIFSIPYIISYVSKIITLEEGDLILTGTPKGVGPVKENDEIEAGIDGVVSMRFKV
FT                   KRSEY"
FT   gene            1711958..1725953
FT                   /gene="Hagh"
FT                   /locus_tag="mCG_132060"
FT                   /note="gene_id=mCG132060.0"
FT   mRNA            join(1711958..1712361,1714386..1714561,1715291..1715355,
FT                   1718290..1718407,1719165..1719273,1722509..1722612,
FT                   1722876..1722977,1725191..1725270,1725695..1725953)
FT                   /gene="Hagh"
FT                   /locus_tag="mCG_132060"
FT                   /product="hydroxyacyl glutathione hydrolase"
FT                   /note="gene_id=mCG132060.0 transcript_id=mCT133408.0
FT                   created on 29-MAY-2002"
FT   CDS             join(1712286..1712361,1714386..1714561,1715291..1715355,
FT                   1718290..1718407,1719165..1719273,1722509..1722612,
FT                   1722876..1722977,1725191..1725270,1725695..1725794)
FT                   /codon_start=1
FT                   /gene="Hagh"
FT                   /locus_tag="mCG_132060"
FT                   /product="hydroxyacyl glutathione hydrolase"
FT                   /note="gene_id=mCG132060.0 transcript_id=mCT133408.0
FT                   protein_id=mCP84659.1"
FT                   /db_xref="GOA:G5E8T9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="MGI:MGI:95745"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8T9"
FT                   /protein_id="EDL22370.1"
FT                   /translation="MVLGRGSLCLRSLSALGATCARRGLGQALLGLSLCHSDFRKNLTV
FT                   QQDIMKVELLPALTDNYMYLIIDEDTQEAAIVDPVQPQKVIEAAKKHRVKLTTVLTTHH
FT                   HWDHAGGNEKLVKLEPGLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGH
FT                   ICYFVSKPGSSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGH
FT                   EYTVNNLKFARHVEPGNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTV
FT                   QQHAGETDPVTTMRAIRREKDQFKVPRD"
FT   assembly_gap    1723644..1723739
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   gene            1739156..1743506
FT                   /gene="Igfals"
FT                   /locus_tag="mCG_12843"
FT                   /note="gene_id=mCG12843.3"
FT   mRNA            join(1739156..1739422,1741450..1743506)
FT                   /gene="Igfals"
FT                   /locus_tag="mCG_12843"
FT                   /product="insulin-like growth factor binding protein, acid
FT                   labile subunit, transcript variant mCT169662"
FT                   /note="gene_id=mCG12843.3 transcript_id=mCT169662.1 created
FT                   on 29-NOV-2004"
FT   CDS             join(1739224..1739422,1741450..1743245)
FT                   /codon_start=1
FT                   /gene="Igfals"
FT                   /locus_tag="mCG_12843"
FT                   /product="insulin-like growth factor binding protein, acid
FT                   labile subunit, isoform CRA_b"
FT                   /note="gene_id=mCG12843.3 transcript_id=mCT169662.1
FT                   protein_id=mCP92673.1 isoform=CRA_b"
FT                   /protein_id="EDL22372.1"
FT                   /translation="MAPNVPQAPEKLFFLKPSTALPGPSRVHSPHPGQGKGTELRQDWL
FT                   ECPSGHRFQALEEEAEMWLRQGSPALVVLLAFWVALGPCYLQGTDPGASADAEGPQCPV
FT                   TCTCSYDDYTDELSVFCSSRNLTQLPDGIPVSTRALWLDGNNLSSIPSAAFQNLSSLDF
FT                   LNLQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRL
FT                   EEGLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGEL
FT                   RELDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVA
FT                   GLLEDTFPGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIRQLGEKTFEGLG
FT                   QLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSC
FT                   LGRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQG
FT                   LGQLEYLLLSNNQLTMLSEDVLGPLQRAFWLDLSHNRLETPAEGLFSSLGRLRYLNLRN
FT                   NSLQTFVPQPGLERLWLDANPWDCSCPLKALRDFALQNPGVVPRFVQTVCEGDDCQPVY
FT                   TYNNITCAGPANVSGLDLRDISETLFVHC"
FT   mRNA            join(1740264..1740321,1741450..1743506)
FT                   /gene="Igfals"
FT                   /locus_tag="mCG_12843"
FT                   /product="insulin-like growth factor binding protein, acid
FT                   labile subunit, transcript variant mCT13711"
FT                   /note="gene_id=mCG12843.3 transcript_id=mCT13711.2 created
FT                   on 29-NOV-2004"
FT   CDS             join(1740306..1740321,1741450..1743245)
FT                   /codon_start=1
FT                   /gene="Igfals"
FT                   /locus_tag="mCG_12843"
FT                   /product="insulin-like growth factor binding protein, acid
FT                   labile subunit, isoform CRA_a"
FT                   /note="gene_id=mCG12843.3 transcript_id=mCT13711.2
FT                   protein_id=mCP23208.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:107973"
FT                   /db_xref="UniProtKB/TrEMBL:Q791Q5"
FT                   /protein_id="EDL22371.1"
FT                   /translation="MALRTGSPALVVLLAFWVALGPCYLQGTDPGASADAEGPQCPVTC
FT                   TCSYDDYTDELSVFCSSRNLTQLPDGIPVSTRALWLDGNNLSSIPSAAFQNLSSLDFLN
FT                   LQGSWLRSLEPQALLGLQNLYHLHLERNLLRSLAAGLFRHTPSLASLSLGNNLLGRLEE
FT                   GLFRGLSHLWDLNLGWNSLVVLPDTVFQGLGNLHELVLAGNKLTYLQPALLCGLGELRE
FT                   LDLSRNALRSVKANVFIHLPRLQKLYLDRNLITAVAPRAFLGMKALRWLDLSHNRVAGL
FT                   LEDTFPGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIRQLGEKTFEGLGQL
FT                   EVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSCLG
FT                   RIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLG
FT                   QLEYLLLSNNQLTMLSEDVLGPLQRAFWLDLSHNRLETPAEGLFSSLGRLRYLNLRNNS
FT                   LQTFVPQPGLERLWLDANPWDCSCPLKALRDFALQNPGVVPRFVQTVCEGDDCQPVYTY
FT                   NNITCAGPANVSGLDLRDISETLFVHC"
FT   gene            complement(1744155..1747870)
FT                   /gene="Nubp2"
FT                   /locus_tag="mCG_12799"
FT                   /note="gene_id=mCG12799.0"
FT   mRNA            complement(join(1744155..1744850,1745359..1745428,
FT                   1745678..1745788,1745944..1746098,1746961..1747159,
FT                   1747261..1747379,1747821..1747870))
FT                   /gene="Nubp2"
FT                   /locus_tag="mCG_12799"
FT                   /product="nucleotide binding protein 2"
FT                   /note="gene_id=mCG12799.0 transcript_id=mCT13667.1 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(1744705..1744850,1745359..1745428,
FT                   1745678..1745788,1745944..1746098,1746961..1747159,
FT                   1747261..1747379,1747821..1747848))
FT                   /codon_start=1
FT                   /gene="Nubp2"
FT                   /locus_tag="mCG_12799"
FT                   /product="nucleotide binding protein 2"
FT                   /note="gene_id=mCG12799.0 transcript_id=mCT13667.1
FT                   protein_id=mCP23221.1"
FT                   /protein_id="EDL22373.1"
FT                   /translation="MEAAAGERAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRH
FT                   QGKKVGILDVDLCGPSIPHMLRAQGKAVHQCDNGWVPVFVDQEQSISLMSVGFLLENPD
FT                   EAVVWRGPKKHALIKQFVSDVAWGQLDYLVVDTPPGTSDEHMATMEALRPYRPLGALVV
FT                   TTPQAVSIGDVRRELTFCKKTGLQVIGVIENMSGFTCPHCAECTNVFSSGSGEELARLA
FT                   GVPFLGSVPLDSQLTRSLEEGRDFIQEFPKSTAYSALTSIAQRVVHRMSALCS"
FT   gene            <1748250..1753565
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /note="gene_id=mCG12854.2"
FT   mRNA            join(<1748250..1748299,1749301..1749438,1751702..1751879,
FT                   1751987..1752174,1752252..1752354,1752430..1752555,
FT                   1752779..>1752908)
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, transcript variant mCT191660"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT191660.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1748252..1748299,1749301..1749438,1751702..1751879,
FT                   1751987..1752174,1752252..1752354,1752430..1752555,
FT                   1752779..>1752908)
FT                   /codon_start=1
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT191660.0
FT                   protein_id=mCP112633.0 isoform=CRA_a"
FT                   /protein_id="EDL22374.1"
FT                   /translation="GRNGKWVSAGGAFWPQVLSTMARRTRSSRAWHFVLSAARRDTDAR
FT                   AVALAGSSNWGYDSDGQHSDSDSDPEYSSLPPSIPSAVPVTGESFCDCEGQNEATFCNS
FT                   LHTAHRGKDCRCGEEDEDFDWVWDDLNKSSATLLSCDNRKVSFHMEYSCGTAAIRGTKE
FT                   LGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLH
FT                   HKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRLQNRRFYPMVCSTAA
FT                   KSSMKVIRSCASSTSLQYLCCYR"
FT   mRNA            join(<1748261..1748644,1749301..1749438,1751702..1751879,
FT                   1751987..1752174,1752252..1752354,1752430..1752560,
FT                   1752730..1753565)
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, transcript variant mCT191663"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT191663.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<1748261..1748644,1749301..1749438,1751702..1751879,
FT                   1751987..1752174,1752252..1752354,1752430..1752555,
FT                   1752779..1753565)
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, transcript variant mCT191662"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT191662.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1748261..1748644,1749301..1749438,1751702..1751879,
FT                   1751987..1752174,1752252..1752354,1752430..1752555,
FT                   1752779..1753122)
FT                   /codon_start=1
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT191662.0
FT                   protein_id=mCP112635.0 isoform=CRA_c"
FT                   /protein_id="EDL22376.1"
FT                   /translation="GKWVSAGGAFWPQVSRAGPARSGPAGGGLTLQAVKPATRCSLAVA
FT                   LGSLGGGLGVRRQGPHRCGEIREPLAREATFSPAEAERGYVQRHLWFIHWVPTVCSYTA
FT                   LSQPNCCGVLCAAPPGFFVNGRGEVLSTMARRTRSSRAWHFVLSAARRDTDARAVALAG
FT                   SSNWGYDSDGQHSDSDSDPEYSSLPPSIPSAVPVTGESFCDCEGQNEATFCNSLHTAHR
FT                   GKDCRCGEEDEDFDWVWDDLNKSSATLLSCDNRKVSFHMEYSCGTAAIRGTKELGDGQH
FT                   FWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKT
FT                   SFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRLQNRRFYPMVCSTAAKSSMKV
FT                   IRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVLHNKLGWVLSMNCNHWKS
FT                   PVPPPGTATPGAESLETRPCQRKRCRRS"
FT   CDS             join(<1748261..1748644,1749301..1749438,1751702..1751879,
FT                   1751987..1752174,1752252..1752354,1752430..1752560,
FT                   1752730..1752765)
FT                   /codon_start=1
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, isoform CRA_d"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT191663.0
FT                   protein_id=mCP112636.0 isoform=CRA_d"
FT                   /protein_id="EDL22377.1"
FT                   /translation="GKWVSAGGAFWPQVSRAGPARSGPAGGGLTLQAVKPATRCSLAVA
FT                   LGSLGGGLGVRRQGPHRCGEIREPLAREATFSPAEAERGYVQRHLWFIHWVPTVCSYTA
FT                   LSQPNCCGVLCAAPPGFFVNGRGEVLSTMARRTRSSRAWHFVLSAARRDTDARAVALAG
FT                   SSNWGYDSDGQHSDSDSDPEYSSLPPSIPSAVPVTGESFCDCEGQNEATFCNSLHTAHR
FT                   GKDCRCGEEDEDFDWVWDDLNKSSATLLSCDNRKVSFHMEYSCGTAAIRGTKELGDGQH
FT                   FWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKT
FT                   SFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGELPGSQPTWHLG"
FT   mRNA            join(<1748269..1748299,1749301..1749438,1751702..1751879,
FT                   1751987..1752354,1752430..1752555,1752779..1753562)
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, transcript variant mCT191661"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT191661.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1748690..1749109,1749301..1749438,1751702..1751879,
FT                   1751987..1752174,1752252..1752354,1752430..1752555,
FT                   1752779..1753565)
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, transcript variant mCT13722"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT13722.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(1749017..1749109,1749301..1749438,1751702..1751879,
FT                   1751987..1752174,1752252..1752354,1752430..1752555,
FT                   1752779..1753122)
FT                   /codon_start=1
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, isoform CRA_e"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT13722.1
FT                   protein_id=mCP23247.1 isoform=CRA_e"
FT                   /protein_id="EDL22378.1"
FT                   /translation="MGWDTSKVMGVWVVFYTIALGLIEVLRYSSQVLSTMARRTRSSRA
FT                   WHFVLSAARRDTDARAVALAGSSNWGYDSDGQHSDSDSDPEYSSLPPSIPSAVPVTGES
FT                   FCDCEGQNEATFCNSLHTAHRGKDCRCGEEDEDFDWVWDDLNKSSATLLSCDNRKVSFH
FT                   MEYSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLG
FT                   RDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATR
FT                   LQNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGL
FT                   KQVLHNKLGWVLSMNCNHWKSPVPPPGTATPGAESLETRPCQRKRCRRS"
FT   CDS             join(<1752078..1752354,1752430..1752555,1752779..1753122)
FT                   /codon_start=1
FT                   /gene="Spsb3"
FT                   /locus_tag="mCG_12854"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG12854.2 transcript_id=mCT191661.0
FT                   protein_id=mCP112634.0 isoform=CRA_b"
FT                   /protein_id="EDL22375.1"
FT                   /translation="LWHCSHSGHQGARGWPTLLGNQDDLSSVWHRHGKWPSKRVDAMGP
FT                   AARHLTVQAHYLQMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSF
FT                   SSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRLQNRRFYPMVCSTAAKSSMKVIR
FT                   SCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVLHNKLGWVLSMNCNHWKSPV
FT                   PPPGTATPGAESLETRPCQRKRCRRS"
FT   gene            complement(1753567..>1756483)
FT                   /locus_tag="mCG_12807"
FT                   /note="gene_id=mCG12807.2"
FT   mRNA            complement(join(1753567..1754362,1754457..1754572,
FT                   1754723..1754816,1754969..1755060,1755550..1755642,
FT                   1755990..1756126,1756241..1756483))
FT                   /locus_tag="mCG_12807"
FT                   /product="mCG12807, transcript variant mCT13675"
FT                   /note="gene_id=mCG12807.2 transcript_id=mCT13675.2 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1753574..1754362,1754457..1754572,
FT                   1754723..1754816,1754969..1755060,1755550..1755642,
FT                   1755990..1756175,1756275..>1756483))
FT                   /locus_tag="mCG_12807"
FT                   /product="mCG12807, transcript variant mCT191710"
FT                   /note="gene_id=mCG12807.2 transcript_id=mCT191710.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1754065..1754362,1754457..1754572,
FT                   1754723..1754816,1754969..1755060,1755550..1755642,
FT                   1755990..1756126,1756241..1756469))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12807"
FT                   /product="mCG12807, isoform CRA_a"
FT                   /note="gene_id=mCG12807.2 transcript_id=mCT13675.2
FT                   protein_id=mCP23284.2 isoform=CRA_a"
FT                   /protein_id="EDL22379.1"
FT                   /translation="MAEVGPGRVTVSRLGRGLRLGHRRPQTWEISDSDGEGVPAREVGT
FT                   QAPSPAGERRAAAKALRADQVLGRLVVCVDPAVLEDAGSDILMEALGTLGCECRIEPQH
FT                   QARSLQWNVVRPDPAPSNVPLEAKAENEQEQLLLLEPQEFLQGAAQLTQITDPPCSIPW
FT                   LSPKSLTRSHLAVIGLDAYLWSHQLSSQKTWQLKKSKEAHARGAISWAEVEEILVLLQL
FT                   HANLDVLLMASWQELSQYVCAFTRALSQLPSKQLRDSQAFSFCTAGHWASGQQVTRDGS
FT                   GLRGVWWRQIRQFNRVSPAVADAVVTAFPSPRLLQQVSPLNPSFQDQDLPSTPHTCAYS
FT                   RLSWTAAQSKNA"
FT   CDS             complement(join(1754065..1754362,1754457..1754572,
FT                   1754723..1754816,1754969..1755060,1755550..1755642,
FT                   1755990..>1756151))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12807"
FT                   /product="mCG12807, isoform CRA_b"
FT                   /note="gene_id=mCG12807.2 transcript_id=mCT191710.0
FT                   protein_id=mCP112663.0 isoform=CRA_b"
FT                   /protein_id="EDL22380.1"
FT                   /translation="LNVACWDPAVLEDAGSDILMEALGTLGCECRIEPQHQARSLQWNV
FT                   VRPDPAPSNVPLEAKAENEQEQLLLLEPQEFLQGAAQLTQITDPPCSIPWLSPKSLTRS
FT                   HLAVIGLDAYLWSHQLSSQKTWQLKKSKEAHARGAISWAEVEEILVLLQLHANLDVLLM
FT                   ASWQELSQYVCAFTRALSQLPSKQLRDSQAFSFCTAGHWASGQQVTRDGSGLRGVWWRQ
FT                   IRQFNRVSPAVADAVVTAFPSPRLLQQVSPLNPSFQDQDLPSTPHTCAYSRLSWTAAQS
FT                   KNA"
FT   gene            <1756540..1757704
FT                   /gene="Mrps34"
FT                   /locus_tag="mCG_12797"
FT                   /note="gene_id=mCG12797.1"
FT   mRNA            join(<1756540..1756908,1757081..1757123,1757207..1757693)
FT                   /gene="Mrps34"
FT                   /locus_tag="mCG_12797"
FT                   /product="mitochondrial ribosomal protein S34, transcript
FT                   variant mCT13665"
FT                   /note="gene_id=mCG12797.1 transcript_id=mCT13665.0 created
FT                   on 29-MAY-2002"
FT   CDS             join(<1756555..1756908,1757081..1757123,1757207..1757499)
FT                   /codon_start=1
FT                   /gene="Mrps34"
FT                   /locus_tag="mCG_12797"
FT                   /product="mitochondrial ribosomal protein S34, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12797.1 transcript_id=mCT13665.0
FT                   protein_id=mCP23141.0 isoform=CRA_a"
FT                   /protein_id="EDL22381.1"
FT                   /translation="SADFLWSKDTDMARKKVRPRLIAELARRVRALREQRNQPRDSQLY
FT                   ALDYETLTRPHSGRRLPVRAWADVRRESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPC
FT                   YWRLTRVRPDYTAQNLDHGRAWGILTFKGKSEDTAREIEQVMYHDWRLVPKHEEEAFTA
FT                   FTAKPEDRLNSVPYPPLLRAMILAERQKNGDTSVQEPLLNLERTRMRPWDYPAKQETKG
FT                   RAKGTPV"
FT   mRNA            1756574..1757704
FT                   /gene="Mrps34"
FT                   /locus_tag="mCG_12797"
FT                   /product="mitochondrial ribosomal protein S34, transcript
FT                   variant mCT169680"
FT                   /note="gene_id=mCG12797.1 transcript_id=mCT169680.0 created
FT                   on 29-MAY-2002"
FT   CDS             1757134..1757499
FT                   /codon_start=1
FT                   /gene="Mrps34"
FT                   /locus_tag="mCG_12797"
FT                   /product="mitochondrial ribosomal protein S34, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG12797.1 transcript_id=mCT169680.0
FT                   protein_id=mCP92692.0 isoform=CRA_b"
FT                   /protein_id="EDL22382.1"
FT                   /translation="MLVGAGDGSHIIQPAGSQLLFFPSGKSEDTAREIEQVMYHDWRLV
FT                   PKHEEEAFTAFTAKPEDRLNSVPYPPLLRAMILAERQKNGDTSVQEPLLNLERTRMRPW
FT                   DYPAKQETKGRAKGTPV"
FT   gene            1757925..1758932
FT                   /gene="Nme3"
FT                   /locus_tag="mCG_12803"
FT                   /note="gene_id=mCG12803.0"
FT   mRNA            join(1757925..1757978,1758057..1758187,1758281..1758382,
FT                   1758457..1758569,1758643..1758932)
FT                   /gene="Nme3"
FT                   /locus_tag="mCG_12803"
FT                   /product="expressed in non-metastatic cells 3"
FT                   /note="gene_id=mCG12803.0 transcript_id=mCT13671.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(1757933..1757978,1758057..1758187,1758281..1758382,
FT                   1758457..1758569,1758643..1758760)
FT                   /codon_start=1
FT                   /gene="Nme3"
FT                   /locus_tag="mCG_12803"
FT                   /product="expressed in non-metastatic cells 3"
FT                   /note="gene_id=mCG12803.0 transcript_id=mCT13671.1
FT                   protein_id=mCP23186.1"
FT                   /protein_id="EDL22383.1"
FT                   /translation="MICLVLTIFANLFPSAYSGVNERTFLAVKPDGVQRRLVGEIVRRF
FT                   ERKGFKLVALKLVQASEELLREHYVELREKPFYSRLVKYMSSGPVVAMVWQGLDVVHAS
FT                   RALIGATDPGDAMPGTIRGDFCVEVGKNVIHGSDSVESAHREIALWFREAELLCWEDSA
FT                   GHWLYE"
FT   gene            complement(1758963..>1798224)
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /note="gene_id=mCG17657.2"
FT   mRNA            complement(join(1758963..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779521..1779572,1785244..1785335,1785575..1785645,
FT                   1789241..1789361,1797790..>1798182))
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, transcript variant mCT191700"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191700.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1758983..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779428..1779572,1785244..1785335,1785575..1785645,
FT                   1789241..1789361,1797790..>1798224))
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, transcript variant mCT191696"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191696.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1758983..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1770593..1770604,1774201..1774319,1774984..1775086,
FT                   1775907..1776153,1779428..1779572,1785244..1785335,
FT                   1785575..1785645,1789241..1789361,1797790..1798224))
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, transcript variant mCT14928"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT14928.2 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(1760228..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779521..1779569,1785244..1785335,1785575..1785645,
FT                   1789241..1789361,1797790..>1798213))
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, transcript variant mCT191699"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191699.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1760377..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779521..1779569,1785244..1785335,1785575..1785645,
FT                   1789241..1789361,1797790..>1798173))
FT                   /codon_start=1
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, isoform CRA_e"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191699.0
FT                   protein_id=mCP112590.0 isoform=CRA_e"
FT                   /protein_id="EDL22388.1"
FT                   /translation="GDSGPWIRAPERAALAAAAVAAMMEIQMDEGGGVVVYQDDYCSGS
FT                   VMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELEL
FT                   LREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAK
FT                   NYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGR
FT                   RKERPTSLNVFPLADGMCPNDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNE
FT                   SLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTP
FT                   ELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLVRDD
FT                   FFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVK
FT                   LENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMAR
FT                   VLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPA
FT                   KRSYPSVNIHYKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQYR
FT                   QVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKL
FT                   WCAAGVNLSGWKPHEEDSSNGPKPVPGRDPLTCDREGEGEPKSTHPSPEKKKAKETPEA
FT                   DATSSRVWILTSTLTTSKVVIIDANQPGTIVDQFTVCNAHVLCISSIPAASDSDYPPGE
FT                   MFLDSDVNPEDSGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGDVATTANG
FT                   KVNPSQSTEEATEATEVPDPGPSESEATTVRPGPLTEHVFTDPAPTPSSSTQPASENGS
FT                   ESNGTIVQPQVEPSGELSTTTSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSV
FT                   LSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVNDRVWC
FT                   GYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQ
FT                   HLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHR
FT                   GQLLGLRANKTSPTSGEGTRPGGIIHVYGDDSSDKAASSFIPYCSMAQAQLCFHGHRDA
FT                   VKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAADAEGQKLKNALVLSGGEGYIDFRIG
FT                   DGEDDETEECAGDVNQTKPSLSKAERSHIIVWQVSYTPE"
FT   CDS             complement(join(1760377..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779521..1779572,1785244..1785335,1785575..1785645,
FT                   1789241..1789361,1797790..>1798173))
FT                   /codon_start=1
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, isoform CRA_f"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191700.0
FT                   protein_id=mCP112591.0 isoform=CRA_f"
FT                   /protein_id="EDL22389.1"
FT                   /translation="GDSGPWIRAPERAALAAAAVAAMMEIQMDEGGGVVVYQDDYCSGS
FT                   VMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELEL
FT                   LREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAK
FT                   NYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGR
FT                   SRKERPTSLNVFPLADGMCPNDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLN
FT                   ESLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDST
FT                   PELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLVRD
FT                   DFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKV
FT                   KLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMA
FT                   RVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPP
FT                   AKRSYPSVNIHYKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQY
FT                   RQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTK
FT                   LWCAAGVNLSGWKPHEEDSSNGPKPVPGRDPLTCDREGEGEPKSTHPSPEKKKAKETPE
FT                   ADATSSRVWILTSTLTTSKVVIIDANQPGTIVDQFTVCNAHVLCISSIPAASDSDYPPG
FT                   EMFLDSDVNPEDSGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGDVATTAN
FT                   GKVNPSQSTEEATEATEVPDPGPSESEATTVRPGPLTEHVFTDPAPTPSSSTQPASENG
FT                   SESNGTIVQPQVEPSGELSTTTSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDS
FT                   VLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVNDRVW
FT                   CGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTH
FT                   QHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLH
FT                   RGQLLGLRANKTSPTSGEGTRPGGIIHVYGDDSSDKAASSFIPYCSMAQAQLCFHGHRD
FT                   AVKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAADAEGQKLKNALVLSGGEGYIDFRI
FT                   GDGEDDETEECAGDVNQTKPSLSKAERSHIIVWQVSYTPE"
FT   CDS             complement(join(1760377..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779428..1779572,1785244..1785335,1785575..1785645,
FT                   1789241..1789361,1797790..>1798173))
FT                   /codon_start=1
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191696.0
FT                   protein_id=mCP112659.0 isoform=CRA_b"
FT                   /protein_id="EDL22385.1"
FT                   /translation="GDSGPWIRAPERAALAAAAVAAMMEIQMDEGGGVVVYQDDYCSGS
FT                   VMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELEL
FT                   LREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAK
FT                   NYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGR
FT                   SRKERPTSLNVFPLADGMVRAQMGGKLVPAGDHWHLSDLGQLQSSSSYQCPNDEMSESG
FT                   QSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYVSVTKNNKQAREKRNSRNM
FT                   EVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRLERTGSSPTQGIVNKAFG
FT                   INTDSLYHELSTAGSEVIGDVDEGADLLVRDDFFGMGKEVGNLLLENSQLLETKNALNV
FT                   VKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPR
FT                   EEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRA
FT                   SREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYKSPTAAGFSQRRSHAL
FT                   CQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQL
FT                   SPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAAGVNLSGWKPHEEDSSNGPKPVPG
FT                   RDPLTCDREGEGEPKSTHPSPEKKKAKETPEADATSSRVWILTSTLTTSKVVIIDANQP
FT                   GTIVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDSGADGVLAGITLVGCA
FT                   TRCNVPRSNCSSRGDTPVLDKGQGDVATTANGKVNPSQSTEEATEATEVPDPGPSESEA
FT                   TTVRPGPLTEHVFTDPAPTPSSSTQPASENGSESNGTIVQPQVEPSGELSTTTSSAAPT
FT                   MWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGED
FT                   GQWDLSNYHLMDLGHPHHSIRCMAVVNDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRE
FT                   SQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRI
FT                   TALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGTRPGGIIHV
FT                   YGDDSSDKAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSEGP
FT                   GPAAPAADAEGQKLKNALVLSGGEGYIDFRIGDGEDDETEECAGDVNQTKPSLSKAERS
FT                   HIIVWQVSYTPE"
FT   mRNA            complement(join(<1760377..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779428..1779569,1785244..1785335,1785575..1785645,
FT                   1789241..1789361,1797790..>1798107))
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, transcript variant mCT191697"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191697.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<1760377..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779521..1779572,1781896..1781919,1785244..1785335,
FT                   1785575..1785645,1789241..1789361,1797790..>1798107))
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, transcript variant mCT191698"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191698.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1760377..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779428..1779569,1785244..1785335,1785575..1785645,
FT                   1789241..1789361,1797790..1798107))
FT                   /codon_start=1
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191697.0
FT                   protein_id=mCP112660.0 isoform=CRA_c"
FT                   /protein_id="EDL22386.1"
FT                   /translation="MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIH
FT                   CYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQA
FT                   EEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNA
FT                   LHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGRRKERPTSLNVFPLADGMVRAQM
FT                   GGKLVPAGDHWHLSDLGQLQSSSSYQCPNDEMSESGQSSAAATPSTTGTKSNTPTSSVP
FT                   SAAVTPLNESLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSD
FT                   VQDIIDSTPELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDE
FT                   GADLLVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGEL
FT                   EAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRR
FT                   RFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLF
FT                   SSSSSPPPAKRSYPSVNIHYKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSAR
FT                   REQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPL
FT                   VEKDPSTKLWCAAGVNLSGWKPHEEDSSNGPKPVPGRDPLTCDREGEGEPKSTHPSPEK
FT                   KKAKETPEADATSSRVWILTSTLTTSKVVIIDANQPGTIVDQFTVCNAHVLCISSIPAA
FT                   SDSDYPPGEMFLDSDVNPEDSGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQ
FT                   GDVATTANGKVNPSQSTEEATEATEVPDPGPSESEATTVRPGPLTEHVFTDPAPTPSSS
FT                   TQPASENGSESNGTIVQPQVEPSGELSTTTSSAAPTMWLGAQNGWLYVHSAVANWKKCL
FT                   HSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCM
FT                   AVVNDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTL
FT                   RLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIP
FT                   LTETVVLHRGQLLGLRANKTSPTSGEGTRPGGIIHVYGDDSSDKAASSFIPYCSMAQAQ
FT                   LCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAADAEGQKLKNALVLSGG
FT                   EGYIDFRIGDGEDDETEECAGDVNQTKPSLSKAERSHIIVWQVSYTPE"
FT   CDS             complement(join(1760377..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1770593..1770604,1774201..1774319,1774984..1775086,
FT                   1775907..1776153,1779428..1779572,1785244..1785335,
FT                   1785575..1785645,1789241..1789361,1797790..1798107))
FT                   /codon_start=1
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT14928.2
FT                   protein_id=mCP23126.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UHB5"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019143"
FT                   /db_xref="InterPro:IPR032486"
FT                   /db_xref="InterPro:IPR034743"
FT                   /db_xref="InterPro:IPR034744"
FT                   /db_xref="MGI:MGI:1353598"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UHB5"
FT                   /protein_id="EDL22384.1"
FT                   /translation="MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIH
FT                   CYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQA
FT                   EEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNA
FT                   LHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGRSRKERPTSLNVFPLADGMVRAQ
FT                   MGGKLVPAGDHWHLSDLGQLQSSSSYQCPNDEMSESGQSSAAATPSTTGTKSNTPTSSV
FT                   PSAAVTPLNESLQPLGDYVSVTKNNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWS
FT                   DVQDIIDSTPELDVCPETRLERTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVD
FT                   EGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEV
FT                   LKGELEAAKQAKVKLENRIKELEEELKRVKSEAVTARREPREEVEDVSSYLCTELDKIP
FT                   MAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQF
FT                   FSRLFSSSSSPPPAKRSYPSVNIHYKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDC
FT                   TSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPV
FT                   YCRPLVEKDPSTKLWCAAGVNLSGWKPHEEDSSNGPKPVPGRDPLTCDREGEGEPKSTH
FT                   PSPEKKKAKETPEADATSSRVWILTSTLTTSKVVIIDANQPGTIVDQFTVCNAHVLCIS
FT                   SIPAASDSDYPPGEMFLDSDVNPEDSGADGVLAGITLVGCATRCNVPRSNCSSRGDTPV
FT                   LDKGQGDVATTANGKVNPSQSTEEATEATEVPDPGPSESEATTVRPGPLTEHVFTDPAP
FT                   TPSSSTQPASENGSESNGTIVQPQVEPSGELSTTTSSAAPTMWLGAQNGWLYVHSAVAN
FT                   WKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHH
FT                   SIRCMAVVNDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIR
FT                   LDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLIAGNRLWVGTGNGV
FT                   VISIPLTETVVLHRGQLLGLRANKTSPTSGEGTRPGGIIHVYGDDSSDKAASSFIPYCS
FT                   MAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPSEGPGPAAPAADAEGQKLKNAL
FT                   VLSGGEGYIDFRIGDGEDDETEECAGDVNQTKPSLSKAERSHIIVWQVSYTPE"
FT   CDS             complement(join(1760377..1760498,1760574..1760723,
FT                   1760825..1761004,1761104..1761142,1761265..1761378,
FT                   1761591..1761762,1761927..1762075,1762217..1762284,
FT                   1762368..1762448,1762535..1762654,1762769..1762958,
FT                   1763034..1763216,1763708..1763873,1764434..1764592,
FT                   1764719..1764814,1765355..1765481,1766079..1766249,
FT                   1766337..1766393,1766598..1766728,1767578..1767659,
FT                   1768240..1768392,1768760..1768817,1769854..1769871,
FT                   1774201..1774319,1774984..1775086,1775907..1776153,
FT                   1779521..1779572,1781896..1781919,1785244..1785335,
FT                   1785575..1785645,1789241..1789361,1797790..1798107))
FT                   /codon_start=1
FT                   /gene="Mapk8ip3"
FT                   /locus_tag="mCG_17657"
FT                   /product="mitogen-activated protein kinase 8 interacting
FT                   protein 3, isoform CRA_d"
FT                   /note="gene_id=mCG17657.2 transcript_id=mCT191698.0
FT                   protein_id=mCP112589.0 isoform=CRA_d"
FT                   /protein_id="EDL22387.1"
FT                   /translation="MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIH
FT                   CYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQA
FT                   EEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNA
FT                   LHQRHTEMIQTYVEHIERSKMQQVGGSGQTESSLPGRSPRQSWRKSRKERPTSLNVFPL
FT                   ADGMCPNDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYVSVTK
FT                   NNKQAREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRLERT
FT                   GSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLVRDDFFGMGKEVGNLLL
FT                   ENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELK
FT                   RVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLM
FT                   ELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYKS
FT                   PTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRL
FT                   QACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAAGVNLSGWKP
FT                   HEEDSSNGPKPVPGRDPLTCDREGEGEPKSTHPSPEKKKAKETPEADATSSRVWILTST
FT                   LTTSKVVIIDANQPGTIVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDSG
FT                   ADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGDVATTANGKVNPSQSTEEATE
FT                   ATEVPDPGPSESEATTVRPGPLTEHVFTDPAPTPSSSTQPASENGSESNGTIVQPQVEP
FT                   SGELSTTTSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVA
FT                   LADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVNDRVWCGYKNKVHVIQPKT
FT                   MQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSK
FT                   MLGTGKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSP
FT                   TSGEGTRPGGIIHVYGDDSSDKAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLA
FT                   TLNGSVLDSPSEGPGPAAPAADAEGQKLKNALVLSGGEGYIDFRIGDGEDDETEECAGD
FT                   VNQTKPSLSKAERSHIIVWQVSYTPE"
FT   gene            complement(1800513..1800823)
FT                   /locus_tag="mCG_1033961"
FT                   /note="gene_id=mCG1033961.0"
FT   mRNA            complement(join(1800513..1800572,1800596..1800823))
FT                   /locus_tag="mCG_1033961"
FT                   /product="mCG1033961"
FT                   /note="gene_id=mCG1033961.0 transcript_id=mCT151665.1
FT                   created on 30-MAY-2002"
FT   CDS             complement(1800642..1800773)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033961"
FT                   /product="mCG1033961"
FT                   /note="gene_id=mCG1033961.0 transcript_id=mCT151665.1
FT                   protein_id=mCP84651.1"
FT                   /protein_id="EDL22390.1"
FT                   /translation="MAQCLRALAMLAEDLRSVLRTHMVTHNCNSSFGRSNDSGLYGH"
FT   gene            complement(1803803..1822892)
FT                   /locus_tag="mCG_17661"
FT                   /note="gene_id=mCG17661.1"
FT   mRNA            complement(join(1803803..1806315,1807222..1807270,
FT                   1810259..1810401,1818285..1818433,1822819..1822892))
FT                   /locus_tag="mCG_17661"
FT                   /product="mCG17661"
FT                   /note="gene_id=mCG17661.1 transcript_id=mCT14932.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(1806128..1806315,1807222..1807270,
FT                   1810259..1810401,1818285..1818433,1822819..1822862))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17661"
FT                   /product="mCG17661"
FT                   /note="gene_id=mCG17661.1 transcript_id=mCT14932.1
FT                   protein_id=mCP23270.1"
FT                   /db_xref="GOA:Q3TM10"
FT                   /db_xref="InterPro:IPR033335"
FT                   /db_xref="MGI:MGI:1196260"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TM10"
FT                   /protein_id="EDL22391.1"
FT                   /translation="MFQGADSQAGKSGSRSMKPPGGESSDLFGSPEEGISSSKPNRMAS
FT                   NIFGPTEEPKNIPKRTNPPGGKGSGIFDESTPVQTRQRLNPPGGKTSDIFGSPVTATAP
FT                   LAHPNKPKDHVLLCEGEDSKSDLKAATDSTPRGEQSDKGSSKEVEHAKIPEPTPTVDSH
FT                   EPRLGPRPRSHNKVLNPPGGKSSLSFY"
FT   gene            complement(1809189..1810171)
FT                   /locus_tag="mCG_147768"
FT                   /note="gene_id=mCG147768.0"
FT   mRNA            complement(1809189..1810171)
FT                   /locus_tag="mCG_147768"
FT                   /product="mCG147768"
FT                   /note="gene_id=mCG147768.0 transcript_id=mCT188031.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1809335..1809622)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147768"
FT                   /product="mCG147768"
FT                   /note="gene_id=mCG147768.0 transcript_id=mCT188031.0
FT                   protein_id=mCP108946.0"
FT                   /protein_id="EDL22392.1"
FT                   /translation="MCPCYLCLSCHVLVVHFLSGLFPPPLVSSLFSTLFSLPATPSQVT
FT                   KNLPARLLSIVWCVRGSPGAALENQQHQTNPHTVSLDHCSTPAASPASPG"
FT   gene            complement(1823479..1844514)
FT                   /locus_tag="mCG_147763"
FT                   /note="gene_id=mCG147763.0"
FT   mRNA            complement(join(1823479..1827208,1830950..1831095,
FT                   1832424..1832588,1833395..1833626,1834038..1834103,
FT                   1834783..1834961,1835206..1835310,1836407..1836488,
FT                   1839025..1839099,1839189..1839370,1841181..1841358,
FT                   1843951..1844514))
FT                   /locus_tag="mCG_147763"
FT                   /product="mCG147763"
FT                   /note="gene_id=mCG147763.0 transcript_id=mCT188026.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(1827044..1827208,1830950..1831095,
FT                   1832424..1832588,1833395..1833626,1834038..1834103,
FT                   1834783..1834961,1835206..1835310,1836407..1836488,
FT                   1839025..1839099,1839189..1839370,1841181..1841358,
FT                   1843951..1844136))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147763"
FT                   /product="mCG147763"
FT                   /note="gene_id=mCG147763.0 transcript_id=mCT188026.0
FT                   protein_id=mCP108940.0"
FT                   /protein_id="EDL22393.1"
FT                   /translation="MMGKPTKLQLEYDWLAVLGPESQAPTAQGQTALSRSSPSALHQQR
FT                   LLSCLLRLISTEVHPKMAFEANTASTASVRPTQEEQSTTPPGKVVTINSRSPRCSRNPS
FT                   TLRSNKTFPSASAPCSPGLRNPPRPLLVAGPSSTGSSDSDGGLFAVPTTLPPNSRHGKL
FT                   FSPSKEAELTFRQHLDSISIQSDFFSPKPKKLRKRHLRKPLVVQRTLLPRPSENQSHNV
FT                   CSFSILSNSPIAGRGWFRPIQSSLTKAALSRPIVPKVLPSQATSHLPSAIDLAAQSAGI
FT                   IPGSPLPILDTDGSSGISPLSSEQATTAISGQGDTGPHQNRDPVTAVRGTNDPFISVTR
FT                   PEQEPMTDGFQGSPALTLPELSKANLQNGLSIPLPSSESSSTRLSPPNVSALLDISLPG
FT                   PPEDVLSQGEPATQISDSIIEIAISSGQYSEGVPLSPAKLNGSDSSKSLPSPSSSPQPN
FT                   WIASPTHDPQWYPSDSTDSSLSSLFASFISPEKSRKMLPTTVGANSGTSLLGPSLLDGN
FT                   SRDSFVSRSLADVAEVVDSQLVCMMNENSIDYISRFNDLAQELSITEPGRREVLFDGGG
FT                   GGNPVGDLSQ"
FT   gene            complement(<1872967..>1875687)
FT                   /locus_tag="mCG_17658"
FT                   /note="gene_id=mCG17658.1"
FT   mRNA            complement(join(<1872967..1873076,1875336..>1875687))
FT                   /locus_tag="mCG_17658"
FT                   /product="mCG17658"
FT                   /note="gene_id=mCG17658.1 transcript_id=mCT14929.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(1872967..1873076,1875336..1875687))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17658"
FT                   /product="mCG17658"
FT                   /note="gene_id=mCG17658.1 transcript_id=mCT14929.1
FT                   protein_id=mCP23161.1"
FT                   /protein_id="EDL22394.1"
FT                   /translation="MTVKLGDAGSGEEGLKKLGKRTADEESLDGEGPGGADAADSSSTK
FT                   RDGQTPRASGAPAPPRGLPTPSPPQGSPQDQHHFLRSSVRPQSKRPRKDAPCALGSGGA
FT                   SGSGPRGKGRDLSLAVSLLVPSSKSHCDGSLGRVTYGEEGGPPCLVVSA"
FT   gene            1880440..1959095
FT                   /locus_tag="mCG_17645"
FT                   /note="gene_id=mCG17645.1"
FT   mRNA            join(1880440..1880600,1882190..1882411,1887210..1887331,
FT                   1887464..1887606,1890452..1890627,1893722..1893813,
FT                   1894723..1894829,1895529..1895674,1897319..1897522,
FT                   1897883..1897955,1898570..1898661,1905475..1905602,
FT                   1905928..1906045,1908448..1908578,1910324..1910492,
FT                   1911830..1911961,1915621..1915820,1946471..1946648,
FT                   1947504..1947690,1948117..1948255,1948431..1948563,
FT                   1949016..1949159,1950259..1950387,1950511..1950693,
FT                   1951901..1952107,1952380..1952592,1952675..1952841,
FT                   1954240..1954381,1958342..1959095)
FT                   /locus_tag="mCG_17645"
FT                   /product="mCG17645, transcript variant mCT14897"
FT                   /note="gene_id=mCG17645.1 transcript_id=mCT14897.1 created
FT                   on 30-MAY-2002"
FT   CDS             join(1880454..1880600,1882190..1882411,1887210..1887331,
FT                   1887464..1887606,1890452..1890627,1893722..1893813,
FT                   1894723..1894829,1895529..1895674,1897319..1897522,
FT                   1897883..1897955,1898570..1898661,1905475..1905602,
FT                   1905928..1906045,1908448..1908578,1910324..1910492,
FT                   1911830..1911961,1915621..1915820,1946471..1946648,
FT                   1947504..1947690,1948117..1948255,1948431..1948563,
FT                   1949016..1949159,1950259..1950387,1950511..1950693,
FT                   1951901..1952107,1952380..1952592,1952675..1952841,
FT                   1954240..1954381,1958342..1958551)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17645"
FT                   /product="mCG17645, isoform CRA_a"
FT                   /note="gene_id=mCG17645.1 transcript_id=mCT14897.1
FT                   protein_id=mCP23234.2 isoform=CRA_a"
FT                   /protein_id="EDL22395.1"
FT                   /translation="MALYFDHRIKAPDTPSSPSHITWHPTHPFLAVASISPSSGGNVDI
FT                   YLEQGEPVPDTHIERSFQATSLCWHPTRLILAIGWETGEVIMFNKQDKEQHTVPLPHTT
FT                   DIAILSWSTSGSCLVSGDKLGVLLLWRLDQRGRVQGTPLLKHEYGKALTHCIFRLPPPG
FT                   EDLVQLAKAAVSGDEKALDMFNWRKSSFGSFLKTGSQEGLSFFVSLMDGTVHYVDEKGK
FT                   TAQVASTDSSIQTLFYIERREALVVVTENLLLSLYVVTPEGEAEEVMKVKLSGKTGCRA
FT                   DITLIEGSLLVTAIGEPVLRFWDLERGENYILSLQEKFGFEKGESINCVCFCKAKGLLA
FT                   AGTNKGRVAMWKKVPSFPNGRGAEGKDMWALQTPTELEGNITQIKWGSRKNLLAVSSTE
FT                   SVSILSEQAMSSHFHQQVAAVQISPSLVNVSFLSTGGTHSLHTDMHISGVFATKDAVAV
FT                   WNGKQVAIFEPSGSTLRNAGTFLCETSVLAMHEESIYTVEPNRLQVRTWQGTVKQLLLF
FT                   SETEGSPCFLDVCGTFLVAGTDLAHFKSFDLSRREAKVHCSCKNLAQLVPDVGSITSLR
FT                   CNANGNKISILLSKVNNSPDSKIYIYDVEMDTVNVFNFTTGQIGQIQALPFNEPPTNET
FT                   RSFMDKSLAGYTPVNHFWDQSEPRLFVCEALQEAPGAQPQAVDKQPRVEEGTCHKEEVL
FT                   ILSFFASEEHGFLLHDSFPRPSTYQSLLGMEVPHYYFTKKPGEADKEDRVDSGYYHIPQ
FT                   MVAKRPLRDFVGLEDCDKSTRDAMLNFSFFVTIGDMDEAFKSIKLIKSEAVWENMARMC
FT                   VKTQRLDVAKVCLGNMGHARGARALREAEQEPELEARVAMLAIQLGMLEEAEQLYKKCK
FT                   RYDLLNKFYQASDQWQKAVEVAELHDRVHLRTTYYNYAKHLEASADCGQALKPLIMQQN
FT                   GSFSFHSYEKSDTHRFEVPRMLSEDLQSLELYINRMKDKTLWRWWAQYLESQAEMDTAL
FT                   RYYELAQDYFSLVRIHCFQGNIQKAAEIANETGDWAASYHLARQYESQDEVKQAVHFYT
FT                   RAQAFNNAIRLCKENSLDDQLMNLALLSSPEDMIEAARYYEEKGEQMDRAVMLYHKAGH
FT                   FSKALELAFTTQQFAALQLIAEDLDEKSDPALLARCSDFCIEHRQFEKAVELLLAAKKY
FT                   HEALQLCLEQNMTITEDMAEKMTVSKDSKDMSEESRRELLEQIANCCMRQGNYHLATKK
FT                   YTQAGNKLKAMRALLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDWRKEPEIMKSII
FT                   SFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLSKAKTKNPLDQETKL
FT                   AQLQSKMTLVKRFIQARRTYTEDPKESLRQCELLLEEPDLDSTIRVGDVYGFLVEHHVQ
FT                   MEEYQMAYKYLEEMRKRLPSANMSYYVDQRTVDTVHQGLGLLPPSRIMPERVRHNSMED
FT                   HKEVYEEVIEEVDNDP"
FT   mRNA            join(<1887300..1887331,1887464..1887606,1890452..1890627,
FT                   1893722..1893813,1894723..1894829,1895529..1895674,
FT                   1897319..1897522,1897883..1897955,1898570..1898661,
FT                   1905475..1905602,1905928..1906045,1908448..1908578,
FT                   1910324..1910492,1911830..1911961,1915621..1915820,
FT                   1946471..1946648,1947504..1947694,1948160..1948255,
FT                   1948431..1948563,1949016..1949159,1950259..1950387,
FT                   1950511..1950693,1951901..1952107,1952380..1952592,
FT                   1952675..1952841,1954240..1956335)
FT                   /locus_tag="mCG_17645"
FT                   /product="mCG17645, transcript variant mCT191643"
FT                   /note="gene_id=mCG17645.1 transcript_id=mCT191643.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1887300..1887331,1887464..1887606,1890452..1890627,
FT                   1893722..1893813,1894723..1894829,1895529..1895674,
FT                   1897319..1897522,1897883..1897955,1898570..1898661,
FT                   1905475..1905602,1905928..1906045,1908448..1908578,
FT                   1910324..1910492,1911830..1911961,1915621..1915820,
FT                   1946471..1946648,1947504..1947694,1948160..1948255,
FT                   1948431..1948563,1949016..1949159,1950259..1950387,
FT                   1950511..1950693,1951901..1952107,1952380..1952592,
FT                   1952675..1952841,1954240..1954459)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17645"
FT                   /product="mCG17645, isoform CRA_b"
FT                   /note="gene_id=mCG17645.1 transcript_id=mCT191643.0
FT                   protein_id=mCP112657.0 isoform=CRA_b"
FT                   /protein_id="EDL22396.1"
FT                   /translation="HCIFRLPPPGEDLVQLAKAAVSGDEKALDMFNWRKSSFGSFLKTG
FT                   SQEGLSFFVSLMDGTVHYVDEKGKTAQVASTDSSIQTLFYIERREALVVVTENLLLSLY
FT                   VVTPEGEAEEVMKVKLSGKTGCRADITLIEGSLLVTAIGEPVLRFWDLERGENYILSLQ
FT                   EKFGFEKGESINCVCFCKAKGLLAAGTNKGRVAMWKKVPSFPNGRGAEGKDMWALQTPT
FT                   ELEGNITQIKWGSRKNLLAVSSTESVSILSEQAMSSHFHQQVAAVQISPSLVNVSFLST
FT                   GGTHSLHTDMHISGVFATKDAVAVWNGKQVAIFEPSGSTLRNAGTFLCETSVLAMHEES
FT                   IYTVEPNRLQVRTWQGTVKQLLLFSETEGSPCFLDVCGTFLVAGTDLAHFKSFDLSRRE
FT                   AKVHCSCKNLAQLVPDVGSITSLRCNANGNKISILLSKVNNSPDSKIYIYDVEMDTVNV
FT                   FNFTTGQIGQIQALPFNEPPTNETRSFMDKSLAGYTPVNHFWDQSEPRLFVCEALQEAP
FT                   GAQPQAVDKQPRVEEGTCHKEEVLILSFFASEEHGFLLHDSFPRPSTYQSLLGMEVPHY
FT                   YFTKKPGEADKEDRVDSGYYHIPQMVAKRPLRDFVGLEDCDKSTRDAMLNFSFFVTIGD
FT                   MDEAFKSIKLIKSEAVWENMARMCVKTQRLDVAKVCLGNMGHARGARALREAEQEPELE
FT                   ARVAMLAIQLGMLEEAEQLYKKCKRYDLLNKFYQASDQWQKAVEVAELHDRVHLRTTYY
FT                   NYAKHLEASADCGQALSYYEKSDTHRFEVPRMLSEDLQSLELYINRMKDKTLWRWWAQY
FT                   LESQAEMDTALRYYELAQDYFSLVRIHCFQGNIQKAAEIANETGDWAASYHLARQYESQ
FT                   DEVKQAVHFYTRAQAFNNAIRLCKENSLDDQLMNLALLSSPEDMIEAARYYEEKGEQMD
FT                   RAVMLYHKAGHFSKALELAFTTQQFAALQLIAEDLDEKSDPALLARCSDFCIEHRQFEK
FT                   AVELLLAAKKYHEALQLCLEQNMTITEDMAEKMTVSKDSKDMSEESRRELLEQIANCCM
FT                   RQGNYHLATKKYTQAGNKLKAMRALLKSGDTEKIVFFAGVSRQKEIYIMAANYLQSLDW
FT                   RKEPEIMKSIISFYTKGRALDLLAGFYDACAQVEIDEYQNYDKAHGALTEAYKCLSKAK
FT                   TKNPLDQETKLAQLQSKMTLVKRFIQARRTYTEDPKESLRQCELLLEEPDLDSTIRVGD
FT                   VYGFLVEHHVQMEEYQMVRLPHFLMLQSPDLVLELTILFPLR"
FT   assembly_gap    1906703..1907195
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   gene            complement(1917769..1940814)
FT                   /gene="BC054438"
FT                   /locus_tag="mCG_17655"
FT                   /note="gene_id=mCG17655.0"
FT   mRNA            complement(join(1917769..1918535,1929861..1930016,
FT                   1939899..1940814))
FT                   /gene="BC054438"
FT                   /locus_tag="mCG_17655"
FT                   /product="cDNA sequence BC054438"
FT                   /note="gene_id=mCG17655.0 transcript_id=mCT14927.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(1918291..1918535,1929861..1930016,
FT                   1939899..1940178))
FT                   /codon_start=1
FT                   /gene="BC054438"
FT                   /locus_tag="mCG_17655"
FT                   /product="cDNA sequence BC054438"
FT                   /note="gene_id=mCG17655.0 transcript_id=mCT14927.1
FT                   protein_id=mCP23289.1"
FT                   /protein_id="EDL22397.1"
FT                   /translation="MTLQKLVATAVLVALVSLILNNAAAFTPNWVYQTLEDGRKRSVGL
FT                   WKSCWLVDRGKGVTSPGTRTGQVDTHDCEVLGWGSESAGFQESRGTVKLQFDMMRACNL
FT                   VATAALVVGQITFILGLTGLPLMSPESQCWEEAMAAAFQLASFVLVIGLVTFYRIGPYT
FT                   NLSWSCYLNIGACLLATLAAAMLIWNILHRREDCMAPRVIVISRSLTARFRRGLDNDYV
FT                   ESPC"
FT   gene            complement(1959176..1979467)
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /note="gene_id=mCG17644.1"
FT   mRNA            complement(join(1959176..1959728,1960925..1960992,
FT                   1961266..1961330,1961637..1961736,1962263..1962354,
FT                   1963206..1963397,1964238..1964309,1964439..1964555,
FT                   1964715..1964806,1964977..1965065,1965361..1965474,
FT                   1965620..1965699,1966400..1966536,1966617..1966758,
FT                   1966955..1967023,1970144..1970246,1971912..1972059,
FT                   1972321..1972453,1973062..1973164,1973541..1973688,
FT                   1973947..1974015,1976548..1976825,1978498..1978846,
FT                   1979001..1979467))
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /product="RIKEN cDNA 1200003M09, transcript variant
FT                   mCT14917"
FT                   /note="gene_id=mCG17644.1 transcript_id=mCT14917.1 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(1959185..1959728,1960925..1961040,
FT                   1961266..1961330,1961637..1961736,1962263..1962354,
FT                   1963206..1963397,1964238..1964309,1964439..1964555,
FT                   1964715..1964806,1964977..1965065,1965361..1965474,
FT                   1965620..1965699,1966400..1966536,1966617..1966758,
FT                   1966955..1967023,1970144..1970246,1971912..1972059,
FT                   1972321..1972389,1976548..1976825,1978498..1978846,
FT                   1979001..1979336))
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /product="RIKEN cDNA 1200003M09, transcript variant
FT                   mCT169689"
FT                   /note="gene_id=mCG17644.1 transcript_id=mCT169689.0 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(1959185..1959728,1960925..1961040,
FT                   1961266..1961330,1961637..1961736,1962263..1962354,
FT                   1963206..1963397,1964238..1964309,1964439..1964555,
FT                   1964715..1964806,1964977..1965065,1965361..1965474,
FT                   1965620..1965699,1966400..1966536,1966617..1966758,
FT                   1966955..1967023,1970144..1970246,1971912..1972059,
FT                   1972321..1972389,1976548..1976825,1978498..1978846,
FT                   1978974..>1979292))
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /product="RIKEN cDNA 1200003M09, transcript variant
FT                   mCT191639"
FT                   /note="gene_id=mCG17644.1 transcript_id=mCT191639.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1959185..1959728,1960925..1961040,
FT                   1961266..1961330,1961637..1961736,1962263..1962354,
FT                   1963206..1963397,1964238..1964309,1964439..1964555,
FT                   1964715..1964806,1964977..1965065,1965361..1965474,
FT                   1965620..1965699,1966400..1966536,1966617..1966758,
FT                   1966955..1967023,1970144..1970246,1971912..1972059,
FT                   1973947..1974015,1976548..1976825,1978498..1978846,
FT                   1978974..>1979289))
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /product="RIKEN cDNA 1200003M09, transcript variant
FT                   mCT191638"
FT                   /note="gene_id=mCG17644.1 transcript_id=mCT191638.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1959616..1959728,1960925..1961040,
FT                   1961266..1961330,1961637..1961736,1962263..1962354,
FT                   1963206..1963397,1964238..1964309,1964439..1964555,
FT                   1964715..1964806,1964977..1965065,1965361..1965474,
FT                   1965620..1965699,1966400..1966536,1966617..1966758,
FT                   1966955..1967023,1970144..1970246,1971912..1972059,
FT                   1972321..1972389,1976548..1976825,1978498..1978846,
FT                   1978974..>1978992))
FT                   /codon_start=1
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /product="RIKEN cDNA 1200003M09, isoform CRA_c"
FT                   /note="gene_id=mCG17644.1 transcript_id=mCT191639.0
FT                   protein_id=mCP112656.0 isoform=CRA_c"
FT                   /protein_id="EDL22400.1"
FT                   /translation="SAWKRRTLFCRMDPALSAVRLTVQEAIHILSSSEDAGHILSTLGT
FT                   LKRYLGGTEDPVLPEEKEEFATVHFSAVLRCLVSKLSPGWLELSPGGQLERLWESFFLD
FT                   GPPDQAFLVLMEAIESTAGPSFRLMKMAQLLDTFLSTGRVAALMEEQCRPQTKPSFPLF
FT                   QETLLSKVVGLPDLLGNCLQRDNLTQFFPQNYFPLLGQEVVQALKAVVNFLQDGLDCSV
FT                   SFVSRVLGKVCIQGRKREILSVLVPQLTVLTQDSCLWQRVCWRLVEQVPDRAVEAVLTG
FT                   LVEAAPRPEVLSRLLGNLVVKNKKARFVVTCKLLLLQYQHTTPMVQSLLGYLALDSQRR
FT                   PLLIQVLKELLETWGCSSAVRHTPLEQQCYISKAILVCLAHLGEPELQDIRDELLASMM
FT                   AGVKCRLDSSLPPVRRLGMIVAEVISSRIHPEGPLLKFQYEDDEMSRELLALATPEPVG
FT                   DCSSVSRGPSPAPADTEPPVEMPEKAVESDVPPTQPQGSDSELDSDDEFIPYDMSGDRE
FT                   LKSSKEPLYIRDCVEALTTSEDMEHWEASLKGLEGLVYRSPTATREVSVELAKVLLHLE
FT                   EKTCVAEFEQLRQSALVAVTVTDPEQVAKYLTSQFYGLNYSLRQRMDILDVLVLAAQAL
FT                   SRPKSLQRRSQHGPPVPGTMCSPALAISQTGNVAAPDWQVVVEERIRSKTRRFSKGCPQ
FT                   RELSGVPNEFSSVAGYFFFPLLQHFDRPLVTFDLLGDDQLVLGRLTHTLASLMYLAVNT
FT                   TVAVPMGKALLEFVWALRFHVDIYVRRGLLSAVSSVLLSVPTERLLGDLPDELLEARSW
FT                   LADVAEKDVDEDCRELAVRALLLLERLKDKLLSSSSPQP"
FT   CDS             complement(join(1959616..1959728,1960925..1961040,
FT                   1961266..1961330,1961637..1961736,1962263..1962354,
FT                   1963206..1963397,1964238..1964309,1964439..1964555,
FT                   1964715..1964806,1964977..1965065,1965361..1965474,
FT                   1965620..1965699,1966400..1966536,1966617..1966758,
FT                   1966955..1967023,1970144..1970246,1971912..1972059,
FT                   1973947..1974015,1976548..1976825,1978498..1978846,
FT                   1978974..>1978992))
FT                   /codon_start=1
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /product="RIKEN cDNA 1200003M09, isoform CRA_b"
FT                   /note="gene_id=mCG17644.1 transcript_id=mCT191638.0
FT                   protein_id=mCP112655.0 isoform=CRA_b"
FT                   /protein_id="EDL22399.1"
FT                   /translation="SAWKRRTLFCRMDPALSAVRLTVQEAIHILSSSEDAGHILSTLGT
FT                   LKRYLGGTEDPVLPEEKEEFATVHFSAVLRCLVSKLSPGWLELSPGGQLERLWESFFLD
FT                   GPPDQAFLVLMEAIESTAGPSFRLMKMAQLLDTFLSTGRVAALMEEQCRPQTKPSFPLF
FT                   QETLLSKVVGLPDLLGNCLQRDNLTQFFPQNYFPLLGQEVVQALKAVVNFLQGGLDCSV
FT                   SFVSRVLGKVCIQGRKREILSVLVPQLTVLTQDSCLWQRVCWRLVEQVPDRAVEAVLTG
FT                   LVEAAPRPEVLSRLLGNLVVKNKKARFVVTCKLLLLQYQHTTPMVQSLLGYLALDSQRR
FT                   PLLIQVLKELLETWGCSSAVRHTPLEQQCYISKAILVCLAHLGEPELQDIRDELLASMM
FT                   AGVKCRLDSSLPPVRRLGMIVAEVISSRIHPEGPLLKFQYEDDEMSRELLALATPEPVG
FT                   DCSSVSRGPSPAPADTEPPVEMPEKAVESDVPPTQPQGSDSELDSDDEFIPYDMSGDRE
FT                   LKSSKEPLYIRDCVEALTTSEDMEHWEASLKGLEGLVYRSPTATREVSVELAKVLLHLE
FT                   EKTCVAEFEQLRQSALVAVTVTDPEQVAKYLTSQFYGLNYSLRQRMDILDVLVLAAQAL
FT                   SRPKSLQRRSQHGPPVPGTMCSPALAISQTGNVAAPDWQVVVEERIRSKTRRFSKGCPQ
FT                   RELSGVPNEFSSVAGYFFFPLLQHFDRPLVTFDLLGDDQLVLGRLTHTLASLMYLAVNT
FT                   TVAVPMGKALLEFVWALRFHVDIYVRRGLLSAVSSVLLSVPTERLLGDLPDELLEARSW
FT                   LADVAEKDVDEDCRELAVRALLLLERLKDKLLSSSSPQP"
FT   CDS             complement(join(1959616..1959728,1960925..1961040,
FT                   1961266..1961330,1961637..1961736,1962263..1962354,
FT                   1963206..1963397,1964238..1964309,1964439..1964555,
FT                   1964715..1964806,1964977..1965065,1965361..1965474,
FT                   1965620..1965699,1966400..1966536,1966617..1966758,
FT                   1966955..1967023,1970144..1970246,1971912..1972059,
FT                   1972321..1972389,1976548..1976825,1978498..1978832))
FT                   /codon_start=1
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /product="RIKEN cDNA 1200003M09, isoform CRA_a"
FT                   /note="gene_id=mCG17644.1 transcript_id=mCT169689.0
FT                   protein_id=mCP92685.0 isoform=CRA_a"
FT                   /protein_id="EDL22398.1"
FT                   /translation="MDPALSAVRLTVQEAIHILSSSEDAGHILSTLGTLKRYLGGTEDP
FT                   VLPEEKEEFATVHFSAVLRCLVSKLSPGWLELSPGGQLERLWESFFLDGPPDQAFLVLM
FT                   EAIESTAGPSFRLMKMAQLLDTFLSTGRVAALMEEQCRPQTKPSFPLFQETLLSKVVGL
FT                   PDLLGNCLQRDNLTQFFPQNYFPLLGQEVVQALKAVVNFLQDGLDCSVSFVSRVLGKVC
FT                   IQGRKREILSVLVPQLTVLTQDSCLWQRVCWRLVEQVPDRAVEAVLTGLVEAAPRPEVL
FT                   SRLLGNLVVKNKKARFVVTCKLLLLQYQHTTPMVQSLLGYLALDSQRRPLLIQVLKELL
FT                   ETWGCSSAVRHTPLEQQCYISKAILVCLAHLGEPELQDIRDELLASMMAGVKCRLDSSL
FT                   PPVRRLGMIVAEVISSRIHPEGPLLKFQYEDDEMSRELLALATPEPVGDCSSVSRGPSP
FT                   APADTEPPVEMPEKAVESDVPPTQPQGSDSELDSDDEFIPYDMSGDRELKSSKEPLYIR
FT                   DCVEALTTSEDMEHWEASLKGLEGLVYRSPTATREVSVELAKVLLHLEEKTCVAEFEQL
FT                   RQSALVAVTVTDPEQVAKYLTSQFYGLNYSLRQRMDILDVLVLAAQALSRPKSLQRRSQ
FT                   HGPPVPGTMCSPALAISQTGNVAAPDWQVVVEERIRSKTRRFSKGCPQRELSGVPNEFS
FT                   SVAGYFFFPLLQHFDRPLVTFDLLGDDQLVLGRLTHTLASLMYLAVNTTVAVPMGKALL
FT                   EFVWALRFHVDIYVRRGLLSAVSSVLLSVPTERLLGDLPDELLEARSWLADVAEKDVDE
FT                   DCRELAVRALLLLERLKDKLLSSSSPQP"
FT   CDS             complement(join(1959616..1959728,1960925..1960992,
FT                   1961266..1961330,1961637..1961736,1962263..1962354,
FT                   1963206..1963397,1964238..1964309,1964439..1964555,
FT                   1964715..1964806,1964977..1965065,1965361..1965474,
FT                   1965620..1965699,1966400..1966536,1966617..1966758,
FT                   1966955..1967023,1970144..1970246,1971912..1972059,
FT                   1972321..1972453,1973062..1973164,1973541..1973688,
FT                   1973947..1974015,1976548..1976825,1978498..1978832))
FT                   /codon_start=1
FT                   /gene="1200003M09Rik"
FT                   /locus_tag="mCG_17644"
FT                   /product="RIKEN cDNA 1200003M09, isoform CRA_d"
FT                   /note="gene_id=mCG17644.1 transcript_id=mCT14917.1
FT                   protein_id=mCP23195.2 isoform=CRA_d"
FT                   /protein_id="EDL22401.1"
FT                   /translation="MDPALSAVRLTVQEAIHILSSSEDAGHILSTLGTLKRYLGGTEDP
FT                   VLPEEKEEFATVHFSAVLRCLVSKLSPGWLELSPGGQLERLWESFFLDGPPDQAFLVLM
FT                   EAIESTAGPSFRLMKMAQLLDTFLSTGRVAALMEEQCRPQTKPSFPLFQETLLSKVVGL
FT                   PDLLGNCLQRDNLTQFFPQNYFPLLGQEVVQALKAVVNFLQGGLDCSVSFVSRVLGKVC
FT                   IQGRKREILSVLVPQLTVLTQDSCLWQRVCWRLVEQVPDRAVEAVLTGLIEAAPRPEVL
FT                   SRLLGNLVVKNKKARFVVTCKLLLLQYQHTSDVLSVFPAYLFCSLVLLSILDGLDCSVS
FT                   FVSRVLGKVCIQGRKREILSVLVPQLTVLTQDSCLWQRVCWRLVEQVPDRAVEAVLTGL
FT                   VEAAPRPEVLSRLLGNLVVKNKKARFVVTCKLLLLQYQHTTPMVQSLLGYLALDSQRRP
FT                   LLIQVLKELLETWGCSSAVRHTPLEQQCYISKAILVCLAHLGEPELQDIRDELLASMMA
FT                   GVKCRLDSSLPPVRRLGMIVAEVISSRIHPEGPLLKFQYEDDEMSRELLALATPEPVGD
FT                   CSSVSRGPSPAPADTEPPVEMPEKAVESDVPPTQPQGSDSELDSDDEFIPYDMSGDREL
FT                   KSSKEPLYIRDCVEALTTSEDMEHWEASLKGLEGLVYRSPTATREVSVELAKVLLHLEE
FT                   KTCVAEFEQLRQSALVAVTVTDPEQVAKYLTSQFYGLNYSLRQRMDILDVLVLAAQALS
FT                   RPKSLQRRSQHGPPVPGTMCSPALAISQTGNVAAPDWQVVVEERIRSKTRRFSKGCPQR
FT                   ELSGVPNEFSSVAGYFFFPLLQHFDRPLVTFDLLGDDQLVLGRLTHTLASLMYLAVNTT
FT                   VAVPMGKALLEFVWALRFHVDIVPTERLLGDLPDELLEARSWLADVAEKDVDEDCRELA
FT                   VRALLLLERLKDKLLSSSSPQP"
FT   assembly_gap    1968094..1968113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1970459..1970478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1971628..1971647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1973037..1973056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1975207..1975226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1986008..1988589
FT                   /locus_tag="mCG_17663"
FT                   /note="gene_id=mCG17663.1"
FT   mRNA            join(<1986008..1986662,1987883..1988589)
FT                   /locus_tag="mCG_17663"
FT                   /product="mCG17663"
FT                   /note="gene_id=mCG17663.1 transcript_id=mCT14934.1 created
FT                   on 30-MAY-2002"
FT   CDS             join(<1986008..1986662,1987883..1988523)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17663"
FT                   /product="mCG17663"
FT                   /note="gene_id=mCG17663.1 transcript_id=mCT14934.1
FT                   protein_id=mCP23282.1"
FT                   /protein_id="EDL22402.1"
FT                   /translation="FQRFQQVTLTHLQNIANNYNVYHNMDVRFQSLVEQSQAVALAMNQ
FT                   SQAAIQGDVAHLKTWYRKSQRRSRKVDARLQALDLSLSTKSRQWVEKEGEQKAQREAIA
FT                   SLALSVQALQDALASLTQQVHSQGARLAALEGQTQSASSGTVALGLTTAPTPTQLAQRG
FT                   PGSLQLWRDRQVAKSSPQHRSSPHDVTVHVQEMQKFQTPSSHQAAPPRTYQGPGNICNT
FT                   DPVLIFPNTSTENVIFLSPGFLMPLRALSFCSWVRMATSHLGTLLSYATKDNDNKLVLH
FT                   GRNSLVPGSIHFVIGDPDFRELSLKPLLDGQWHHICIIWTSVEGKYWLHIDRRLVATGS
FT                   RFREGYEIPPGGSLVLGQEQDTVGGEFDSSEAFVGSISGLAIWDRALLPGEVANLASGK
FT                   EFPTGAILTLTNVTSVGGFVQRAKCTCLEQCP"
FT   assembly_gap    1991540..1991559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1995299..1995318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1997518..2025270
FT                   /gene="Clcn7"
FT                   /locus_tag="mCG_140476"
FT                   /note="gene_id=mCG140476.0"
FT   mRNA            join(<1997518..1997655,2008736..2008804,2009875..2009946,
FT                   2010074..2010139,2010623..2010755,2011076..2011185,
FT                   2012018..2012098,2013347..2013409,2013519..2013602,
FT                   2014499..2014592,2014854..2014918,2015428..2015544,
FT                   2016016..2016070,2016660..2016720,2017328..2017466,
FT                   2018044..2018137,2019680..2019849,2021126..2021177,
FT                   2021465..2021592,2021816..2021901,2022199..2022328,
FT                   2023757..2023816,2023899..2024075,2024419..2024499,
FT                   2024734..2025270)
FT                   /gene="Clcn7"
FT                   /locus_tag="mCG_140476"
FT                   /product="chloride channel 7"
FT                   /note="gene_id=mCG140476.0 transcript_id=mCT169693.0
FT                   created on 30-MAY-2002"
FT   CDS             join(1997518..1997655,2008736..2008804,2009875..2009946,
FT                   2010074..2010139,2010623..2010755,2011076..2011185,
FT                   2012018..2012098,2013347..2013409,2013519..2013602,
FT                   2014499..2014592,2014854..2014918,2015428..2015544,
FT                   2016016..2016070,2016660..2016720,2017328..2017466,
FT                   2018044..2018137,2019680..2019849,2021126..2021177,
FT                   2021465..2021592,2021816..2021901,2022199..2022328,
FT                   2023757..2023816,2023899..2024075,2024419..2024499,
FT                   2024734..2024820)
FT                   /codon_start=1
FT                   /gene="Clcn7"
FT                   /locus_tag="mCG_140476"
FT                   /product="chloride channel 7"
FT                   /note="gene_id=mCG140476.0 transcript_id=mCT169693.0
FT                   protein_id=mCP92697.0"
FT                   /db_xref="GOA:Q6RUT9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002249"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:1347048"
FT                   /db_xref="UniProtKB/TrEMBL:Q6RUT9"
FT                   /protein_id="EDL22403.1"
FT                   /translation="MANVSKKVSWSGRDRDDEEGAPLLRRTGQPDEETPLLNGAGPGAR
FT                   QSHSALFRIGQMNNVELDDELLDPEVDPPHTFPKEIPHNEKLLSLKYESLDYDNSENQL
FT                   FLEEERRINHTAFRTVEIKRWVICALIGILTGLVACFIDIVVENLAGLKYRVIKDNIDK
FT                   FTEKGGLSFSLLLWATLNSAFVLVGSVIVAFIEPVAAGSGIPQIKCFLNGVKIPHVVRL
FT                   KTLVIKVSGVILSVVGGLAVGKEGPMIHSGSVIAAGISQGRSTSLKRDFKIFEYFRRDT
FT                   EKRDFVSAGAAAGVSAAFGAPVGGVLFSLEEGASFWNQFLTWRIFFASMISTFTLNFVL
FT                   SIYHGNMWDLSSPGLINFGRFDSEKMAYTIHEIPVFIAMGVVGGILGAVFNALNYWLTM
FT                   FRIRYIHRPCLQVIEAMLVAAVTATVAFVLIYSSRDCQPLQGSSMSYPLQLFCADGEYN
FT                   SMAAAFFNTPEKSVVSLFHDPPGSYNPMTLGLFTLVYFFLACWTYGLTVSAGVFIPSLL
FT                   IGAAWGRLFGISLSYLTGAAIWADPGKYALMGAAAQLGGIVRMTLSLTVIMMEATSNVT
FT                   YGFPIMLVLMTAKIVGDVFIEGLYDMHIQLQSVPFLHWEAPVTSHSLTAREVMSTPVTC
FT                   LRRREKVGIIVDVLSDTASNHNGFPVVEDVGDTQPARLQGLILRSQLIVLLKHKVFVER
FT                   SNMGLVQRRLRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLP
FT                   RVFKLFRALGLRHLVVVDNHNQVVGLVTRKDLARYRLGKGGLEELSLAQT"
FT   assembly_gap    2001092..2001249
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            2031956..2036153
FT                   /locus_tag="mCG_140475"
FT                   /note="gene_id=mCG140475.0"
FT   mRNA            join(2031956..2032102,2032173..2032300,2032595..2032721,
FT                   2032813..2032950,2034357..2034476,2034807..2034883,
FT                   2035106..2035223,2035362..2035442,2035730..2035912,
FT                   2036002..2036153)
FT                   /locus_tag="mCG_140475"
FT                   /product="mCG140475"
FT                   /note="gene_id=mCG140475.0 transcript_id=mCT169692.0
FT                   created on 30-MAY-2002"
FT   CDS             join(2031977..2032102,2032173..2032300,2032595..2032721,
FT                   2032813..2032950,2034357..2034476,2034807..2034883,
FT                   2035106..2035223,2035362..2035442,2035730..2035912,
FT                   2036002..2036094)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140475"
FT                   /product="mCG140475"
FT                   /note="gene_id=mCG140475.0 transcript_id=mCT169692.0
FT                   protein_id=mCP92682.0"
FT                   /protein_id="EDL22404.1"
FT                   /translation="MKSSESTRQIAESSLREELESRWQKLHELTEERLRALRAQREQEE
FT                   EGHLLEQCRGLDKAVVYLTKFVRQNQVSLNRVLMAEQKAREAKVSLEETQAGELASYVH
FT                   ENLEAVQMAGKLAQQETQDALELLQEKSQVLEGSVAGLDQQLKDLSDHCLALSWRLDLQ
FT                   EQTLGLKLSQTQAAWEGMERESLKDLVQWLKEVSAHLEEVQEKVNSLPQQIESISNKCV
FT                   IHKSEVDVKISAEGKAREFEVETVRQELAALLMSVQLLKEENPGRKIAEIQGQLATKQM
FT                   IKLENSLQANKTIQNLKFNNETKLRTEEIATLRESMLRLWSEEGPWPLTLGSKRVFMSL
FT                   VRQRFFIKDVALDAMVSVNSWGVYQAVASLEESPLELGGPEKARSDLGDDPVEACI"
FT   gene            complement(<2037126..>2038040)
FT                   /locus_tag="mCG_1033964"
FT                   /note="gene_id=mCG1033964.1"
FT   mRNA            complement(<2037126..>2038040)
FT                   /locus_tag="mCG_1033964"
FT                   /product="mCG1033964"
FT                   /note="gene_id=mCG1033964.1 transcript_id=mCT151668.1
FT                   created on 30-MAY-2002"
FT   CDS             complement(2037126..>2038040)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033964"
FT                   /product="mCG1033964"
FT                   /note="gene_id=mCG1033964.1 transcript_id=mCT151668.1
FT                   protein_id=mCP84660.1"
FT                   /protein_id="EDL22405.1"
FT                   /translation="ASPNLLTHPLTSLLACVCCSREPQNFGDLNKMAAGVIRSVCDFRL
FT                   PLPSHESFLPIDLEAPEISEEEEEEEEEEEEEEEEEEVDQDQQGEGSQGCGPDSQSSGV
FT                   VPQDPSSPETPMQLLRFSELISGDIQRYFGRKDTGQDPDAQDIYADSQPASCSARDLYY
FT                   ADLVCLAQDGPPEDEEAAEFRMHLPGGPEGQVHRLGHRGDRVPPLGPLAELFDYGLRQF
FT                   SRPRISACRRLRLERKYSHITPMTQRKLPPSFWKEPVPNPLGLLHVGTPDFSDLLASWS
FT                   AEGGSELQSGGTQGLEGTQLAEV"
FT   gene            2048783..2050103
FT                   /locus_tag="mCG_1033928"
FT                   /note="gene_id=mCG1033928.1"
FT   mRNA            join(2048783..2048854,2048934..2050103)
FT                   /locus_tag="mCG_1033928"
FT                   /product="mCG1033928"
FT                   /note="gene_id=mCG1033928.1 transcript_id=mCT151632.1
FT                   created on 30-MAY-2002"
FT   CDS             join(2048823..2048854,2048934..2049312)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033928"
FT                   /product="mCG1033928"
FT                   /note="gene_id=mCG1033928.1 transcript_id=mCT151632.1
FT                   protein_id=mCP84616.1"
FT                   /protein_id="EDL22406.1"
FT                   /translation="MNSVLCSRAAGAVRALRLVGWASRSLHPPPRGRSPAQPADREEED
FT                   DDPNLPIQFSGSKATPIRWTVEHSLGKPQQRPWWKVLPLTLTLVALVVWCYQREESGMD
FT                   LWLRQVLEEEDEEEPEGPPEELEAPALYGART"
FT   assembly_gap    2052589..2052849
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   gene            <2053727..>2072486
FT                   /locus_tag="mCG_140473"
FT                   /note="gene_id=mCG140473.0"
FT   mRNA            join(<2053727..2053938,2064069..2064245,2065343..2065476,
FT                   2069889..2070024,2072369..>2072486)
FT                   /locus_tag="mCG_140473"
FT                   /product="mCG140473"
FT                   /note="gene_id=mCG140473.0 transcript_id=mCT169687.0
FT                   created on 30-MAY-2002"
FT   CDS             join(<2053727..2053938,2064069..2064245,2065343..2065476,
FT                   2069889..2070024,2072369..>2072486)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140473"
FT                   /product="mCG140473"
FT                   /note="gene_id=mCG140473.0 transcript_id=mCT169687.0
FT                   protein_id=mCP92681.0"
FT                   /protein_id="EDL22407.1"
FT                   /translation="RYLKEFRTEQCSLFLQHKCSQHRPFTCFHWHFLNQRRRRPLRRRD
FT                   GTFNYSPDIYCSKYDEATGLCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARG
FT                   HCVKNGLHCAFAHGPLDLRPPVCDIRELQAQEALQNGQLSGGDGVPDLQPGVLASQAMI
FT                   EKILGEDPRWQDSNFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYRST
FT                   PCPSVKHGDEWGEPSRCDGGDSCQYCHSRTEQQFHPE"
FT   assembly_gap    2060018..2060063
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            2086612..2095366
FT                   /gene="Unkl"
FT                   /locus_tag="mCG_140474"
FT                   /note="gene_id=mCG140474.0"
FT   mRNA            join(2086612..2086649,2092782..2092865,2093438..2093665,
FT                   2094406..2094608,2094720..2095366)
FT                   /gene="Unkl"
FT                   /locus_tag="mCG_140474"
FT                   /product="unkempt-like (Drosophila), transcript variant
FT                   mCT172364"
FT                   /note="gene_id=mCG140474.0 transcript_id=mCT172364.0
FT                   created on 21-AUG-2002"
FT   mRNA            join(2086846..2086987,2092782..2092865,2094406..2094608,
FT                   2094720..2095365)
FT                   /gene="Unkl"
FT                   /locus_tag="mCG_140474"
FT                   /product="unkempt-like (Drosophila), transcript variant
FT                   mCT169688"
FT                   /note="gene_id=mCG140474.0 transcript_id=mCT169688.0
FT                   created on 21-AUG-2002"
FT   CDS             join(2086966..2086987,2092782..2092865,2094406..2094608,
FT                   2094720..2094992)
FT                   /codon_start=1
FT                   /gene="Unkl"
FT                   /locus_tag="mCG_140474"
FT                   /product="unkempt-like (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG140474.0 transcript_id=mCT169688.0
FT                   protein_id=mCP92680.0 isoform=CRA_a"
FT                   /protein_id="EDL22408.1"
FT                   /translation="MRPPTLPGSALDLRLSDINIASLDKDLEEQDLGLTGLNGVPGSIW
FT                   DFVSGSFSPSPSPILNSGPSASSSASPNSAELARVRRQLDEAKRKIRQWEESWQQVKQA
FT                   CDAWQREAQEAKERARVADSDRQLALQRKEEVEAKVTQLQEELEGLGLSSLPGLQSLGD
FT                   ISDIPLPKLHSLQSKLRLDLEAVDGVSPAL"
FT   mRNA            join(2087044..2087170,2092782..2092865,2093438..2093665,
FT                   2094406..2094608,2094720..2095366)
FT                   /gene="Unkl"
FT                   /locus_tag="mCG_140474"
FT                   /product="unkempt-like (Drosophila), transcript variant
FT                   mCT172365"
FT                   /note="gene_id=mCG140474.0 transcript_id=mCT172365.0
FT                   created on 21-AUG-2002"
FT   CDS             join(2093584..2093665,2094406..2094608,2094720..2094992)
FT                   /codon_start=1
FT                   /gene="Unkl"
FT                   /locus_tag="mCG_140474"
FT                   /product="unkempt-like (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG140474.0 transcript_id=mCT172364.0
FT                   protein_id=mCP95283.0 isoform=CRA_b"
FT                   /protein_id="EDL22409.1"
FT                   /translation="MTPPQQPPPLRSEPATLGSAASSYSSLGLNGVPGSIWDFVSGSFS
FT                   PSPSPILNSGPSASSSASPNSAELARVRRQLDEAKRKIRQWEESWQQVKQACDAWQREA
FT                   QEAKERARVADSDRQLALQRKEEVEAKVTQLQEELEGLGLSSLPGLQSLGDISDIPLPK
FT                   LHSLQSKLRLDLEAVDGVSPAL"
FT   CDS             join(2093584..2093665,2094406..2094608,2094720..2094992)
FT                   /codon_start=1
FT                   /gene="Unkl"
FT                   /locus_tag="mCG_140474"
FT                   /product="unkempt-like (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG140474.0 transcript_id=mCT172365.0
FT                   protein_id=mCP95284.0 isoform=CRA_b"
FT                   /protein_id="EDL22410.1"
FT                   /translation="MTPPQQPPPLRSEPATLGSAASSYSSLGLNGVPGSIWDFVSGSFS
FT                   PSPSPILNSGPSASSSASPNSAELARVRRQLDEAKRKIRQWEESWQQVKQACDAWQREA
FT                   QEAKERARVADSDRQLALQRKEEVEAKVTQLQEELEGLGLSSLPGLQSLGDISDIPLPK
FT                   LHSLQSKLRLDLEAVDGVSPAL"
FT   assembly_gap    2095531..2105381
FT                   /estimated_length=9851
FT                   /gap_type="unknown"
FT   gene            complement(2105382..2118184)
FT                   /locus_tag="mCG_17651"
FT                   /note="gene_id=mCG17651.2"
FT   mRNA            complement(join(2105382..2105650,2105731..2105936,
FT                   2106015..2106138,2106218..2106338,2106420..2106731,
FT                   2107044..2107152,2107223..2107302,2107389..2107457,
FT                   2107546..2107737,2107841..2107933,2108020..2108163,
FT                   2108237..2108360,2108465..2108595,2108711..2108762,
FT                   2108865..2108962,2109043..2109099,2109216..2109306,
FT                   2109390..2109514,2109933..2110053,2110177..2110280,
FT                   2110341..2110466,2110555..2110662,2110924..2111089,
FT                   2111214..2111291,2111414..2111458,2111981..2112176,
FT                   2112291..2112357,2112494..2112553,2112999..2113106,
FT                   2113336..2113416,2113630..2113717,2113909..2114042,
FT                   2118058..2118184))
FT                   /locus_tag="mCG_17651"
FT                   /product="mCG17651"
FT                   /note="gene_id=mCG17651.2 transcript_id=mCT14920.2 created
FT                   on 09-JUN-2003"
FT   CDS             complement(join(2105547..2105650,2105731..2105936,
FT                   2106015..2106138,2106218..2106338,2106420..2106731,
FT                   2107044..2107152,2107223..2107302,2107389..2107457,
FT                   2107546..2107737,2107841..2107933,2108020..2108163,
FT                   2108237..2108360,2108465..2108595,2108711..2108762,
FT                   2108865..2108962,2109043..2109099,2109216..2109306,
FT                   2109390..2109514,2109933..2110053,2110177..2110280,
FT                   2110341..2110466,2110555..2110662,2110924..2111089,
FT                   2111214..2111291,2111414..2111458,2111981..2112176,
FT                   2112291..2112357,2112494..2112553,2112999..2113106,
FT                   2113336..2113416,2113630..2113717,2113909..2114033))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17651"
FT                   /product="mCG17651"
FT                   /note="gene_id=mCG17651.2 transcript_id=mCT14920.2
FT                   protein_id=mCP23292.2"
FT                   /protein_id="EDL22411.1"
FT                   /translation="MSTLLDIKSSVLRQVQVCPSFRRKTEQEPEVTNSQEPPTGAWKPG
FT                   DGVEFFAHMRLILKKGDGRQGLPCPEVLLRSGSPAPAEPVDPNRGLRTLTQEEVEMLYE
FT                   EALYTVLHRAGTMGPDQVDDEEVLLSYLQQVFGTSSEEHMEAIMRVKKAKAPTYALKVS
FT                   VMRAKNLLAKDPNGFSDPYCMLGILPASSAPQESSGQKEQRFGFRKGSKRSSPLPAKCI
FT                   QVTEVKNSTLNPVWKEHFLFEIDDVNTDQLHLDIWDHDDDVSLAEACRKLNEVIGLKGM
FT                   TRYFKQIVKSARANGTAGPTEDHTDDFLGCLNIPIRVFEEGWDKDMGCGWVPQDAWWEV
FT                   PVAGADRWFKLEPRSSASRVQGDCHLVLKLITTQRDTVMNQRGRSGFLSYLLLLSRVLR
FT                   FEHRVEEVVGVLGLLSRPNSSSWRGELSGPGTTVLCLHGAQSNLSPLQLAVLHWQVSSR
FT                   HHQTRTLDYGYLLGLLEDVQAHWEEAASLPQEQEESLADSFSAFSEFGLRLLRQLRDYF
FT                   PATNSTAVYRLELLLKCLEKLQLFQPAFEICPFETELSMDIAAALKRGNREWYDQLLNT
FT                   KSPREQPGPQRLAGLVELADIIYEDLQLCYGVYASLFHGILKVDFFTLTFRQLERLVAE
FT                   EAWVLTEELSPKMNLEVASGLFELYLTLADTQRFWSCIPGRESRSLALAGIHTPFLPAV
FT                   KLWLQVLRDQAKWRLQGAVDVDTLEPVDAASKHSSSAATASLCLSHIQELWVRLAWPDP
FT                   SQAQGLGTQLSQDMCEASLFYTELLRKKVDTQPGAAGEAVSEQLCVVLNNVELVRRASG
FT                   QALRGLAWSEGASGLEGVLPRPLLSCIQALDEDLHREAHTVTAHLTSKMVADIRKYIQH
FT                   ISLSPDSIQNDEAVAPLLKYLDEKLALLNDALVKENLNRVLEALWELLLQAILQALSAN
FT                   RDVSADFYGRFHFTLEALVSFFHAEGQGLPLENLRDGSYKVSEPSAGAISLVPCRRHPC
FT                   VGEARWPRGSSDDSGKPLGCDARDQGYKRQLPLQRLQEELRLHKCSTRECIEQFYLDKL
FT                   KQRSLEQNRFGRLTVRCHYEAAEQRLAVEVLHAADLLPLDANGLSDPFVIVELGPPHLF
FT                   PLVRSQRTQVKARTLHPVYDELFHFSVPAEACRRRGACVLFTVMDHDWLSTNDFAGEAA
FT                   LGLGGISGIARPHVGGGMRPGQPITLHLRRPRAQVRSALRMLEGRTSREAQEFVKKLKE
FT                   LEKCMEADL"
FT   gene            complement(2123941..>2136618)
FT                   /locus_tag="mCG_17660"
FT                   /note="gene_id=mCG17660.2"
FT   mRNA            complement(join(2123941..2124517,2126792..2126871,
FT                   2127145..2127254,2130569..2130641,2131220..2131303,
FT                   2131431..2131507,2136197..2136332))
FT                   /locus_tag="mCG_17660"
FT                   /product="mCG17660, transcript variant mCT14930"
FT                   /note="gene_id=mCG17660.2 transcript_id=mCT14930.1 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(2124073..2124508,2126792..2126871,
FT                   2127145..2127254,2130569..2130641,2131220..2131303,
FT                   2131431..2131507,2135356..>2135387))
FT                   /locus_tag="mCG_17660"
FT                   /product="mCG17660, transcript variant mCT191636"
FT                   /note="gene_id=mCG17660.2 transcript_id=mCT191636.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2124419..2124517,2126792..2126871,
FT                   2127145..2127254,2130569..2130641,2131220..2131303,
FT                   2131431..2131507,2136571..>2136618))
FT                   /locus_tag="mCG_17660"
FT                   /product="mCG17660, transcript variant mCT191637"
FT                   /note="gene_id=mCG17660.2 transcript_id=mCT191637.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2124454..2124517,2126792..2126871,
FT                   2127145..2127254,2130569..2130641,2131220..2131303,
FT                   2131431..2131507,2136571..>2136616))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17660"
FT                   /product="mCG17660, isoform CRA_c"
FT                   /note="gene_id=mCG17660.2 transcript_id=mCT191637.0
FT                   protein_id=mCP112594.0 isoform=CRA_c"
FT                   /protein_id="EDL22414.1"
FT                   /translation="HGTLVPVLGHPTTSKGTLNMSGIALSRLAQERKAWRKDHPFGFVA
FT                   VPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPN
FT                   VYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEY
FT                   EKRVRAQAKKFAPS"
FT   CDS             complement(join(2124454..2124517,2126792..2126871,
FT                   2127145..2127254,2130569..2130641,2131220..2131303,
FT                   2131431..2131496))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17660"
FT                   /product="mCG17660, isoform CRA_d"
FT                   /note="gene_id=mCG17660.2 transcript_id=mCT14930.1
FT                   protein_id=mCP23198.2 isoform=CRA_d"
FT                   /protein_id="EDL22415.1"
FT                   /translation="MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAI
FT                   PGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWR
FT                   PAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS"
FT   mRNA            complement(join(<2124479..2124517,2126792..2126871,
FT                   2127145..2127254,2130569..2130641,2131220..2131303,
FT                   2131431..2131507,2135517..>2135536))
FT                   /locus_tag="mCG_17660"
FT                   /product="mCG17660, transcript variant mCT191635"
FT                   /note="gene_id=mCG17660.2 transcript_id=mCT191635.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<2124479..2124517,2126792..2126871,
FT                   2127145..2127254,2130569..2130641,2131220..2131303,
FT                   2131431..2131507,2135517..>2135535))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17660"
FT                   /product="mCG17660, isoform CRA_a"
FT                   /note="gene_id=mCG17660.2 transcript_id=mCT191635.0
FT                   protein_id=mCP112592.0 isoform=CRA_a"
FT                   /protein_id="EDL22412.1"
FT                   /translation="PPDGRDGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGT
FT                   MNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCL
FT                   SILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA"
FT   CDS             complement(join(2124508,2126792..2126871,2127145..2127254,
FT                   2130569..2130641,2131220..2131303,2131431..2131507,
FT                   2135356..>2135386))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17660"
FT                   /product="mCG17660, isoform CRA_b"
FT                   /note="gene_id=mCG17660.2 transcript_id=mCT191636.0
FT                   protein_id=mCP112593.0 isoform=CRA_b"
FT                   /protein_id="EDL22413.1"
FT                   /translation="RRDGPGRGRPGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKN
FT                   PDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSG
FT                   TVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIY"
FT   assembly_gap    2143675..2143694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2149953..2150548
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    2152049..2152315
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   gene            <2161130..2162898
FT                   /gene="Prss34"
FT                   /locus_tag="mCG_145353"
FT                   /note="gene_id=mCG145353.0"
FT   mRNA            join(<2161130..2161303,2161463..2161643,2161839..2162113,
FT                   2162206..2162369,2162476..2162898)
FT                   /gene="Prss34"
FT                   /locus_tag="mCG_145353"
FT                   /product="protease, serine, 34"
FT                   /note="gene_id=mCG145353.0 transcript_id=mCT184777.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2161168..2161303,2161463..2161643,2161839..2162113,
FT                   2162206..2162369,2162476..2162739)
FT                   /codon_start=1
FT                   /gene="Prss34"
FT                   /locus_tag="mCG_145353"
FT                   /product="protease, serine, 34"
FT                   /note="gene_id=mCG145353.0 transcript_id=mCT184777.0
FT                   protein_id=mCP105319.0"
FT                   /protein_id="EDL22416.1"
FT                   /translation="HLCPQVSWLPKSVFGTRNLCDLCLGMLWLLFLSLPCLGNTMPLTL
FT                   DLGSGQGLVGIVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCV
FT                   RPKEVKAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVV
FT                   LSEHVYPVSLPAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQK
FT                   YQTNSSLDSTTRIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGP
FT                   PDFPGVYTRVMSYVSWIKCYVPTFLEPLKGPDGIHTTEETPATHIDPFTPPSGPASLS"
FT   assembly_gap    2167877..2167896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2172775..2175245
FT                   /gene="Prss28"
FT                   /locus_tag="mCG_141596"
FT                   /note="gene_id=mCG141596.0"
FT   mRNA            join(<2172775..2172835,2173017..2173197,2173299..2173564,
FT                   2174601..2174764,2174889..2175245)
FT                   /gene="Prss28"
FT                   /locus_tag="mCG_141596"
FT                   /product="protease, serine, 28"
FT                   /note="gene_id=mCG141596.0 transcript_id=mCT176037.0
FT                   created on 22-NOV-2002"
FT   CDS             join(2172775..2172835,2173017..2173197,2173299..2173564,
FT                   2174601..2174764,2174889..2175041)
FT                   /codon_start=1
FT                   /gene="Prss28"
FT                   /locus_tag="mCG_141596"
FT                   /product="protease, serine, 28"
FT                   /note="gene_id=mCG141596.0 transcript_id=mCT176037.0
FT                   protein_id=mCP98959.0"
FT                   /protein_id="EDL22417.1"
FT                   /translation="MFRLLLLALSCLESTVFMASVSISRSKPVGIVGGQRTPPGKWPWQ
FT                   VSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQEL
FT                   LNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGW
FT                   GNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGP
FT                   CFGDSGGPLVCWKSNKWIQVGVVSKGIDCSNNLPSIFSRVQSSLAWIHQHIQ"
FT   gene            <2183614..2185959
FT                   /gene="Prss29"
FT                   /locus_tag="mCG_141597"
FT                   /note="gene_id=mCG141597.0"
FT   mRNA            join(<2183614..2183674,2183827..2184007,2184203..2184469,
FT                   2185468..2185537,2185622..2185959)
FT                   /gene="Prss29"
FT                   /locus_tag="mCG_141597"
FT                   /product="protease, serine, 29"
FT                   /note="gene_id=mCG141597.0 transcript_id=mCT176038.0
FT                   created on 22-NOV-2002"
FT   CDS             join(2183614..2183674,2183827..2184007,2184203..2184469,
FT                   2185468..2185537,2185622..2185786)
FT                   /codon_start=1
FT                   /gene="Prss29"
FT                   /locus_tag="mCG_141597"
FT                   /product="protease, serine, 29"
FT                   /note="gene_id=mCG141597.0 transcript_id=mCT176038.0
FT                   protein_id=mCP98960.0"
FT                   /protein_id="EDL22418.1"
FT                   /translation="MLIQLCLTLFFLGCSIAGTPAPGPEDVLMGIVGGHSAPQGKWPWQ
FT                   VSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKEL
FT                   LSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGW
FT                   GAVSTHSNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCAL
FT                   RDFPGVYARVQSFLPWITQQMQRFS"
FT   assembly_gap    2184741..2184770
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    2185235..2185467
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    2189395..2189414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2189751..2190668)
FT                   /pseudo
FT                   /locus_tag="mCG_17664"
FT                   /note="gene_id=mCG17664.2"
FT   mRNA            complement(2189751..2190668)
FT                   /pseudo
FT                   /locus_tag="mCG_17664"
FT                   /note="gene_id=mCG17664.2 transcript_id=mCT14935.2 created
FT                   on 30-MAY-2002"
FT   assembly_gap    2202542..2202561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2206264..>2208574)
FT                   /gene="Tpsab1"
FT                   /locus_tag="mCG_17632"
FT                   /note="gene_id=mCG17632.2"
FT   mRNA            complement(join(2206264..2206602,2206675..2206829,
FT                   2207661..2207926,2208060..2208225,2208317..2208403))
FT                   /gene="Tpsab1"
FT                   /locus_tag="mCG_17632"
FT                   /product="tryptase alpha/beta 1, transcript variant
FT                   mCT14887"
FT                   /note="gene_id=mCG17632.2 transcript_id=mCT14887.1 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(2206265..2207926,2208317..>2208574))
FT                   /gene="Tpsab1"
FT                   /locus_tag="mCG_17632"
FT                   /product="tryptase alpha/beta 1, transcript variant
FT                   mCT191681"
FT                   /note="gene_id=mCG17632.2 transcript_id=mCT191681.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<2206438..2206602,2206675..2206829,
FT                   2207661..2207926,2208158..2208225,2208317..>2208389))
FT                   /gene="Tpsab1"
FT                   /locus_tag="mCG_17632"
FT                   /product="tryptase alpha/beta 1, transcript variant
FT                   mCT191682"
FT                   /note="gene_id=mCG17632.2 transcript_id=mCT191682.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2206438..2206602,2206675..2206829,
FT                   2207661..2207926,2208060..2208225,2208317..2208377))
FT                   /codon_start=1
FT                   /gene="Tpsab1"
FT                   /locus_tag="mCG_17632"
FT                   /product="tryptase alpha/beta 1, isoform CRA_a"
FT                   /note="gene_id=mCG17632.2 transcript_id=mCT14887.1
FT                   protein_id=mCP23124.2 isoform=CRA_a"
FT                   /db_xref="GOA:B5A5B0"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:B5A5B0"
FT                   /protein_id="EDL22419.1"
FT                   /translation="MLKLLLLTLPLLSSLVHAAPGPAMTREGIVGGQEAHGNKWPWQVS
FT                   LRANDTYWMHFCGGSLIHPQWVLTAAHCVGPDVADPNKVRVQLRKQYLYYHDHLMTVSQ
FT                   IITHPDFYIVQDGADIALLKLTNPVNISDYVHPVPLPPASETFPSGTLCWVTGWGNIDN
FT                   GVNLPPPFPLQVPIIENHLCDLKYHKGLITGDNVHIVRDDMLCAGNEGHDSCQGDSGGP
FT                   LVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHRYVPKDF"
FT   CDS             complement(join(2206438..2206602,2206675..2206829,
FT                   2207661..2207926,2208158..>2208213))
FT                   /codon_start=1
FT                   /gene="Tpsab1"
FT                   /locus_tag="mCG_17632"
FT                   /product="tryptase alpha/beta 1, isoform CRA_c"
FT                   /note="gene_id=mCG17632.2 transcript_id=mCT191682.0
FT                   protein_id=mCP112653.0 isoform=CRA_c"
FT                   /protein_id="EDL22421.1"
FT                   /translation="HEKALWGDRRHMGTSGPGRDVADPNKVRVQLRKQYLYYHDHLMTV
FT                   SQIITHPDFYIVQDGADIALLKLTNPVNISDYVHPVPLPPASETFPSGTLCWVTGWGNI
FT                   DNGVNLPPPFPLQVPIIENHLCDLKYHKGLITGDNVHIVRDDMLCAGNEGHDSCQGDSG
FT                   GPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHRYVPKDF"
FT   CDS             complement(join(2207653..2207926,2208317..>2208426))
FT                   /codon_start=1
FT                   /gene="Tpsab1"
FT                   /locus_tag="mCG_17632"
FT                   /product="tryptase alpha/beta 1, isoform CRA_b"
FT                   /note="gene_id=mCG17632.2 transcript_id=mCT191681.0
FT                   protein_id=mCP112652.0 isoform=CRA_b"
FT                   /protein_id="EDL22420.1"
FT                   /translation="TSPHLQLGPHYSSLCPNAKAAAAHAAPPVQPGACSPRDVADPNKV
FT                   RVQLRKQYLYYHDHLMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDYVHPVPLPPA
FT                   SETFPSGTLCWVTGWGNIDNGGM"
FT   assembly_gap    2221708..2221727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2225296..2225315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2229293..2231611
FT                   /gene="Mcpt6"
FT                   /locus_tag="mCG_17668"
FT                   /note="gene_id=mCG17668.0"
FT   mRNA            join(2229293..2229366,2229506..2229671,2229792..2230057,
FT                   2230191..2230354,2231346..2231611)
FT                   /gene="Mcpt6"
FT                   /locus_tag="mCG_17668"
FT                   /product="mast cell protease 6"
FT                   /note="gene_id=mCG17668.0 transcript_id=mCT14939.0 created
FT                   on 31-MAY-2002"
FT   CDS             join(2229297..2229366,2229506..2229671,2229792..2230057,
FT                   2230191..2230354,2231346..2231372)
FT                   /codon_start=1
FT                   /gene="Mcpt6"
FT                   /locus_tag="mCG_17668"
FT                   /product="mast cell protease 6"
FT                   /note="gene_id=mCG17668.0 transcript_id=mCT14939.0
FT                   protein_id=mCP23136.1"
FT                   /protein_id="EDL22422.1"
FT                   /translation="MLKRRLLLLWALSLLASLVYSAPRPANQRVGIVGGHEASESKWPW
FT                   QVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLS
FT                   LNRIVVHPHYYTAEGGADVALLELEVPVNVSTHIHPISLPPASETFPPGTSCWVTGWGD
FT                   IDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQ
FT                   PFCIGDDI"
FT   gene            2231785..2236980
FT                   /gene="Tpsg1"
FT                   /locus_tag="mCG_17638"
FT                   /note="gene_id=mCG17638.2"
FT   mRNA            join(2231785..2231930,2235704..2235969,2236254..2236399,
FT                   2236487..2236980)
FT                   /gene="Tpsg1"
FT                   /locus_tag="mCG_17638"
FT                   /product="tryptase gamma 1, transcript variant mCT173553"
FT                   /note="gene_id=mCG17638.2 transcript_id=mCT173553.0 created
FT                   on 19-SEP-2002"
FT   mRNA            join(2233118..2233225,2235002..2235173,2235704..2235969,
FT                   2236254..2236399,2236487..2236964)
FT                   /gene="Tpsg1"
FT                   /locus_tag="mCG_17638"
FT                   /product="tryptase gamma 1, transcript variant mCT14893"
FT                   /note="gene_id=mCG17638.2 transcript_id=mCT14893.2 created
FT                   on 19-SEP-2002"
FT   CDS             join(2233177..2233225,2235002..2235173,2235704..2235969,
FT                   2236254..2236399,2236487..2236789)
FT                   /codon_start=1
FT                   /gene="Tpsg1"
FT                   /locus_tag="mCG_17638"
FT                   /product="tryptase gamma 1, isoform CRA_b"
FT                   /note="gene_id=mCG17638.2 transcript_id=mCT14893.2
FT                   protein_id=mCP23197.0 isoform=CRA_b"
FT                   /db_xref="GOA:D5L840"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:D5L840"
FT                   /protein_id="EDL22424.1"
FT                   /translation="MALGPNCGILLFLAVSGCGHPQVSNSGSRIVGGHAAPAGTWPWQA
FT                   SLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELTVTLSPHFSTVKRIIM
FT                   YTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGMQCWVTGWGYTGEGE
FT                   PLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARGPGDACQDDSGGPLVCQV
FT                   AGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEAGGSGMQGLPWAPLLAAL
FT                   FWPSLFLLLVSGVLMAKYWLSSPSHAASEL"
FT   CDS             join(2235792..2235969,2236254..2236399,2236487..2236789)
FT                   /codon_start=1
FT                   /gene="Tpsg1"
FT                   /locus_tag="mCG_17638"
FT                   /product="tryptase gamma 1, isoform CRA_a"
FT                   /note="gene_id=mCG17638.2 transcript_id=mCT173553.0
FT                   protein_id=mCP96472.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA07"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="MGI:MGI:1349391"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA07"
FT                   /protein_id="EDL22423.1"
FT                   /translation="MYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPG
FT                   MQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARGPG
FT                   DACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEAGG
FT                   SGMQGLPWAPLLAALFWPSLFLLLVSGVLMAKYWLSSPSHAASEL"
FT   gene            complement(2236879..>2295582)
FT                   /locus_tag="mCG_17637"
FT                   /note="gene_id=mCG17637.1"
FT   mRNA            complement(join(2236879..2238675,2239376..2239536,
FT                   2239701..2239869,2239962..2240207,2240294..2240415,
FT                   2241313..2241391,2242638..2242708,2242933..2243066,
FT                   2243217..2243326,2243823..2243993,2245474..2245666,
FT                   2245855..2245944,2246048..2246173,2246355..2246481,
FT                   2246660..2246844,2246938..2247006,2247087..2247210,
FT                   2247371..2247471,2247976..2248398,2249385..2249593,
FT                   2249896..2249986,2250162..2250317,2250462..2250579,
FT                   2250981..2251166,2251757..2251908,2253523..2253962,
FT                   2254255..2255044,2255944..2256036,2256162..2256477,
FT                   2257771..2257930,2259694..2259791,2259954..2260087,
FT                   2260167..2260278,2295284..>2295582))
FT                   /locus_tag="mCG_17637"
FT                   /product="mCG17637"
FT                   /note="gene_id=mCG17637.1 transcript_id=mCT14892.1 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2243307..2243326,2243823..2243993,
FT                   2245474..2245666,2245855..2245944,2246048..2246173,
FT                   2246355..2246481,2246660..2246844,2246938..2247006,
FT                   2247087..2247210,2247371..2247471,2247976..2248398,
FT                   2249385..2249593,2249896..2249986,2250162..2250317,
FT                   2250462..2250579,2250981..2251166,2251757..2251908,
FT                   2253523..2253962,2254255..2255044,2255944..2256036,
FT                   2256162..2256477,2257771..2257930,2259694..2259791,
FT                   2259954..2260087,2260167..2260278,2295284..2295582))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17637"
FT                   /product="mCG17637"
FT                   /note="gene_id=mCG17637.1 transcript_id=mCT14892.1
FT                   protein_id=mCP23144.1"
FT                   /protein_id="EDL22425.1"
FT                   /translation="MTEGTLAADEVRVPLGASPSAPAAPVRASPASPGVPGREEQRGSG
FT                   SSVLAPESPGTECGADLGADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEH
FT                   ISMLVIMLNCVTLGMFRPCEDVECRSERCSILEAFDDFIFAFFAVEMVIKMVALGLFGQ
FT                   KCYLGDTWNRLDFFIVMAGMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTL
FT                   LLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQT
FT                   EEGEENPFICSSRRDNGMQKCSHIPSRRELRVQCTLGWEAYGQPQAEDGGAGRNACINW
FT                   NQYYNVCRSGEFNPHNGAINFDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYF
FT                   ILLIIVGSFFMINLCLVVIATQFSETKQRENQLMREQRARYLSNDSTLASFSEPGSCYE
FT                   ELLKYVGHIFRKVKRRSLRLYARWQSRWRKKVDPSSTLHGQGPRRRPRRAGRRTASVHH
FT                   LVYHHHHHHHHHYHFSHGGPRRPSPEPGAGDTRLVRACVPPSPPSPGHGPPDSESVHSI
FT                   YHADCHVEGPQERARVAHTIATAASLKLASGLGTMNYPTILPSGAVNSKGSTSSRPKGL
FT                   RSAGTPGATAHSPLSLGSPSPYEKIQHVVGEQGLGRASSHLSGLSVPCPLPSPQAGTLT
FT                   CELKSCPYCASALEDPEFEFSGSESGDSDAHGVYEFTQDVRHGDCRDPVQQPHEGGTPG
FT                   HGNERWRPPLRTASQPGGLGRLWASFSSKLRRIVDSKYFNRGIMAAILVNTLSMGVEYH
FT                   EQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIFDGIVVVISVWEIVG
FT                   QADGGLSVLRTFRLLRVLKLVRFLPALRRQLVVLMRTMDNVATFCMLLMLFIFIFSILG
FT                   MHLFGCKFSLKTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSSWAA
FT                   LYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRSDTDEDKTSTHLEEDFDKLRDVRAT
FT                   EMKMYSLAVTPNGHLEGRGSLPPPLITHTAATPMPTPKSSPHLDMAHTLLDSRRSSSGS
FT                   VDPQLGDQKSLASLRSSPCAPWGPNSAGSSRRSSWNSLGRAPSLKRRSQCGERESLLSG
FT                   EGKGSTDDEAEDSRPNSGTHPGASPGPRATPLRRAESLGHRSTMDLCPPRPATLLPTKF
FT                   RDCNGQMVALPSEFFLRIDSHKEDAAEFDDDIEDSCCFRLHKVLEPYAPQWCSSRESWA
FT                   LYLFPPQNRLRVSCQKVIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERAFLSVSN
FT                   YIFTAIFVVEMMVKVVALGLLWGEHAYLQSSWNVLDGLLVLVSLVDIIVAVASAGGAKI
FT                   LGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQ
FT                   LFKGKFYYCEGTDTRNITTKAECHAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNI
FT                   MYDGLDAVGIDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAE
FT                   EARRREEKRLRRLERRRRTAPLSHRGPAPALLRRLFTHAPLHPFAVHQPLPGPLHHLHH
FT                   LPQCHHHVHGALQPAQVSGRGP"
FT   assembly_gap    2278052..2278154
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    2296633..2296652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2304877..2304896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2334957..2339961
FT                   /locus_tag="mCG_17650"
FT                   /note="gene_id=mCG17650.1"
FT   mRNA            join(2334957..2335625,2337107..2337177,2337484..2337627,
FT                   2338008..2338230,2338927..2339081,2339690..2339961)
FT                   /locus_tag="mCG_17650"
FT                   /product="mCG17650"
FT                   /note="gene_id=mCG17650.1 transcript_id=mCT14923.1 created
FT                   on 31-MAY-2002"
FT   CDS             join(2335092..2335625,2337107..2337177,2337484..2337627,
FT                   2338008..2338230,2338927..2339081,2339690..2339906)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17650"
FT                   /product="mCG17650"
FT                   /note="gene_id=mCG17650.1 transcript_id=mCT14923.1
FT                   protein_id=mCP23252.1"
FT                   /protein_id="EDL22426.1"
FT                   /translation="MAQTGVLLTKEPAPQSIDVCELPRKEYEVACNTGAYTSSGLATAG
FT                   FRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVG
FT                   ERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQ
FT                   HPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVY
FT                   NIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNQDNLLRAERERLASVNLRKL
FT                   IDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALK
FT                   QAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAE
FT                   QALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGYQ"
FT   assembly_gap    2348120..2348139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2351508..2351527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2353254..2353273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2355668..2355687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2356739..2356758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2358537..>2359694)
FT                   /locus_tag="mCG_49768"
FT                   /note="gene_id=mCG49768.1"
FT   mRNA            complement(<2358537..>2359694)
FT                   /locus_tag="mCG_49768"
FT                   /product="mCG49768"
FT                   /note="gene_id=mCG49768.1 transcript_id=mCT49951.1 created
FT                   on 31-MAY-2002"
FT   CDS             complement(2358537..2359694)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49768"
FT                   /product="mCG49768"
FT                   /note="gene_id=mCG49768.1 transcript_id=mCT49951.1
FT                   protein_id=mCP42861.1"
FT                   /db_xref="GOA:Q9JK40"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000586"
FT                   /db_xref="InterPro:IPR001184"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JK40"
FT                   /protein_id="EDL22427.1"
FT                   /translation="MCPLVTPSSLAEIHVLWHPEPDSMEPLSLASTPSWNASAASSGSH
FT                   NWSLVDPVSPMGARAVLVPVLYLLVCTVGLGGNTLVIYVVLRYAKMKTVTNVYILNLAV
FT                   ADVLFMLGLPFLATQNAVSYWPFGSFLCRLVMTLDGINQFTSIFCLMVMSVDRYLAVVH
FT                   PLRSARWRRPRVAKLASAAVWVFSLLMSLPLLVFADVQEGWGTCNLSWPEPVGLWGAAF
FT                   ITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRRRSERKVTRMVVVVVLVFVG
FT                   CWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCANPLLYGFLSDNFRQSFRKA
FT                   LCLRRGYGVEDADAIEPRPDKSGRPQTTLPTRSCEANGLMQTSRL"
FT   assembly_gap    2365493..2365619
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    2374419..2374983
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   gene            2386100..>2390135
FT                   /locus_tag="mCG_1033966"
FT                   /note="gene_id=mCG1033966.0"
FT   mRNA            join(2386100..2386147,2386457..2386643,2389832..>2390135)
FT                   /locus_tag="mCG_1033966"
FT                   /product="mCG1033966"
FT                   /note="gene_id=mCG1033966.0 transcript_id=mCT151670.0
FT                   created on 31-MAY-2002"
FT   CDS             2389950..2390135
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033966"
FT                   /product="mCG1033966"
FT                   /note="gene_id=mCG1033966.0 transcript_id=mCT151670.0
FT                   protein_id=mCP84665.1"
FT                   /protein_id="EDL22428.1"
FT                   /translation="MVRSLPHATHGNRVQVEGWLYREHGDLTAKKKKHDILIKMCWRNF
FT                   SQHDANIRNHKGVHSS"
FT   assembly_gap    2406509..2406556
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            complement(2415872..2416513)
FT                   /pseudo
FT                   /locus_tag="mCG_1033938"
FT                   /note="gene_id=mCG1033938.1"
FT   mRNA            complement(2415872..2416513)
FT                   /pseudo
FT                   /locus_tag="mCG_1033938"
FT                   /note="gene_id=mCG1033938.1 transcript_id=mCT151642.1
FT                   created on 31-MAY-2002"
FT   gene            complement(2432901..2437888)
FT                   /gene="Sox8"
FT                   /locus_tag="mCG_17675"
FT                   /note="gene_id=mCG17675.1"
FT   mRNA            complement(join(2432901..2433292,2435045..2435091,
FT                   2435841..2436073,2437123..2437888))
FT                   /gene="Sox8"
FT                   /locus_tag="mCG_17675"
FT                   /product="SRY-box containing gene 8, transcript variant
FT                   mCT14946"
FT                   /note="gene_id=mCG17675.1 transcript_id=mCT14946.1 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2433023..2433292,2435045..2435091,
FT                   2435841..2436073,2437123..2437535))
FT                   /codon_start=1
FT                   /gene="Sox8"
FT                   /locus_tag="mCG_17675"
FT                   /product="SRY-box containing gene 8, isoform CRA_a"
FT                   /note="gene_id=mCG17675.1 transcript_id=mCT14946.1
FT                   protein_id=mCP23331.2 isoform=CRA_a"
FT                   /protein_id="EDL22429.1"
FT                   /translation="MLDMSEARAQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRA
FT                   GGGGRGDTAEAADERFPACIRDAVSQVLKGYDWSLVPMPVRGGGGGTLKAKPHVKRPMN
FT                   AFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDH
FT                   PDYKYQPRRRKSVKTGRSDSDSGTELGHHPGGPMYKADAVLGEAHHHSDHHTGQTHGPP
FT                   TPPTTPKTDLPCLRRCVECINRLRHGNLCLEHFVYLLTFEKFRFFLIFLLFLPFFRGEK
FT                   KIQPFFSFFSLSPSGGRGGNHSKLIFMQSFFFFFFFFWC"
FT   mRNA            complement(join(<2434343..2435091,2435841..2436073,
FT                   2437123..2437583))
FT                   /gene="Sox8"
FT                   /locus_tag="mCG_17675"
FT                   /product="SRY-box containing gene 8, transcript variant
FT                   mCT169690"
FT                   /note="gene_id=mCG17675.1 transcript_id=mCT169690.0 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2434343..2435091,2435841..2436073,
FT                   2437123..2437535))
FT                   /codon_start=1
FT                   /gene="Sox8"
FT                   /locus_tag="mCG_17675"
FT                   /product="SRY-box containing gene 8, isoform CRA_b"
FT                   /note="gene_id=mCG17675.1 transcript_id=mCT169690.0
FT                   protein_id=mCP92679.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q543C3"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR022151"
FT                   /db_xref="InterPro:IPR031265"
FT                   /db_xref="MGI:MGI:98370"
FT                   /db_xref="UniProtKB/TrEMBL:Q543C3"
FT                   /protein_id="EDL22430.1"
FT                   /translation="MLDMSEARAQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRA
FT                   GGGGRGDTAEAADERFPACIRDAVSQVLKGYDWSLVPMPVRGGGGGTLKAKPHVKRPMN
FT                   AFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDH
FT                   PDYKYQPRRRKSVKTGRSDSDSGTELGHHPGGPMYKADAVLGEAHHHSDHHTGQTHGPP
FT                   TPPTTPKTDLHQASNGSKQELRLEGRRLVDSGRQNIDFSNVDISELSSEVISNMDTFDV
FT                   HEFDQYLPLNGHSALPTEPSQATASGSYGGASYSHSGATGIGASPVWAHKGAPSASASP
FT                   TEAGPLRPQIKTEQLSPSHYNDQSHGSPGRADYGSYSAQASVTTAASATAASSFASAQC
FT                   DYTDLQASNYYSPYPGYPPSLYQYPYFHSSRRPYASPLLNGLSMPPAHSPSSNWDQPVY
FT                   TTLTRP"
FT   gene            2437929..2442053
FT                   /locus_tag="mCG_147773"
FT                   /note="gene_id=mCG147773.0"
FT   mRNA            join(2437929..2438114,2441005..2442053)
FT                   /locus_tag="mCG_147773"
FT                   /product="mCG147773"
FT                   /note="gene_id=mCG147773.0 transcript_id=mCT188036.0
FT                   created on 13-JAN-2004"
FT   CDS             2441661..2441816
FT                   /codon_start=1
FT                   /locus_tag="mCG_147773"
FT                   /product="mCG147773"
FT                   /note="gene_id=mCG147773.0 transcript_id=mCT188036.0
FT                   protein_id=mCP108950.0"
FT                   /protein_id="EDL22431.1"
FT                   /translation="MPGFVWGTLHHTDPGFPHYLLHARILRLLIPSEVRHNVPEQMLMG
FT                   THCWAT"
FT   gene            2446198..2529610
FT                   /gene="2400010G15Rik"
FT                   /locus_tag="mCG_17631"
FT                   /note="gene_id=mCG17631.1"
FT   mRNA            join(2446198..2446398,2452560..2452869,2455685..2455695,
FT                   2479284..2479432,2498861..2498977,2512248..2512415,
FT                   2521201..2521387,2521869..2522022,2522166..2522349,
FT                   2522782..2522894,2529303..2529610)
FT                   /gene="2400010G15Rik"
FT                   /locus_tag="mCG_17631"
FT                   /product="RIKEN cDNA 2400010G15, transcript variant
FT                   mCT14886"
FT                   /note="gene_id=mCG17631.1 transcript_id=mCT14886.1 created
FT                   on 31-MAY-2002"
FT   mRNA            join(<2446205..2446398,2479284..2479432,2498861..2498926,
FT                   2512248..2512415,2521201..2521387,2521869..2522022,
FT                   2522166..2522349,2522782..2522894,2529303..2529508)
FT                   /gene="2400010G15Rik"
FT                   /locus_tag="mCG_17631"
FT                   /product="RIKEN cDNA 2400010G15, transcript variant
FT                   mCT191677"
FT                   /note="gene_id=mCG17631.1 transcript_id=mCT191677.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(2446206..2446398,2452560..2452869,2455685..2455695,
FT                   2479284..2479432,2498861..2498977,2512248..2512415,
FT                   2521201..2521387,2521869..2522022,2522166..2522349,
FT                   2522782..2522894,2529303..2529492)
FT                   /codon_start=1
FT                   /gene="2400010G15Rik"
FT                   /locus_tag="mCG_17631"
FT                   /product="RIKEN cDNA 2400010G15, isoform CRA_a"
FT                   /note="gene_id=mCG17631.1 transcript_id=mCT14886.1
FT                   protein_id=mCP23323.2 isoform=CRA_a"
FT                   /protein_id="EDL22432.1"
FT                   /translation="MRPDSLVMAAPEGSLRKRKVGGAEHSPASQPSLARDPADSPARLH
FT                   TGTFWLTRIVLLRALAFIYFVAFLVAFNQNKALIGDRGLLPCKLYLKNVQEYFQGSTGW
FT                   AAWTYAPTIMWLLDWSDMNFNLDLIALLGLGISSFVLVTGCANMILMTALWALYMSLVN
FT                   VGQIWYSFGWESQLLETGFLGIFLSPLWTLSRLPKNTPTSQIVLWGFRWLIFRIMLGAG
FT                   LIKVRGDKCWLDLTCMDFHYEVSTDLAVAEASVSLLSETQPVPNPIAYYLHRSPWWFHR
FT                   FETLSNHFVELLVPFFLFLGRRMRILHGVLQILFQVILIISGNLSFLNWLTIVPSLACF
FT                   DDAALGFLFPSGPQGLKKQVLEIQREDTQRVQPKPRDRGCLVRQVVNISLGILVAWLSV
FT                   PVVINLLSSRQIMNTSFNPLRIVNTYGAFGSVTKERTEVILQGTVSPNASAPDAVWEDY
FT                   EFKCKPGDPWRQPCLISPYHYRLDWLMWFAAFQTYEQNEWILHLAGKLLAGDSEALALL
FT                   AVNPFEGRTPPRWIRGEHYRYKFSLPGGQHATQGKWWIRKRIGPYFPPLRLEDLKEYFK
FT                   TREWPLPEPPSRHTR"
FT   mRNA            join(<2446208..2446398,2452560..2452873,2479284..2479432,
FT                   2498861..2498926,2512248..2512415,2521201..2521387,
FT                   2521869..2522022,2522166..2522349,2522782..2522894,
FT                   2529303..2529512)
FT                   /gene="2400010G15Rik"
FT                   /locus_tag="mCG_17631"
FT                   /product="RIKEN cDNA 2400010G15, transcript variant
FT                   mCT191676"
FT                   /note="gene_id=mCG17631.1 transcript_id=mCT191676.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2452609..2452873,2479284..2479432,2498861..2498926,
FT                   2512248..2512415,2521201..2521387,2521869..2522022,
FT                   2522166..2522349,2522782..2522894,2529303..2529492)
FT                   /codon_start=1
FT                   /gene="2400010G15Rik"
FT                   /locus_tag="mCG_17631"
FT                   /product="RIKEN cDNA 2400010G15, isoform CRA_b"
FT                   /note="gene_id=mCG17631.1 transcript_id=mCT191676.0
FT                   protein_id=mCP112650.0 isoform=CRA_b"
FT                   /protein_id="EDL22433.1"
FT                   /translation="PGPAALQTVPEECPGVLPGQHWLGCLDLCTNHYVVVGLVRHELQP
FT                   GPHCSSWAGHLVLCPGDRLCQHDTHDCPLGPLHVPGQRRADLVRWESQLLETGFLGIFL
FT                   SPLWTLSRLPKNTPTSQIVLWGFRWLIFRIMLGAGLIKVRGDKCWLDLTCMDFHYETQP
FT                   VPNPIAYYLHRSPWWFHRFETLSNHFVELLVPFFLFLGRRMRILHGVLQILFQVILIIS
FT                   GNLSFLNWLTIVPSLACFDDAALGFLFPSGPQGLKKQVLEIQREDTQRVQPKPRDRGCL
FT                   VRQVVNISLGILVAWLSVPVVINLLSSRQIMNTSFNPLRIVNTYGAFGSVTKERTEVIL
FT                   QGTVSPNASAPDAVWEDYEFKCKPGDPWRQPCLISPYHYRLDWLMWFAAFQTYEQNEWI
FT                   LHLAGKLLAGDSEALALLAVNPFEGRTPPRWIRGEHYRYKFSLPGGQHATQGKWWIRKR
FT                   IGPYFPPLRLEDLKEYFKTREWPLPEPPSRHTR"
FT   CDS             join(<2479286..2479432,2498861..2498926,2512248..2512415,
FT                   2521201..2521387,2521869..2522022,2522166..2522349,
FT                   2522782..2522894,2529303..2529492)
FT                   /codon_start=1
FT                   /gene="2400010G15Rik"
FT                   /locus_tag="mCG_17631"
FT                   /product="RIKEN cDNA 2400010G15, isoform CRA_c"
FT                   /note="gene_id=mCG17631.1 transcript_id=mCT191677.0
FT                   protein_id=mCP112651.0 isoform=CRA_c"
FT                   /protein_id="EDL22434.1"
FT                   /translation="WESQLLETGFLGIFLSPLWTLSRLPKNTPTSQIVLWGFRWLIFRI
FT                   MLGAGLIKVRGDKCWLDLTCMDFHYETQPVPNPIAYYLHRSPWWFHRFETLSNHFVELL
FT                   VPFFLFLGRRMRILHGVLQILFQVILIISGNLSFLNWLTIVPSLACFDDAALGFLFPSG
FT                   PQGLKKQVLEIQREDTQRVQPKPRDRGCLVRQVVNISLGILVAWLSVPVVINLLSSRQI
FT                   MNTSFNPLRIVNTYGAFGSVTKERTEVILQGTVSPNASAPDAVWEDYEFKCKPGDPWRQ
FT                   PCLISPYHYRLDWLMWFAAFQTYEQNEWILHLAGKLLAGDSEALALLAVNPFEGRTPPR
FT                   WIRGEHYRYKFSLPGGQHATQGKWWIRKRIGPYFPPLRLEDLKEYFKTREWPLPEPPSR
FT                   HTR"
FT   assembly_gap    2487796..2487979
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    2496169..2497078
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    2509728..2509821
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   gene            complement(<2564880..2565627)
FT                   /locus_tag="mCG_147771"
FT                   /note="gene_id=mCG147771.0"
FT   mRNA            complement(join(<2564880..2565087,2565533..2565627))
FT                   /locus_tag="mCG_147771"
FT                   /product="mCG147771"
FT                   /note="gene_id=mCG147771.0 transcript_id=mCT188034.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<2564880..2565085)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147771"
FT                   /product="mCG147771"
FT                   /note="gene_id=mCG147771.0 transcript_id=mCT188034.0
FT                   protein_id=mCP108942.0"
FT                   /protein_id="EDL22435.1"
FT                   /translation="MKLLEHSINTLKDRDYLFFLGLWKIFLKGLCDSQAQLRIDVRDPS
FT                   CVPGNKLVPPLTSPHFLTCFIFV"
FT   assembly_gap    2566594..2566613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2572084..2572857
FT                   /pseudo
FT                   /locus_tag="mCG_1033922"
FT                   /note="gene_id=mCG1033922.0"
FT   mRNA            2572084..2572857
FT                   /pseudo
FT                   /locus_tag="mCG_1033922"
FT                   /note="gene_id=mCG1033922.0 transcript_id=mCT151626.1
FT                   created on 31-MAY-2002"
FT   gene            2584254..2586115
FT                   /gene="Gng13"
FT                   /locus_tag="mCG_17639"
FT                   /note="gene_id=mCG17639.2"
FT   mRNA            join(2584254..2584308,2585698..2585829,2585958..2586115)
FT                   /gene="Gng13"
FT                   /locus_tag="mCG_17639"
FT                   /product="guanine nucleotide binding protein 13, gamma"
FT                   /note="gene_id=mCG17639.2 transcript_id=mCT14894.2 created
FT                   on 31-MAY-2002"
FT   CDS             join(2585732..2585829,2585958..2586063)
FT                   /codon_start=1
FT                   /gene="Gng13"
FT                   /locus_tag="mCG_17639"
FT                   /product="guanine nucleotide binding protein 13, gamma"
FT                   /note="gene_id=mCG17639.2 transcript_id=mCT14894.2
FT                   protein_id=mCP23207.1"
FT                   /protein_id="EDL22436.1"
FT                   /translation="MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKD
FT                   PFLNPDLMKNNPWVEKAKCTIL"
FT   gene            complement(2585957..2594423)
FT                   /gene="Chtf18"
FT                   /locus_tag="mCG_17653"
FT                   /note="gene_id=mCG17653.2"
FT   mRNA            complement(join(2585957..2586315,2586399..2586456,
FT                   2586683..2586814,2586896..2587040,2587631..2587761,
FT                   2587855..2588004,2588090..2588314,2589122..2589269,
FT                   2589677..2589807,2589875..2590344,2590434..2590582,
FT                   2590674..2590797,2591034..2591106,2591560..2591769,
FT                   2592527..2592665,2592773..2592825,2592911..2593003,
FT                   2593406..2593580,2593732..2593879,2593972..2594154,
FT                   2594278..>2594402))
FT                   /gene="Chtf18"
FT                   /locus_tag="mCG_17653"
FT                   /product="CTF18, chromosome transmission fidelity factor 18
FT                   homolog (S. cerevisiae), transcript variant mCT191689"
FT                   /note="gene_id=mCG17653.2 transcript_id=mCT191689.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2586061..2586315,2586399..2586456,
FT                   2586683..2586814,2586896..2587040,2587631..2587761,
FT                   2587855..2588004,2588090..2588314,2589122..2589269,
FT                   2589677..2589807,2589875..2589973,2590251..2590344,
FT                   2590434..2590582,2590674..2590797,2591034..2591131,
FT                   2591560..2591769,2592527..2592665,2592773..2592825,
FT                   2592911..2593003,2593406..2593580,2593732..2593879,
FT                   2593972..2594151,2594278..2594423))
FT                   /gene="Chtf18"
FT                   /locus_tag="mCG_17653"
FT                   /product="CTF18, chromosome transmission fidelity factor 18
FT                   homolog (S. cerevisiae), transcript variant mCT14925"
FT                   /note="gene_id=mCG17653.2 transcript_id=mCT14925.2 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2586179..2586315,2586399..2586456,
FT                   2586683..2586814,2586896..2587040,2587631..2587761,
FT                   2587855..2588004,2588090..2588314,2589122..2589269,
FT                   2589677..2589807,2589875..2589973,2590251..2590344,
FT                   2590434..2590582,2590674..2590797,2591034..2591131,
FT                   2591560..2591769,2592527..2592665,2592773..2592825,
FT                   2592911..2593003,2593406..2593580,2593732..2593879,
FT                   2593972..2594151,2594278..2594368))
FT                   /codon_start=1
FT                   /gene="Chtf18"
FT                   /locus_tag="mCG_17653"
FT                   /product="CTF18, chromosome transmission fidelity factor 18
FT                   homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG17653.2 transcript_id=mCT14925.2
FT                   protein_id=mCP23125.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0R4J0I4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2384887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0I4"
FT                   /protein_id="EDL22437.1"
FT                   /translation="MEDYEEDLYGVEDDFQNQFAAELEVLAELEGTRDQAPPGTLQTPA
FT                   SRPPLTFEEAIAGGDTVPRPCPAGSPGNVNRNTRKNVRRDQPAPSSPMVKRPRLDVVKK
FT                   LNFEPDMEELLYPDSPPGDITPPPSPEVFPEMLDAGYSDANADKDLMQTLPSPRNRNPV
FT                   LRRPPILEDYINVTSTSGERAFLVLRADLIGPGVQNPLLDVHWRGCGQLDLLGVPFASL
FT                   KEQVDSKRRQQLLEDAQQLSDTLHSLRSEGEEAVLEGPPAEEPAPGQNTAQHCLWVDEF
FT                   APQHYTELLSDDFTNRCLLKWLKLWDLVVFGRERPARKPRPGVETTRVGKEATAPGKWK
FT                   SHEQALEEMLEAELDPSQRPRQKVALLCGPPGLGKTTLAHVVARHAGYCVVEMNASDDR
FT                   SPEAFRTRIEAATQMESVLGVGGRPNCLVIDEIDGAPTAAINVLLGILNRKGPQEADQG
FT                   GTAVAAGGRRRRAEGGLLTRPIICICNDQFTPSLRQLKQQALLLHVPPTLPSRLVQRLQ
FT                   EISLQHGMRSDPGALVALCEKTDNDIRACINTLQFLYGRGRRELSVKAVQTTHVGLKDQ
FT                   RKGLFSVWQEVFQLPRTQRRIVGQDLMLPAHALLLSNGDKGSLTLASQRFYHILRVTTS
FT                   AGEHEKVVQGLFDNFLRLRLRDSSLSTVCCALDWLAFDDLLEQAAHRGQSFQLLCYLPF
FT                   VPAAFHVLFASSHVPRITFPSSQQEAQTRMSQTRNHIQTLVSGMAPTTRSRATPQALVL
FT                   DTLCLLLDVLAPKLRPVSTQLYSAHEKQQLSCLVGTMLAYSLTYHQERTPDGQYLYKLE
FT                   PNVEEVCRFPELPARKPLTYQAKQLIAREIEMEKMRRAEALAWARSGPQVDQGSSGPAS
FT                   LWTDSGEKGTRQPVPRNHEQRLEHIMTRATVQEQPERDFFGRVVIRKVAVPSREVEAPQ
FT                   KDADEWRMGVAVGRSEVWFRFNEGVSNAVRRSLYIRDLL"
FT   CDS             complement(join(2586179..2586315,2586399..2586456,
FT                   2586683..2586814,2586896..2587040,2587631..2587761,
FT                   2587855..2588004,2588090..2588314,2589122..2589269,
FT                   2589677..2589807,2589875..>2589973))
FT                   /codon_start=1
FT                   /gene="Chtf18"
FT                   /locus_tag="mCG_17653"
FT                   /product="CTF18, chromosome transmission fidelity factor 18
FT                   homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG17653.2 transcript_id=mCT191689.0
FT                   protein_id=mCP112658.0 isoform=CRA_b"
FT                   /protein_id="EDL22438.1"
FT                   /translation="ISLQHGMRSDPGALVALCEKTDNDIRACINTLQFLYGRGRRELSV
FT                   KAVQTTHVGLKDQRKGLFSVWQEVFQLPRTQRRIVGQDLMLPAHALLLSNGDKGSLTLA
FT                   SQRFYHILRVTTSAGEHEKVVQGLFDNFLRLRLRDSSLSTVCCALDWLAFDDLLEQAAH
FT                   RGQSFQLLCYLPFVPAAFHVLFASSHVPRITFPSSQQEAQTRMSQTRNHIQTLVSGMAP
FT                   TTRSRATPQALVLDTLCLLLDVLAPKLRPVSTQLYSAHEKQQLSCLVGTMLAYSLTYHQ
FT                   ERTPDGQYLYKLEPNVEEVCRFPELPARKPLTYQAKQLIAREIEMEKMRRAEALAWARS
FT                   GPQVDQGSSGPASLWTDSGEKGTRQPVPRNHEQRLEHIMTRATVQEQPERDFFGRVVIR
FT                   KVAVPSREVEAPQKDADEWRMGVAVGRSEVWFRFNEGVSNAVRRSLYIRDLL"
FT   gene            2594759..2598494
FT                   /gene="Rpusd1"
FT                   /locus_tag="mCG_17652"
FT                   /note="gene_id=mCG17652.2"
FT   mRNA            join(2594759..2594878,2595234..2595422,2595554..2595677,
FT                   2595857..2595959,2596099..2596200,2597400..2597539,
FT                   2598216..2598486)
FT                   /gene="Rpusd1"
FT                   /locus_tag="mCG_17652"
FT                   /product="RNA pseudouridylate synthase domain containing 1,
FT                   transcript variant mCT14924"
FT                   /note="gene_id=mCG17652.2 transcript_id=mCT14924.1 created
FT                   on 31-MAY-2002"
FT   mRNA            join(2594760..2594878,2595554..2595677,2595857..2595959,
FT                   2596099..2596200,2597400..2598487)
FT                   /gene="Rpusd1"
FT                   /locus_tag="mCG_17652"
FT                   /product="RNA pseudouridylate synthase domain containing 1,
FT                   transcript variant mCT169848"
FT                   /note="gene_id=mCG17652.2 transcript_id=mCT169848.0 created
FT                   on 31-MAY-2002"
FT   mRNA            join(2594821..2594878,2595234..2595422,2595554..2595677,
FT                   2595857..2595959,2596099..2596200,2597400..2598494)
FT                   /gene="Rpusd1"
FT                   /locus_tag="mCG_17652"
FT                   /product="RNA pseudouridylate synthase domain containing 1,
FT                   transcript variant mCT169849"
FT                   /note="gene_id=mCG17652.2 transcript_id=mCT169849.0 created
FT                   on 31-MAY-2002"
FT   CDS             join(2595241..2595422,2595554..2595677,2595857..2595959,
FT                   2596099..2596200,2597400..2597539,2598216..2598275)
FT                   /codon_start=1
FT                   /gene="Rpusd1"
FT                   /locus_tag="mCG_17652"
FT                   /product="RNA pseudouridylate synthase domain containing 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17652.2 transcript_id=mCT14924.1
FT                   protein_id=mCP23260.2 isoform=CRA_a"
FT                   /protein_id="EDL22439.1"
FT                   /translation="MEPGSMENLSIVYQSSDFLVVNKHWDLRIDSKTWRETLTLQKQLR
FT                   HHFPELADPDTCYGFRFCHQLDFSTSGALCVALNKAAAGSAYKCFKERRVTKAYLALVR
FT                   GHVQESQVTINYAIGRNSTEGRTHTMCIEGTHGCENPKPSLTELLVLEHGLYAGDPVSK
FT                   VLLKPLTGRTHQLRVHCSALGHPIVGDLTYGQAEDQEDQPFRMMLHAFYLRIPTCMGVC
FT                   WGIYRGILHACPVL"
FT   CDS             join(2595241..2595422,2595554..2595677,2595857..2595959,
FT                   2596099..2596200,2597400..2597809)
FT                   /codon_start=1
FT                   /gene="Rpusd1"
FT                   /locus_tag="mCG_17652"
FT                   /product="RNA pseudouridylate synthase domain containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17652.2 transcript_id=mCT169849.0
FT                   protein_id=mCP92694.0 isoform=CRA_b"
FT                   /protein_id="EDL22440.1"
FT                   /translation="MEPGSMENLSIVYQSSDFLVVNKHWDLRIDSKTWRETLTLQKQLR
FT                   HHFPELADPDTCYGFRFCHQLDFSTSGALCVALNKAAAGSAYKCFKERRVTKAYLALVR
FT                   GHVQESQVTINYAIGRNSTEGRTHTMCIEGTHGCENPKPSLTELLVLEHGLYAGDPVSK
FT                   VLLKPLTGRTHQLRVHCSALGHPIVGDLTYGQAEDQEDQPFRMMLHAFYLRIPTQAERV
FT                   EACTPDPFLPALDACWSPSTCVQPLEQLIQALRTDPDPDPMSGGPRPCSPSTPQPRPGR
FT                   PPPETEAQRASCLQWLSEWTLEPDN"
FT   CDS             join(2595938..2595959,2596099..2596200,2597400..2597809)
FT                   /codon_start=1
FT                   /gene="Rpusd1"
FT                   /locus_tag="mCG_17652"
FT                   /product="RNA pseudouridylate synthase domain containing 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG17652.2 transcript_id=mCT169848.0
FT                   protein_id=mCP92683.0 isoform=CRA_c"
FT                   /protein_id="EDL22441.1"
FT                   /translation="MCIEGTHGCENPKPSLTELLVLEHGLYAGDPVSKVLLKPLTGRTH
FT                   QLRVHCSALGHPIVGDLTYGQAEDQEDQPFRMMLHAFYLRIPTQAERVEACTPDPFLPA
FT                   LDACWSPSTCVQPLEQLIQALRTDPDPDPMSGGPRPCSPSTPQPRPGRPPPETEAQRAS
FT                   CLQWLSEWTLEPDN"
FT   gene            <2600287..2615390
FT                   /gene="BC052484"
FT                   /locus_tag="mCG_1033939"
FT                   /note="gene_id=mCG1033939.1"
FT   mRNA            join(<2600287..2600580,2604813..2604940,2605955..2606174,
FT                   2609711..2609796,2609978..2610104,2610182..2610372,
FT                   2610726..2610816,2611014..2611155,2611518..2611705,
FT                   2611777..2611932,2612019..2612146,2613116..2613188,
FT                   2613344..2613460,2613834..2614083,2614953..2615390)
FT                   /gene="BC052484"
FT                   /locus_tag="mCG_1033939"
FT                   /product="cDNA sequence BC052484, transcript variant
FT                   mCT151643"
FT                   /note="gene_id=mCG1033939.1 transcript_id=mCT151643.1
FT                   created on 31-MAY-2002"
FT   mRNA            join(<2603075..2603336,2603898..2603998,2604820..2604940,
FT                   2605984..2606104,2609711..2609796,2609978..2610104,
FT                   2610182..2610372,2610726..2610816,2611014..2611155,
FT                   2611518..2611705,2611777..2611932,2612019..2612146,
FT                   2613116..2613246,2613366..2613460,2613834..2614083,
FT                   2614953..2615390)
FT                   /gene="BC052484"
FT                   /locus_tag="mCG_1033939"
FT                   /product="cDNA sequence BC052484, transcript variant
FT                   mCT191713"
FT                   /note="gene_id=mCG1033939.1 transcript_id=mCT191713.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<2603941..2603998,2604820..2604940,2605984..2606104,
FT                   2609711..2609796,2609978..2610104,2610182..2610372,
FT                   2610726..2610816,2611014..2611155,2611518..2611705,
FT                   2611777..2611932,2612019..2612146,2613116..2613246,
FT                   2613366..2613460,2613834..2614083,2614953..2615140)
FT                   /codon_start=1
FT                   /gene="BC052484"
FT                   /locus_tag="mCG_1033939"
FT                   /product="cDNA sequence BC052484, isoform CRA_b"
FT                   /note="gene_id=mCG1033939.1 transcript_id=mCT191713.0
FT                   protein_id=mCP112661.0 isoform=CRA_b"
FT                   /protein_id="EDL22443.1"
FT                   /translation="DISARMSRTLRPSAMGSRVGALASPGLALLLSLTAHCSGPQAKGL
FT                   PKGGLNASEANTWVRNNTSLLQNFWCLPASQLPREQLSSLIRSLASQRVALKAWQLSCL
FT                   ANLAAQLGLQDDFEFHPPNLLLFYDLSQVGDTNCRAFIHHAAQGDTELLTNLPNQRVAL
FT                   QRTALACLGGPHLQLSASDLWLLGVLVCDMEAAQIVTADPSVLRNLLRCPRLTVMQTAA
FT                   LNTLLASGKTQIGPPGSWNLQGLQALGLLATYISPHLWEKVQEAVGLDFFRSVVAACRA
FT                   GQLSRHDARRFVDNFLESKATSVSSRPKRRTGRSCVRGNITAATLHDDLFLVHYDCTQL
FT                   ESCLGTRVLRANLDPLLQHPLPAECQRVVKAKLTQIYPHGIPEDQLHLIPSLVYLYSLA
FT                   EIGQWNITSGDTVMILLASDAALDNQTEAVLQRFLDHNGKVTGALLVAIGGSRLCWMSL
FT                   KQLQFIQPSEFRLAGAPDISPCPQSRKDALFVKAHEVFRNTSNVGEYYYLIRPYLGGAP
FT                   LEELQYLAQANISMDIDTFTNLNPLTLKSMGVDSVRNLLGQNLGDLRKARNHPNVILWM
FT                   HSHNMTDLSDMGLYTSPTQAYVANRPPNTAYPPSSLIHSLDPPGNDGVSHTSGSPPVHL
FT                   GYLSLAVALPSSLLWLLLCQLPSGQMATAHRTLGPMALAQGSWTPEHQIPEKRSC"
FT   CDS             join(<2606109..2606174,2609711..2609796,2609978..2610104,
FT                   2610182..2610372,2610726..2610816,2611014..2611155,
FT                   2611518..2611705,2611777..2611932,2612019..2612146,
FT                   2613116..2613188,2613344..2613460,2613834..2614083,
FT                   2614953..2615140)
FT                   /codon_start=1
FT                   /gene="BC052484"
FT                   /locus_tag="mCG_1033939"
FT                   /product="cDNA sequence BC052484, isoform CRA_a"
FT                   /note="gene_id=mCG1033939.1 transcript_id=mCT151643.1
FT                   protein_id=mCP84640.1 isoform=CRA_a"
FT                   /protein_id="EDL22442.1"
FT                   /translation="VLQGPKRAQVSRGTTGIQESAQLSCLANLAAQLGLQDDFEFHPPN
FT                   LLLFYDLSQVGDTNCRAFIHHAAQGDTELLTNLPNQRVALQRTALACLGGPHLQLSASD
FT                   LWLLGVLVCDMEAAQIVTADPSVLRNLLRCPRLTVMQTAALNTLLASGKTQIGPPGSWN
FT                   LQGLQALGLLATYISPHLWEKVQEAVGLDFFRSVVAACRAGQLSRHDARRFVDNFLESK
FT                   ATSVSSRPKRRTGRSCVRGNITAATLHDDLFLVHYDCTQLESCLGTRVLRANLDPLLQH
FT                   PLPAECQRVVKAKLTQIYPHGIPEDQLHLIPSLVYLYSLAEIGQWNITSGDTVMILLAS
FT                   DAALDNQTEAVLQRFLDHNGKVTGALLVAIGGSRLCWMSLKQLQFIQPSEFRLAGAPDI
FT                   SPCPQSRKDALFVKAHEGSHPLPLGGAPLEELQYLAQANISMDIDTFTNLNPLTLKSMG
FT                   VDSVRNLLGQNLGDLRKARNHPNVILWMHSHNMTDLSDMGLYTSPTQAYVANRPPNTAY
FT                   PPSSLIHSLDPPGNDGVSHTSGSPPVHLGYLSLAVALPSSLLWLLLCQLPSGQMATAHR
FT                   TLGPMALAQGSWTPEHQIPEKRSC"
FT   assembly_gap    2609135..2609272
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   gene            complement(2615674..2621387)
FT                   /gene="Msln"
FT                   /locus_tag="mCG_17640"
FT                   /note="gene_id=mCG17640.1"
FT   mRNA            complement(join(2615674..2615890,2615961..2616147,
FT                   2616509..2616603,2616886..2617013,2617091..2617233,
FT                   2617319..2617474,2617735..2617913,2618139..2618238,
FT                   2618313..2618403,2618630..2618823,2618916..2619045,
FT                   2619349..2619434,2620002..2620122,2620438..2620484,
FT                   2620834..2620877,2621192..2621387))
FT                   /gene="Msln"
FT                   /locus_tag="mCG_17640"
FT                   /product="mesothelin"
FT                   /note="gene_id=mCG17640.1 transcript_id=mCT14895.1 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2615802..2615890,2615961..2616147,
FT                   2616509..2616603,2616886..2617013,2617091..2617233,
FT                   2617319..2617474,2617735..2617913,2618139..2618238,
FT                   2618313..2618403,2618630..2618823,2618916..2619045,
FT                   2619349..2619434,2620002..2620122,2620438..2620484,
FT                   2620834..2620877,2621192..2621279))
FT                   /codon_start=1
FT                   /gene="Msln"
FT                   /locus_tag="mCG_17640"
FT                   /product="mesothelin"
FT                   /note="gene_id=mCG17640.1 transcript_id=mCT14895.1
FT                   protein_id=mCP23209.1"
FT                   /protein_id="EDL22444.1"
FT                   /translation="MALPTARPLLGSCGSPICSRSFLLLLLSLGWIPRLQTQTTKTSQE
FT                   ATLLHAVNGAADFASLPTGLFLGLTCEEVSDLSMEQAKGLAMAVRQKNITLRGHQLRCL
FT                   ARRLPRHLTDEELNALPLDLLLFLNPAMFPGQQACAHFFSLISKANVDVLPRRSLERQR
FT                   LLMEALKCQGVYGFQVSEADVRALGGLACDLPGKFVARSSEVLLPWLAGCQGPLDQSQE
FT                   KAVREVLRSGRTQYGPPSKWSVSTLDALQSLVAVLDESIVQSIPKDVKAEWLQHISRDP
FT                   SRLGSKLTVIHPRFRRDAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDL
FT                   VNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKT
FT                   LLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSV
FT                   MWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHN
FT                   VSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRL
FT                   GLGLQGGIPNGYLVLDFNVREAFSSRASLLGPGFVLIWIPALLPALRLS"
FT   gene            <2627261..>2627582
FT                   /locus_tag="mCG_1033970"
FT                   /note="gene_id=mCG1033970.1"
FT   mRNA            join(<2627261..2627317,2627453..>2627582)
FT                   /locus_tag="mCG_1033970"
FT                   /product="mCG1033970"
FT                   /note="gene_id=mCG1033970.1 transcript_id=mCT151674.1
FT                   created on 31-MAY-2002"
FT   CDS             join(<2627262..2627317,2627453..>2627582)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033970"
FT                   /product="mCG1033970"
FT                   /note="gene_id=mCG1033970.1 transcript_id=mCT151674.1
FT                   protein_id=mCP84683.1"
FT                   /protein_id="EDL22445.1"
FT                   /translation="RGTGTHEETKEDTSRFSACVTLQTPVTSQLRGQRMTPPVNRLHSL
FT                   LTSVDSYEPRKITRNLL"
FT   assembly_gap    2631029..2631361
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   gene            2641135..2650383
FT                   /gene="Narfl"
FT                   /locus_tag="mCG_17642"
FT                   /note="gene_id=mCG17642.1"
FT   mRNA            join(2641135..2641218,2642424..2642519,2644501..2644644,
FT                   2644860..2644992,2646485..2646619,2647033..2647151,
FT                   2647842..2647971,2648415..2648487,2648776..2648913,
FT                   2649223..2649380,2649551..2650383)
FT                   /gene="Narfl"
FT                   /locus_tag="mCG_17642"
FT                   /product="nuclear prelamin A recognition factor-like"
FT                   /note="gene_id=mCG17642.1 transcript_id=mCT14915.0 created
FT                   on 31-MAY-2002"
FT   CDS             join(2641153..2641218,2642424..2642519,2644501..2644644,
FT                   2644860..2644992,2646485..2646619,2647033..2647151,
FT                   2647842..2647971,2648415..2648487,2648776..2648913,
FT                   2649223..2649380,2649551..2649789)
FT                   /codon_start=1
FT                   /gene="Narfl"
FT                   /locus_tag="mCG_17642"
FT                   /product="nuclear prelamin A recognition factor-like"
FT                   /note="gene_id=mCG17642.1 transcript_id=mCT14915.0
FT                   protein_id=mCP23238.1"
FT                   /protein_id="EDL22446.1"
FT                   /translation="MASPFSGALQLTDLDDFIGPSQNCIKPVKVAKKPGSGIAKIHIED
FT                   DGSYFQVNQDGRTQKLEKAKVSLNDCLACSGCVTSAETVLITQQSHEELRKVLDANKEA
FT                   APGQQRLVVVSISPQSRASLAARFRLDPTDTARKLTSFFKKIGVHFVFDTAFARNFSLL
FT                   ESQKEFVQRFREQANSREALPVLASACPGWICYAEKTHGNFILPYISTARSPQQVMGSL
FT                   VKDFFAQQQLLTPDKIYHVTVMPCYDKKLEASRPDFFNQEYQTRDVDCVLTTGEVFRLL
FT                   EEEGVSLTELEPAPLDGLTSSVSAEEPSSHRGGGSGGYLEHVFRHAAQELFGIHVAEVT
FT                   YQPLRNKDFQEVTLEREGQVLLRFAVAYGFRNIQNLVQKLKRGRCPYHYVEVMACPSGC
FT                   LNGGGQLKAPDTEGSELLQQLERLYSMVRTEAPEDAPGVQELYQHWLQGEDSERASRLL
FT                   HTQYHAVEKPSSGLSIRW"
FT   assembly_gap    2642303..2642322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2644064..2644204
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            complement(2650082..2653119)
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /note="gene_id=mCG17667.1"
FT   mRNA            complement(join(2650082..2650713,2651038..2651117,
FT                   2651320..2651421,2651610..2651713,2651795..2651903,
FT                   2651990..2652107,2652196..2652260,2652539..2652729,
FT                   2652963..2653119))
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /product="hydroxyacylglutathione hydrolase-like, transcript
FT                   variant mCT14938"
FT                   /note="gene_id=mCG17667.1 transcript_id=mCT14938.1 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(2650325..2651117,2651320..2651421,
FT                   2651610..2652107,2652196..2652260,2652539..>2652871))
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /product="hydroxyacylglutathione hydrolase-like, transcript
FT                   variant mCT191650"
FT                   /note="gene_id=mCG17667.1 transcript_id=mCT191650.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2650340..2650713,2651038..2651117,
FT                   2651320..2651421,2651610..2651713,2651795..2651903,
FT                   2651990..2652107,2652196..2652260,2652958..2653119))
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /product="hydroxyacylglutathione hydrolase-like, transcript
FT                   variant mCT169852"
FT                   /note="gene_id=mCG17667.1 transcript_id=mCT169852.0 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(2650360..2650713,2651038..2651117,
FT                   2651320..2651421,2651610..2651713,2651795..2651903,
FT                   2651990..2652107,2652196..2652260,2652539..2652870))
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /product="hydroxyacylglutathione hydrolase-like, transcript
FT                   variant mCT169853"
FT                   /note="gene_id=mCG17667.1 transcript_id=mCT169853.0 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2650545..2650713,2651038..2651117,
FT                   2651320..2651421,2651610..2651713,2651795..2651903,
FT                   2651990..2652107,2652196..2652260,2652539..2652643))
FT                   /codon_start=1
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /product="hydroxyacylglutathione hydrolase-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17667.1 transcript_id=mCT169853.0
FT                   protein_id=mCP92687.0 isoform=CRA_b"
FT                   /protein_id="EDL22448.1"
FT                   /translation="MKVKVIPVLEDNYMYLIIEEHTREAVAIDVAVAERLLEIAGREGV
FT                   SLTMVLSTHHHWDHTRGNAELAHILPGLAVLGADERICALTRRLEHGEGLQFGAIHVRC
FT                   LLTPGHTSGHMSYFLWEDDCPDSPALFSGDALSVAGCGWHLEDTAQQMYQSLAKTLGTL
FT                   PPETKVFCGHEHTLSNLEFAQKVEPCNEHVQAKLSWAQERDDEDIPTVPSTLGEELMYN
FT                   PFLRVTEDAVRAFTGQVAPAQVLEALCRERARFQPAVEPPQPQVRALLALQWGLLSTHQ
FT                   KK"
FT   CDS             complement(join(2650545..2650713,2651038..2651117,
FT                   2651320..2651421,2651610..2651713,2651795..2651903,
FT                   2651990..2652107,2652196..2652260,2652539..2652643))
FT                   /codon_start=1
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /product="hydroxyacylglutathione hydrolase-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17667.1 transcript_id=mCT14938.1
FT                   protein_id=mCP23311.1 isoform=CRA_b"
FT                   /protein_id="EDL22450.1"
FT                   /translation="MKVKVIPVLEDNYMYLIIEEHTREAVAIDVAVAERLLEIAGREGV
FT                   SLTMVLSTHHHWDHTRGNAELAHILPGLAVLGADERICALTRRLEHGEGLQFGAIHVRC
FT                   LLTPGHTSGHMSYFLWEDDCPDSPALFSGDALSVAGCGWHLEDTAQQMYQSLAKTLGTL
FT                   PPETKVFCGHEHTLSNLEFAQKVEPCNEHVQAKLSWAQERDDEDIPTVPSTLGEELMYN
FT                   PFLRVTEDAVRAFTGQVAPAQVLEALCRERARFQPAVEPPQPQVRALLALQWGLLSTHQ
FT                   KK"
FT   CDS             complement(join(2650545..2650713,2651038..2651117,
FT                   2651320..2651421,2651610..2651713,2651795..2651903,
FT                   2651990..2652107,2652196..2652221))
FT                   /codon_start=1
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /product="hydroxyacylglutathione hydrolase-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17667.1 transcript_id=mCT169852.0
FT                   protein_id=mCP92686.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3YZU6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="MGI:MGI:1919877"
FT                   /db_xref="UniProtKB/TrEMBL:D3YZU6"
FT                   /protein_id="EDL22447.1"
FT                   /translation="MVLSTHHHWDHTRGNAELAHILPGLAVLGADERICALTRRLEHGE
FT                   GLQFGAIHVRCLLTPGHTSGHMSYFLWEDDCPDSPALFSGDALSVAGCGWHLEDTAQQM
FT                   YQSLAKTLGTLPPETKVFCGHEHTLSNLEFAQKVEPCNEHVQAKLSWAQERDDEDIPTV
FT                   PSTLGEELMYNPFLRVTEDAVRAFTGQVAPAQVLEALCRERARFQPAVEPPQPQVRALL
FT                   ALQWGLLSTHQKK"
FT   CDS             complement(join(2651034..2651117,2651320..2651421,
FT                   2651610..>2652038))
FT                   /codon_start=1
FT                   /gene="Haghl"
FT                   /locus_tag="mCG_17667"
FT                   /product="hydroxyacylglutathione hydrolase-like, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG17667.1 transcript_id=mCT191650.0
FT                   protein_id=mCP112596.0 isoform=CRA_c"
FT                   /protein_id="EDL22449.1"
FT                   /translation="AHLRSNPKAGTWRRASGEHVRRRGGEGPGPVLPSGPHRSNASPSQ
FT                   FGAIHVRCLLTPGHTSGHMSYFLWEDDCPDSPALFSGTVQPGFIYLPNSTVPSLPPSDP
FT                   LCSLGDALSVAGCGWHLEDTAQQMYQSLAKTLGTLPPETKVFCGHEHTLSNLEFAQKVE
FT                   PCNEHVQAKLSWAQERDDEDIPTVPSTLGEELMYNPFLRVT"
FT   gene            <2654117..2657860
FT                   /locus_tag="mCG_140594"
FT                   /note="gene_id=mCG140594.0"
FT   mRNA            join(<2654117..2654240,2654397..2654513,2654602..2654688,
FT                   2654913..2655029,2655287..2655375,2655488..2655566,
FT                   2655652..2655777,2656231..2656406,2656533..2656614,
FT                   2656774..2657387,2657460..2657560,2657645..2657860)
FT                   /locus_tag="mCG_140594"
FT                   /product="mCG140594"
FT                   /note="gene_id=mCG140594.0 transcript_id=mCT170162.0
FT                   created on 21-JUN-2002"
FT   CDS             join(<2654118..2654240,2654397..2654513,2654602..2654688,
FT                   2654913..2655029,2655287..2655375,2655488..2655566,
FT                   2655652..2655777,2656231..2656406,2656533..2656614,
FT                   2656774..2656857)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140594"
FT                   /product="mCG140594"
FT                   /note="gene_id=mCG140594.0 transcript_id=mCT170162.0
FT                   protein_id=mCP93036.0"
FT                   /protein_id="EDL22451.1"
FT                   /translation="SSKSQEASHYQMDQRPELLSSMEYVASPDPKPGVPLRVAENVAPG
FT                   AEDWLPSASGHLAWATSLETEHQTHLELSEEQRLQISKELVDLQIATHHLREQHEAEVF
FT                   ELRREILRLESRVLELELHGNGACQGHKVQPMANLGQHQVPPLEPPGGQQKLQEELKWL
FT                   LEHHRARQQALETQVGVLSQQLQGAREEARTTGQQLASQAMVLASCKGQLRQAEAENTQ
FT                   LQLQLKKMNEEYAVRLQHYARETVENASSTNQAALQAFLESTLQDIRAAHRTREQQLAQ
FT                   AARTYRKRLADLNQRQELLLTTCRATFATAINLEPLPMHWATELSHPRENEYGRHRTLL
FT                   LYPEKGSGETSKENKSQPL"
FT   gene            complement(2657902..2660097)
FT                   /gene="BC008155"
FT                   /locus_tag="mCG_17629"
FT                   /note="gene_id=mCG17629.1"
FT   mRNA            complement(join(2657902..2658313,2658468..2658518,
FT                   2658881..2659021,2659107..2659238,2659588..2660097))
FT                   /gene="BC008155"
FT                   /locus_tag="mCG_17629"
FT                   /product="cDNA sequence BC008155, transcript variant
FT                   mCT14884"
FT                   /note="gene_id=mCG17629.1 transcript_id=mCT14884.1 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(2658043..2658313,2658468..2658518,
FT                   2658881..2659021,2659107..2659211,2659866..>2659922))
FT                   /gene="BC008155"
FT                   /locus_tag="mCG_17629"
FT                   /product="cDNA sequence BC008155, transcript variant
FT                   mCT191649"
FT                   /note="gene_id=mCG17629.1 transcript_id=mCT191649.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2658083..2658313,2658468..2658518,
FT                   2658881..2659021,2659107..2659211,2659866..>2659913))
FT                   /codon_start=1
FT                   /gene="BC008155"
FT                   /locus_tag="mCG_17629"
FT                   /product="cDNA sequence BC008155, isoform CRA_b"
FT                   /note="gene_id=mCG17629.1 transcript_id=mCT191649.0
FT                   protein_id=mCP112649.0 isoform=CRA_b"
FT                   /protein_id="EDL22453.1"
FT                   /translation="SQRILRFLQLRLRLAGVPYVGASARQVENVLSLLRGRPGKMVDLG
FT                   SGDGRIVLAAHQCGLRPAMGYELNPWLVGLARLHAWRAGCSASVCYHRKDLWKVSLRDC
FT                   HNVSVFLAPSVLQLLEDKLQAELPVGARVVSGRFPLPTWQPVAVVGEGTDRVWAYDVHG
FT                   SGPTVSSCGVPIKAIPESSSTLVPRAPV"
FT   CDS             complement(join(2658083..2658313,2658468..2658518,
FT                   2658881..2659021,2659107..2659238,2659588..2659749))
FT                   /codon_start=1
FT                   /gene="BC008155"
FT                   /locus_tag="mCG_17629"
FT                   /product="cDNA sequence BC008155, isoform CRA_a"
FT                   /note="gene_id=mCG17629.1 transcript_id=mCT14884.1
FT                   protein_id=mCP23304.1 isoform=CRA_a"
FT                   /protein_id="EDL22452.1"
FT                   /translation="MDQDDPAEALTELREKRLGLLEIVQAAAGSGLAVYTIWALLLQPG
FT                   FRRVPLRLQPQPTKFLIQVPYVGASARQVENVLSLLRGRPGKMVDLGSGDGRIVLAAHQ
FT                   CGLRPAMGYELNPWLVGLARLHAWRAGCSASVCYHRKDLWKVSLRDCHNVSVFLAPSVL
FT                   QLLEDKLQAELPVGARVVSGRFPLPTWQPVAVVGEGTDRVWAYDVHGSGPTVSSCGVPI
FT                   KAIPESSSTLVPRAPV"
FT   gene            complement(2661748..2664623)
FT                   /gene="Metrn"
FT                   /locus_tag="mCG_17630"
FT                   /note="gene_id=mCG17630.1"
FT   mRNA            complement(join(2661748..2662826,2662909..2662968,
FT                   2663776..2664176,2664400..2664623))
FT                   /gene="Metrn"
FT                   /locus_tag="mCG_17630"
FT                   /product="meteorin, glial cell differentiation regulator"
FT                   /note="gene_id=mCG17630.1 transcript_id=mCT14885.1 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2662510..2662826,2662909..2662968,
FT                   2663776..2664176,2664400..2664497))
FT                   /codon_start=1
FT                   /gene="Metrn"
FT                   /locus_tag="mCG_17630"
FT                   /product="meteorin, glial cell differentiation regulator"
FT                   /note="gene_id=mCG17630.1 transcript_id=mCT14885.1
FT                   protein_id=mCP23319.2 partial"
FT                   /db_xref="GOA:A2RSN4"
FT                   /db_xref="MGI:MGI:1917333"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSN4"
FT                   /protein_id="EDL22454.1"
FT                   /translation="MLVATLLCALCCGLLAASAHAGYSEDRCSWRGSGLTQEPGSVGQL
FT                   TLDCTEGAIEWLYPAGALRLTLGGPDPGTRPSIVCLRPERPFAGAQVFAERMTGNLELL
FT                   LAEGPDLAGGRCMRWGPRERRALFLQATPHRDISRRVAAFRFELHEDQRAEMSPQAQGL
FT                   GVDGACRPCSDAELLLAACTSDFVIHGTIHGVAHDTELQESVITVVVARVIRQTLPLFK
FT                   EGSSEGQGRASIRTLLRCGVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALTT
FT                   HLNPCEMALD"
FT   assembly_gap    2664533..2664552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2676720..2687338
FT                   /locus_tag="mCG_17674"
FT                   /note="gene_id=mCG17674.1"
FT   mRNA            join(2676720..2676940,2683972..2684619,2685236..2685744,
FT                   2686054..2686138,2686452..2686515,2686930..2687338)
FT                   /locus_tag="mCG_17674"
FT                   /product="mCG17674"
FT                   /note="gene_id=mCG17674.1 transcript_id=mCT14945.1 created
FT                   on 31-MAY-2002"
FT   CDS             join(2683987..2684619,2685236..2685744,2686054..2686138,
FT                   2686452..2686515,2686930..2687078)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17674"
FT                   /product="mCG17674"
FT                   /note="gene_id=mCG17674.1 transcript_id=mCT14945.1
FT                   protein_id=mCP23280.1"
FT                   /db_xref="GOA:B2RPY3"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2448488"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPY3"
FT                   /protein_id="EDL22455.1"
FT                   /translation="MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPAAKNR
FT                   PCQPPPPPTLPPPSLATPLSRVALAGGPCPPASGPASGPVSGPPVERPPLATDEKILNG
FT                   LFWYFSACEKCILAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGF
FT                   AARGFEGFCLVGVSDLDICEFIDNYSLSKKGVKAMSLKRSTITDAGLEVMLEQMQGVVR
FT                   LELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHVT
FT                   DTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTSLSLSGCSKVTDDGVEL
FT                   VAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSL
FT                   RSLYLRWCCQVQDFGLKHLLAMRNLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCP
FT                   GATPELFKYFSQHLPRCLVIE"
FT   gene            2691206..2696276
FT                   /gene="Wdr24"
FT                   /locus_tag="mCG_17643"
FT                   /note="gene_id=mCG17643.1"
FT   mRNA            join(2691206..2692238,2693206..2693383,2693504..2694176,
FT                   2694587..2694705,2694787..2694908,2694980..2695084,
FT                   2695205..2695545,2695706..2695890,2695967..2696276)
FT                   /gene="Wdr24"
FT                   /locus_tag="mCG_17643"
FT                   /product="WD repeat domain 24"
FT                   /note="gene_id=mCG17643.1 transcript_id=mCT14916.1 created
FT                   on 31-MAY-2002"
FT   CDS             join(2691758..2692238,2693206..2693383,2693504..2694176,
FT                   2694587..2694705,2694787..2694908,2694980..2695084,
FT                   2695205..2695545,2695706..2695890,2695967..2696135)
FT                   /codon_start=1
FT                   /gene="Wdr24"
FT                   /locus_tag="mCG_17643"
FT                   /product="WD repeat domain 24"
FT                   /note="gene_id=mCG17643.1 transcript_id=mCT14916.1
FT                   protein_id=mCP23324.1"
FT                   /protein_id="EDL22456.1"
FT                   /translation="MEKMSRVSTALSGSALTGRTMHCHLDAPANAISVCRDAAQVVVAG
FT                   RSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNL
FT                   GRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVSTFSGQS
FT                   ESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGW
FT                   LATGGRDKMVKVWDMTTHRAKEIHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVW
FT                   DVRRPFVPAAMFEEHRDVTTGIAWRHPHDPSFLLSGSKDSTLCQHLFRDASQPVERANP
FT                   EGLCYGLFGDLAFAVKESLVAAESGRKPYAGDRRHPIFFKRKLDPAEPFSGLASSALSV
FT                   FETESSGGSMSWFVDTAERYVLAGRPLAELCDHNAKVARELGRNQVAQTWTMLRIIYCS
FT                   PGLVSSANLNHSVGKGSSCGLPLMNSFNLKDMGPGLGSETRLDRSKGDTRSDAALLDSS
FT                   ATLVTNEDNEETEGSDVPADYLLGDVEGEDDELYPLDTEHVHSEEPEYVLPQEAFPLRH
FT                   EIVDTPSGPEHLQDKADSPHVSGNEADTASLAPVDSSSSLLSVSHALYDSRLPPDFFSV
FT                   LVRDMLRFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFCLWNVSN
FT                   EVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGL
FT                   FVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS"
FT   gene            2696529..2699318
FT                   /gene="2610003J06Rik"
FT                   /locus_tag="mCG_17646"
FT                   /note="gene_id=mCG17646.0"
FT   mRNA            join(2696529..2696715,2696792..2696890,2697036..2697084,
FT                   2697158..2697254,2697337..2697405,2697494..2697613,
FT                   2697691..2697758,2697852..2697986,2698062..2699318)
FT                   /gene="2610003J06Rik"
FT                   /locus_tag="mCG_17646"
FT                   /product="RIKEN cDNA 2610003J06, transcript variant
FT                   mCT14918"
FT                   /note="gene_id=mCG17646.0 transcript_id=mCT14918.1 created
FT                   on 31-MAY-2002"
FT   CDS             join(2696558..2696715,2696792..2696890,2697036..2697084,
FT                   2697158..2697254,2697337..2697405,2697494..2697613,
FT                   2697691..2697758,2697852..2697986,2698062..2698142)
FT                   /codon_start=1
FT                   /gene="2610003J06Rik"
FT                   /locus_tag="mCG_17646"
FT                   /product="RIKEN cDNA 2610003J06, isoform CRA_c"
FT                   /note="gene_id=mCG17646.0 transcript_id=mCT14918.1
FT                   protein_id=mCP23225.1 isoform=CRA_c"
FT                   /protein_id="EDL22459.1"
FT                   /translation="MACGYASVDRIPSVLRACTRMFMAAAGRRGLLLLFVLWMMVTVIL
FT                   PASGEGGWKQNGLGIAAAVMEEERCTVERRAHITYSEFMQHYAFLKPVILQGLTDNSKF
FT                   RALCSRENLLASFGDNIVRLSTANTYSYQKVDLPFQEYVEQLLQPQDPASLGNDTLYFF
FT                   GDNNFTEWASLFQHYSPPPFRLLGTTPAYSFGIAGAGSGVPFHWHGPGFSEVIYGRKRW
FT                   FLYPPEKTPEFHPNKTTLAWLLEIYPSLALSARPLECTIQAGEVLYFPDRWWHATLNLD
FT                   TSVFISTFLG"
FT   mRNA            join(2696623..2696715,2696792..2696890,2697036..2697084,
FT                   2697158..2697254,2697337..2697405,2697550..2697613,
FT                   2697691..2697758,2697852..2697986)
FT                   /gene="2610003J06Rik"
FT                   /locus_tag="mCG_17646"
FT                   /product="RIKEN cDNA 2610003J06, transcript variant
FT                   mCT169846"
FT                   /note="gene_id=mCG17646.0 transcript_id=mCT169846.0 created
FT                   on 31-MAY-2002"
FT   CDS             join(2696668..2696715,2696792..2696890,2697036..2697084,
FT                   2697158..2697254,2697337..2697405,2697550..2697613,
FT                   2697691..2697758,2697852..2697942)
FT                   /codon_start=1
FT                   /gene="2610003J06Rik"
FT                   /locus_tag="mCG_17646"
FT                   /product="RIKEN cDNA 2610003J06, isoform CRA_a"
FT                   /note="gene_id=mCG17646.0 transcript_id=mCT169846.0
FT                   protein_id=mCP92670.0 isoform=CRA_a"
FT                   /protein_id="EDL22457.1"
FT                   /translation="MDDGDCDSACLWRRGMETEWAGNCSSSNGGGALHSGASGTHHVLR
FT                   IHAALCLPQARHLARTHGQLEVPGPVFPGKPASLVRGQHCSLEYSQHLLLPESGPALPG
FT                   ICGTAAAAPGSCIPRQCTTLRHHSVSWEPPLLTALELQELDLGYPSTGMGLVSQRLSMV
FT                   GSAGSSTLLRRHLSSTLTRPHWPGCWKYTHL"
FT   mRNA            join(2696673..2696715,2696792..2696890,2697036..2697084,
FT                   2697158..2697254,2697337..2697777)
FT                   /gene="2610003J06Rik"
FT                   /locus_tag="mCG_17646"
FT                   /product="RIKEN cDNA 2610003J06, transcript variant
FT                   mCT169847"
FT                   /note="gene_id=mCG17646.0 transcript_id=mCT169847.0 created
FT                   on 31-MAY-2002"
FT   CDS             join(2696675..2696715,2696792..2696890,2697036..2697084,
FT                   2697158..2697254,2697337..2697530)
FT                   /codon_start=1
FT                   /gene="2610003J06Rik"
FT                   /locus_tag="mCG_17646"
FT                   /product="RIKEN cDNA 2610003J06, isoform CRA_b"
FT                   /note="gene_id=mCG17646.0 transcript_id=mCT169847.0
FT                   protein_id=mCP92689.0 isoform=CRA_b"
FT                   /protein_id="EDL22458.1"
FT                   /translation="MVTVILPASGEGGWKQNGLGIAAAVMEEERCTVERRAHITYSEFM
FT                   QHYAFLKPVILQGLTDNSKFRALCSRENLLASFGDNIVRLSTANTYSYQKVDLPFQEYV
FT                   EQLLQPQDPASLGNGEPDPGSGGSGVLGSPLLPVLLPITLSAGRHPVLFWRQQLH"
FT   gene            complement(2698189..2700507)
FT                   /gene="Stub1"
FT                   /locus_tag="mCG_17662"
FT                   /note="gene_id=mCG17662.1"
FT   mRNA            complement(join(2698189..2698562,2698654..2698770,
FT                   2698861..2698917,2699096..2699183,2699348..2699513,
FT                   2699598..2699796,2700244..2700460))
FT                   /gene="Stub1"
FT                   /locus_tag="mCG_17662"
FT                   /product="STIP1 homology and U-Box containing protein 1,
FT                   transcript variant mCT14933"
FT                   /note="gene_id=mCG17662.1 transcript_id=mCT14933.0 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(2698192..2698562,2698654..2698770,
FT                   2698861..2699104,2699620..2699796,2700244..2700507))
FT                   /gene="Stub1"
FT                   /locus_tag="mCG_17662"
FT                   /product="STIP1 homology and U-Box containing protein 1,
FT                   transcript variant mCT169850"
FT                   /note="gene_id=mCG17662.1 transcript_id=mCT169850.0 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2698437..2698562,2698654..2698770,
FT                   2698861..2698917,2699096..2699183,2699348..2699513,
FT                   2699598..2699796,2700244..2700405))
FT                   /codon_start=1
FT                   /gene="Stub1"
FT                   /locus_tag="mCG_17662"
FT                   /product="STIP1 homology and U-Box containing protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17662.1 transcript_id=mCT14933.0
FT                   protein_id=mCP23211.1 isoform=CRA_a"
FT                   /protein_id="EDL22460.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH
FT                   SYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK
FT                   RKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL
FT                   IPNLAMKEVIDAFISENGWVEDY"
FT   mRNA            complement(join(2698477..2698562,2698654..2698770,
FT                   2698861..2698917,2699096..2699183,2699348..2699461,
FT                   2699598..2699796,2700244..>2700467))
FT                   /gene="Stub1"
FT                   /locus_tag="mCG_17662"
FT                   /product="STIP1 homology and U-Box containing protein 1,
FT                   transcript variant mCT191648"
FT                   /note="gene_id=mCG17662.1 transcript_id=mCT191648.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2698722..2698770,2698861..2698917,
FT                   2699096..2699183,2699348..2699461,2699598..2699796,
FT                   2700244..>2700444))
FT                   /codon_start=1
FT                   /gene="Stub1"
FT                   /locus_tag="mCG_17662"
FT                   /product="STIP1 homology and U-Box containing protein 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG17662.1 transcript_id=mCT191648.0
FT                   protein_id=mCP112595.0 isoform=CRA_c"
FT                   /protein_id="EDL22462.1"
FT                   /translation="VAGRGAQAVPRGAMKGKEEKEGGARLGTGGGGSPDKSPSAQELKE
FT                   QGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELD
FT                   GQSVKAHFFLGQCQLEMESYDEAIANLQRVPFALLRRSAGTVSRNGASTRRVSCIHISP
FT                   GSLLLSERGNWRSVSGTTRVMKMMATSGPSRPALRPSTINTWQIWMSSSLRWTRKERSE
FT                   ISLTTCVARLALS"
FT   CDS             complement(join(2698991..2699104,2699620..2699796,
FT                   2700244..2700405))
FT                   /codon_start=1
FT                   /gene="Stub1"
FT                   /locus_tag="mCG_17662"
FT                   /product="STIP1 homology and U-Box containing protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17662.1 transcript_id=mCT169850.0
FT                   protein_id=mCP92674.0 isoform=CRA_b"
FT                   /protein_id="EDL22461.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAKHVRVPLVHMWVIVCVFVCGMKSAPAFGGSVGPCMT"
FT   gene            complement(2702012..>2704678)
FT                   /gene="Rhbdl1"
FT                   /locus_tag="mCG_17641"
FT                   /note="gene_id=mCG17641.2"
FT   mRNA            complement(join(2702012..2702607,2702688..2702748,
FT                   2702828..2702928,2703021..2703133,2703296..2703453,
FT                   2703520..2703744,2703950..2704123,2704539..2704676))
FT                   /gene="Rhbdl1"
FT                   /locus_tag="mCG_17641"
FT                   /product="rhomboid, veinlet-like 1 (Drosophila), transcript
FT                   variant mCT14896"
FT                   /note="gene_id=mCG17641.2 transcript_id=mCT14896.2 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(2702018..2702607,2702688..2702748,
FT                   2702828..2702928,2703021..2703133,2703296..2703444,
FT                   2703520..2703744,2703962..2704123,2704539..>2704678))
FT                   /gene="Rhbdl1"
FT                   /locus_tag="mCG_17641"
FT                   /product="rhomboid, veinlet-like 1 (Drosophila), transcript
FT                   variant mCT191632"
FT                   /note="gene_id=mCG17641.2 transcript_id=mCT191632.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2702336..2702607,2702688..2702748,
FT                   2702828..2702928,2703021..2703133,2703296..2703444,
FT                   2703520..2703744,2703962..2704123,2704539..>2704676))
FT                   /codon_start=1
FT                   /gene="Rhbdl1"
FT                   /locus_tag="mCG_17641"
FT                   /product="rhomboid, veinlet-like 1 (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17641.2 transcript_id=mCT191632.0
FT                   protein_id=mCP112654.0 isoform=CRA_b"
FT                   /protein_id="EDL22464.1"
FT                   /translation="RAEQAERAGRGGAERSAEQPLPASADPGPRPGSMDRSSLLQLIQE
FT                   QQLDPENTGFIGADTFAGLVHSHELPLDPTKLDMLVALAQSNERGQVCYQELVDLISSK
FT                   RSSSFKRAIANGQRALPRDGLLDEPGLSVYKRFVRYVAYEILPCEVDRRWYFYRHRTCP
FT                   PPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARAWRFLTYMFM
FT                   HVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVGGSG
FT                   GVYALCSAHLANVVMNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQP
FT                   SFMAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTFLLFAIFWNVFAYDLLG
FT                   ADIPPPP"
FT   CDS             complement(join(2702336..2702607,2702688..2702748,
FT                   2702828..2702928,2703021..2703133,2703296..2703453,
FT                   2703520..2703744,2703950..2704123,2704539..2704577))
FT                   /codon_start=1
FT                   /gene="Rhbdl1"
FT                   /locus_tag="mCG_17641"
FT                   /product="rhomboid, veinlet-like 1 (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17641.2 transcript_id=mCT14896.2
FT                   protein_id=mCP23307.2 isoform=CRA_a"
FT                   /protein_id="EDL22463.1"
FT                   /translation="MDRSSLLQLIQEQQLDPENTGFIGADTFAGLVHSHELPLDPTKLD
FT                   MLVALAQSNERGQVCYQELVDLVSAMISSKRSSSFKRAIANGQRALPRDGLLDEPGLSV
FT                   YKRFVRYVAYEILPCEVDRRWYFYRHRTCPPPVFMASVTLAQCPQIIVFLCYGARLNKW
FT                   VLQTYHPEYMKSPLVYHPGHRARAWRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHG
FT                   VLRISLLYLAGVLAGSLTVSITDMRAPVVGGSGGVYALCSAHLANVVMNWAGMRCPYKL
FT                   LRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSFMAHLAGAVVGVSMGLTILRSYEER
FT                   LRDQCGWWVVLLAYGTFLLFAIFWNVFAYDLLGADIPPPP"
FT   gene            complement(2706006..>2712058)
FT                   /gene="Rhot2"
FT                   /locus_tag="mCG_17669"
FT                   /note="gene_id=mCG17669.2"
FT   mRNA            complement(join(2706006..2707045,2707240..2707442,
FT                   2707538..2707658,2707806..2707886,2707989..2708119,
FT                   2708202..2708302,2708387..2708529,2708603..2708687,
FT                   2708913..2709034,2709111..2709219,2709309..2709407,
FT                   2709542..2709643,2709732..2709840,2709918..2709970,
FT                   2710659..2710712,2711493..2711536,2711641..2711722,
FT                   2711807..2711865,2711952..2712034))
FT                   /gene="Rhot2"
FT                   /locus_tag="mCG_17669"
FT                   /product="ras homolog gene family, member T2, transcript
FT                   variant mCT14943"
FT                   /note="gene_id=mCG17669.2 transcript_id=mCT14943.2 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(2706390..2707045,2707240..2707442,
FT                   2707536..2707658,2707806..2707886,2707989..2708119,
FT                   2708202..2708302,2708387..2708529,2708603..2708687,
FT                   2708913..2709034,2709111..2709219,2709309..2709407,
FT                   2709542..2709643,2709732..2709840,2709918..2709970,
FT                   2710659..2710712,2711493..2711536,2711641..2711722,
FT                   2711807..2711865,2711952..>2712058))
FT                   /gene="Rhot2"
FT                   /locus_tag="mCG_17669"
FT                   /product="ras homolog gene family, member T2, transcript
FT                   variant mCT191651"
FT                   /note="gene_id=mCG17669.2 transcript_id=mCT191651.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2706919..2707045,2707240..2707442,
FT                   2707536..2707658,2707806..2707886,2707989..2708119,
FT                   2708202..2708302,2708387..2708529,2708603..2708687,
FT                   2708913..>2709019))
FT                   /codon_start=1
FT                   /gene="Rhot2"
FT                   /locus_tag="mCG_17669"
FT                   /product="ras homolog gene family, member T2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17669.2 transcript_id=mCT191651.0
FT                   protein_id=mCP112597.0 isoform=CRA_b"
FT                   /protein_id="EDL22466.1"
FT                   /translation="THSSSSVAGTRPRGPSLRRFGYSDSLELTPDYLYPALHVPPGCST
FT                   ELNHRGYQFVQRMFEKHDQDHDGVLSPTELQNLFSVFSGAPWGPELLHTVPTQAGCLPL
FT                   HGYLCQWTLMTYLDVQQCLAHLGYLGYPTLCEQDSQAQAITVTREKKLDQEKGQTQRSV
FT                   LMCKVLGARGVGKSAFLQAFLGNSLGEARDPPEKFPLHTINTVRVNGQEKYLILCEVNA
FT                   DSLLDTSLDTTCDVACLMFDSSDPKTFVHCATIYKRYYMDGQTPCLFIASKADLPEGVA
FT                   PPGLSPAEFCRRHRLPAPASFSCLGPAMPSTDVFTQLATMATFPHLVHTELHPTSFWLR
FT                   GVLVAVGTAVAAVLSFSLYRVLVKSR"
FT   CDS             complement(join(2708949..2709034,2709111..2709219,
FT                   2709309..2709407,2709542..2709643,2709732..2709840,
FT                   2709918..2709970,2710659..2710712,2711493..2711536,
FT                   2711641..2711722,2711807..2711865,2711952..2711988))
FT                   /codon_start=1
FT                   /gene="Rhot2"
FT                   /locus_tag="mCG_17669"
FT                   /product="ras homolog gene family, member T2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17669.2 transcript_id=mCT14943.2
FT                   protein_id=mCP23224.2 isoform=CRA_a"
FT                   /protein_id="EDL22465.1"
FT                   /translation="MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPARAEEITIPAD
FT                   VTPEKVPTHIVDYSEAEQTEEELQEEIHKANVVCVVYDVSEETTIEKIRTKWIPLVNGR
FT                   TATGPRLPIILVGNKSDLRPGSTMEAVLPIMSQFPEIETCVECSAKHLRNISELFYYAQ
FT                   KAVLHPTAPLYDPEAKQLRPACAQALTRIFRLSDQDRDHGLSDEELNAFQKSCFGHPLA
FT                   PQALEDVKRVVCKNVSGGVQNDRLTLEGFLFLNTLFIQRGRHETTWTIPAALWLQ"
FT   gene            complement(2712323..>2728936)
FT                   /locus_tag="mCG_17671"
FT                   /note="gene_id=mCG17671.3"
FT   mRNA            complement(join(2712323..2712777,2712927..2713011,
FT                   2713131..2713250,2713323..2713466,2713551..2713681,
FT                   2713792..2713966,2714076..2714198,2715352..2715523,
FT                   2715879..2715990,2716080..2716248,2716525..2716715,
FT                   2716806..2716965,2717115..2717236,2717420..2717522,
FT                   2717970..2718067,2718299..2718490,2718948..2719079,
FT                   2719270..2719308,2719378..2719499,2719708..2719836,
FT                   2719950..2720111,2720378..2720508,2721274..2721404,
FT                   2721590..2721729,2722082..2722317,2722670..2722786,
FT                   2722853..2722983,2723060..2723221,2723311..2723429,
FT                   2724514..2724571,2724651..2724796,2724877..2724987,
FT                   2726289..2726357,2726653..2726871,2726942..2727045,
FT                   2727411..2727478,2727572..2727686,2727925..2728095,
FT                   2728262..2728370,2728460..>2728936))
FT                   /locus_tag="mCG_17671"
FT                   /product="mCG17671, transcript variant mCT191692"
FT                   /note="gene_id=mCG17671.3 transcript_id=mCT191692.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2712327..2712777,2712927..2713011,
FT                   2713131..2713250,2713323..2713466,2713536..2713681,
FT                   2713792..2713966,2714076..2714198,2715352..2715523,
FT                   2715879..2715990,2716080..2716248,2716525..2716715,
FT                   2716806..2716965,2717115..2717236,2717420..2717522,
FT                   2717970..2718067,2718299..2718490,2718948..2719072,
FT                   2719303..2719499,2719708..2719836,2719950..2720111,
FT                   2720378..2720508,2721274..2721404,2721590..2721729,
FT                   2722082..2722317,2722670..2722786,2722853..2722983,
FT                   2723060..2723221,2723311..2723429,2724514..2724571,
FT                   2724651..2724796,2724877..2724987,2726289..2726357,
FT                   2726653..2726871,2726942..2727045,2727411..2727478,
FT                   2727572..2727686,2727925..2728095,2728262..2728370,
FT                   2728460..2728636,2728738..2728908))
FT                   /locus_tag="mCG_17671"
FT                   /product="mCG17671, transcript variant mCT14941"
FT                   /note="gene_id=mCG17671.3 transcript_id=mCT14941.2 created
FT                   on 31-MAY-2002"
FT   CDS             complement(join(2712620..2712777,2712927..2713011,
FT                   2713131..2713250,2713323..2713466,2713536..2713681,
FT                   2713792..2713966,2714076..2714198,2715352..2715523,
FT                   2715879..2715990,2716080..2716248,2716525..2716715,
FT                   2716806..2716965,2717115..2717236,2717420..2717522,
FT                   2717970..2718067,2718299..2718490,2718948..2719072,
FT                   2719303..2719499,2719708..2719836,2719950..2720111,
FT                   2720378..2720508,2721274..2721404,2721590..2721729,
FT                   2722082..2722317,2722670..2722786,2722853..2722983,
FT                   2723060..2723221,2723311..2723429,2724514..2724571,
FT                   2724651..2724796,2724877..2724987,2726289..2726357,
FT                   2726653..2726871,2726942..2727045,2727411..2727478,
FT                   2727572..2727686,2727925..2728027))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17671"
FT                   /product="mCG17671, isoform CRA_a"
FT                   /note="gene_id=mCG17671.3 transcript_id=mCT14941.2
FT                   protein_id=mCP23255.2 isoform=CRA_a"
FT                   /protein_id="EDL22467.1"
FT                   /translation="MFYLGRHYSHLKSIRLCASLLVRNLYTSDLCFDPAVTVTEARRAK
FT                   LSVNPMPREMAFPVPKGESWHDNYIHVRFPSDCSKVPDEQDEKSCSPPEAVFLGRMSRH
FT                   LPHPGVLGKPLLSSKSPVAQACSSALPCQVLSASSRLPEVSRTYRYREVSSVSASSIQS
FT                   QRPSVRDEVPDAHTVSGERHVLADRSSGVPMALEDIGSCRLFLPDPVLRLKGVIGFGGH
FT                   STQWALWTKDGVAVVYPCHAVIIVLQIDTGQQRFFLGHTDKVSALALNGSDTLLASAQV
FT                   QPPSMVRLWDFQTGSCLSLFRSPLHTICSLSFSGSGALLCGVGKDRHGRTVVVAWSTEQ
FT                   AGLGGEVVVLAKVHTDFDIRAFQVAFFDETRMASCGRGSVRLWRLRGGVLRSCAVDLGE
FT                   YCSLELTDLAFAQALDGHCAPSAGTLFVCSHSGHILEIDHQRMSVQHVRRLLPARSPGA
FT                   PLAEKQNFSVGSGIAISSLSVSTATCAVGSEDGYLRLWPLDFSSVLLEAEHDGPVSSVS
FT                   FSPDGLRVLSTTTSGHLGFLDVPSREYTVLARSHMAPVLALSTEPNRGQMATVSLDHTV
FT                   RIWDLATLQQLYDFSSSEDTPCAVAFHPTMPNFFCGFSSGAVRSFSLESSGVLVEHTRH
FT                   RGAITSLVITLDGRFLFSSCSQGSLVQYSCADSQCCVLRVAANMVCQDGRPNPNILAVS
FT                   GDSCRLAFVGPSKCMVTIVESASLDELLRVDVSTLNLASNHLDWAVAICFSPGNSGHLL
FT                   VSTSSNKVVVLDAVSGHTLRELSSVRSRACCSLALSEDAHLLLAATDRTITVWDYPTQA
FT                   NPSCQVYIGHSEPVHAVAFTPDQLQVISVGDAIFLWDILATPERQVSTLHHVCMGLCWL
FT                   APDTFSCSQRWSSGQLDDLASGASGLPRQQVPIPFQALPPPLSSHDRLLDGSTGTFSTS
FT                   DEEGLCEENHVSEALLQGQAPTPHVLVDREASGAGDAPRETAGSSWTPAERPSPHSHMS
FT                   EWSLRSGKAGLPTRPDSYKHFTPRYKTSPRVKSVYFPPIGRERLRLKAIVGYNGNGRAN
FT                   MVWRPDTGFFAYTCGRLVVVEDLHSGTQRHWLGHSQEISTLALNQDGQILASASCCGNT
FT                   AARCQIRIWDVPKGLCRHLLSHHDTAVQALAFSPDDEFLVTLGDYADRNLALWSMATYE
FT                   LLSSTRLLEPVHGVAFNPWDANELICVGTNAITFWLLQHHGADTCFQVHREPIPEELGA
FT                   SELTSLCYGASPLLYCGSSSGQVCVWDTGTGHCFLAWEADDGEIGVLLCSGSRLISGSN
FT                   TKRLRLWAVGVVPELRRKGSSARSSSVFMERELTLDGAVVSASFDSGMDMGVVGTTAGT
FT                   IWYISWTEGTSTRLISGHRTKVNEVVFSPGESHCATCGEDGSVRVWSLASMELVIQFQV
FT                   LNQSCLCLAWTPPSCELPEQQQVVAGYSDGTLRVFSISRTAMELKMHPHRTALTAIAFS
FT                   TDGQTILSGDKDGLVAISHPCTGMTFRVLSDHRGAPISAIQSTSKEVRQAQYGDLGVEG
FT                   VELWLAASGDQRVSIWVSDWLRDRCELLEWLSFPAPAVSEAPGLLPPSLAAFCPWDKAI
FT                   LVCVGLGAHEEVIFYSLRQKQVIQKTPLPFFAMSLSLSPGSQLMVVGFAECMMRLLDCA
FT                   SGTAQDLEGHDDSVHLCRFTPSGRLLFTAAHNEILVWEVTDP"
FT   CDS             complement(join(2719299..2719308,2719378..2719499,
FT                   2719708..2719836,2719950..2720111,2720378..2720508,
FT                   2721274..2721404,2721590..2721729,2722082..2722317,
FT                   2722670..2722786,2722853..2722983,2723060..2723221,
FT                   2723311..2723429,2724514..2724571,2724651..2724796,
FT                   2724877..2724987,2726289..2726357,2726653..2726871,
FT                   2726942..2727045,2727411..2727478,2727572..2727686,
FT                   2727925..2728095,2728262..2728370,2728460..>2728636))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17671"
FT                   /product="mCG17671, isoform CRA_b"
FT                   /note="gene_id=mCG17671.3 transcript_id=mCT191692.0
FT                   protein_id=mCP112598.0 isoform=CRA_b"
FT                   /protein_id="EDL22468.1"
FT                   /translation="DKVLKSAVYRIRGSVSASNYIQLPRTSTQSLGLTGRYLYVLFRPV
FT                   PTKHFVIHLDVSTEDGQVIRVSFSNLFKEFKSSTTWLQFPFVFETKTPRRDLAGVALPR
FT                   ARWTCLQLDLRDILMFYLGRHYSHLKSIRLCASLLVRNLYTSDLCFDPAVTVTEARRAK
FT                   LSVNPMPREMAFPVPKGESWHDNYIHVRFPSDCSKVPDEQDEKSCSPPEAVFLGRMSRH
FT                   LPHPGVLGKPLLSSKSPVAQACSSALPCQVLSASSRLPEVSRTYRYREVSSVSASSIQS
FT                   QRPSVRDEVPDAHTVSGERHVLADRSSGVPMALEDIGSCRLFLPDPVLRLKGVIGFGGH
FT                   STQWALWTKDGVAVVYPCHAVIIVLQIDTGQQRFFLGHTDKVSALALNGSDTLLASAQV
FT                   QPPSMVRLWDFQTGSCLSLFRSPLHTICSLSFSGSGALLCGVGKDRHGRTVVVAWSTEQ
FT                   AGLGGEVVVLAKVHTDFDIRAFQVAFFDETRMASCGRGSVRLWRLRGGVLRSCAVDLGE
FT                   YCSLELTDLAFAQALDGHCAPSAGTLFVCSHSGHILEIDHQRMSVQHVRRLLPARSPGA
FT                   PLAEKQNFSVGSGIAISSLSVSTATCAVGSEDGYLRLWPLDFSSVLLEAEHDGPVSSVS
FT                   FSPDGLRVLSTTTSGHLGFLDVPSREYTVLARSHMAPVLALSTEPNRGQMATVSLDHTV
FT                   RIWDLATLQQLYDFSSSEDTPCAVAFHPTMPNFFCGFSSGAVRSFSLESSGVLVEHTRH
FT                   RGAITSLVITLDGRFLFSSCSQGSLVQYSCADSQCCVLRVAANMVCQDGRPNPNILAVS
FT                   GDSCRLAFVGPSKCMVTIVESASLDELLRVDVSTLNLASNHLDWAVAICFSPGNSGHLL
FT                   VSTSSNKVVVLDAVSGHTLRELSSVRSRACCSLALSEDAHLLLAATDRTITVWDYPTQA
FT                   NPSCQVYIGHSEPVHAVAFTPDQLQVISVGDAIFLWDILATPERQVWR"
FT   gene            complement(2731252..2736517)
FT                   /gene="9530058B02Rik"
FT                   /locus_tag="mCG_17666"
FT                   /note="gene_id=mCG17666.1"
FT   mRNA            complement(join(2731252..2731592,2731804..2731905,
FT                   2732147..2732274,2736190..2736319,2736401..2736517))
FT                   /gene="9530058B02Rik"
FT                   /locus_tag="mCG_17666"
FT                   /product="RIKEN cDNA 9530058B02"
FT                   /note="gene_id=mCG17666.1 transcript_id=mCT14937.0 created
FT                   on 03-JUN-2002"
FT   CDS             complement(join(2731522..2731592,2731804..2731905,
FT                   2732147..2732274,2736190..2736319,2736401..2736452))
FT                   /codon_start=1
FT                   /gene="9530058B02Rik"
FT                   /locus_tag="mCG_17666"
FT                   /product="RIKEN cDNA 9530058B02"
FT                   /note="gene_id=mCG17666.1 transcript_id=mCT14937.0
FT                   protein_id=mCP23228.1"
FT                   /protein_id="EDL22469.1"
FT                   /translation="MYTITKGPSKLVAQRRTGPTQQQVESRLGELLKCRQPVPPTALPA
FT                   HLQPSAQTQGPWPLASSGPRLVFNRVNGRRPLTTSPSLEGTQETYTVAHEENVRFVSEA
FT                   WQQVERQLDGGPADESGPRPVQYVESTPDPRLQNFVPIDLDEWWAQQFLAKITNCS"
FT   assembly_gap    2734989..2735008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2737174..2737193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2738935..2739379
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   gene            2742842..2744882
FT                   /gene="0610011F06Rik"
FT                   /locus_tag="mCG_17665"
FT                   /note="gene_id=mCG17665.0"
FT   mRNA            join(2742842..2743443,2743677..2743839,2743937..2743996,
FT                   2744212..2744279,2744378..2744456,2744667..2744882)
FT                   /gene="0610011F06Rik"
FT                   /locus_tag="mCG_17665"
FT                   /product="RIKEN cDNA 0610011F06, transcript variant
FT                   mCT14936"
FT                   /note="gene_id=mCG17665.0 transcript_id=mCT14936.0 created
FT                   on 03-JUN-2002"
FT   mRNA            join(2742843..2743443,2743677..2743839,2743937..2743996,
FT                   2744212..2744279,2744378..2744877)
FT                   /gene="0610011F06Rik"
FT                   /locus_tag="mCG_17665"
FT                   /product="RIKEN cDNA 0610011F06, transcript variant
FT                   mCT169851"
FT                   /note="gene_id=mCG17665.0 transcript_id=mCT169851.0 created
FT                   on 03-JUN-2002"
FT   CDS             join(2743247..2743443,2743677..2743839,2743937..2743996,
FT                   2744212..2744279,2744378..2744456,2744667..2744714)
FT                   /codon_start=1
FT                   /gene="0610011F06Rik"
FT                   /locus_tag="mCG_17665"
FT                   /product="RIKEN cDNA 0610011F06, isoform CRA_a"
FT                   /note="gene_id=mCG17665.0 transcript_id=mCT14936.0
FT                   protein_id=mCP23285.1 isoform=CRA_a"
FT                   /protein_id="EDL22470.1"
FT                   /translation="MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHF
FT                   AQAFPNAEWQPSDVDQRCLDSIAATTRAQGLSNVKAPLYLDVTWEWEQWGGIPPRSLDL
FT                   LLCINMIHISPLNCTEGLFRAAGHLLKTKAVLITYGPYAVNGKISPQSNVDFDLTLRCR
FT                   NPEWGLRDTVLLEELGQASGLVLERMVDMPANNKCLIFRKE"
FT   CDS             join(2743247..2743443,2743677..2743839,2743937..2743996,
FT                   2744212..2744279,2744378..2744495)
FT                   /codon_start=1
FT                   /gene="0610011F06Rik"
FT                   /locus_tag="mCG_17665"
FT                   /product="RIKEN cDNA 0610011F06, isoform CRA_b"
FT                   /note="gene_id=mCG17665.0 transcript_id=mCT169851.0
FT                   protein_id=mCP92669.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1915597"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8X1"
FT                   /protein_id="EDL22471.1"
FT                   /translation="MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHF
FT                   AQAFPNAEWQPSDVDQRCLDSIAATTRAQGLSNVKAPLYLDVTWEWEQWGGIPPRSLDL
FT                   LLCINMIHISPLNCTEGLFRAAGHLLKTKAVLITYGPYAVNGKISPQSNVDFDLTLRCR
FT                   NPEWGLRDTVLLEELGQASGLVLERMVGRAMWGWGASL"
FT   assembly_gap    2745223..2745394
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   gene            complement(<2745475..>2747828)
FT                   /locus_tag="mCG_52137"
FT                   /note="gene_id=mCG52137.0"
FT   mRNA            complement(join(<2745475..2746953,2747649..>2747828))
FT                   /locus_tag="mCG_52137"
FT                   /product="mCG52137"
FT                   /note="gene_id=mCG52137.0 transcript_id=mCT52320.0 created
FT                   on 03-JUN-2002"
FT   CDS             complement(join(2745475..2746953,2747649..2747828))
FT                   /codon_start=1
FT                   /locus_tag="mCG_52137"
FT                   /product="mCG52137"
FT                   /note="gene_id=mCG52137.0 transcript_id=mCT52320.0
FT                   protein_id=mCP42882.0"
FT                   /protein_id="EDL22472.1"
FT                   /translation="MPAPQPFLPLLFVFVLIHLTSETNLLPDPGSHPGMCPNELSPHLW
FT                   VDAQSTCERECTGDQDCAASEKCCTNVCGLQSCVAARFPSGGPAVPETAASCEGFQCPQ
FT                   QGSDCDIWDGQPVCRCRDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLHLHVVPCKH
FT                   ILSWPPSSPGPPETTARPTPGAAPMPPALYNSPSPQAVHVGGTASLHCDVSGRPPPAVT
FT                   WEKQSHQRENLIMRPDQMYGNVVVTSIGQLVLYNAQLEDAGLYTCTARNAAGLLRADFP
FT                   LSVLQRATTQDRDPGIPALAECQADTQACVGPPTPHHVLWRFDPQRGSCMTFPALRCDG
FT                   AARGFETYEACQQACVRGPGDVCALPAVQGPCQGWEPRWAYSPLLQQCHPFVYSGCEGN
FT                   SNNFETRESCEDACPVPRTPPCRACRLKSKLALSLCRSDFAIVGRLTEVLEEPEAAGGI
FT                   ARVALDDVLKDDKMGLKFLGTKYLEVTLSGMDWACPCPNVTAVDGPLVIMGEVREGVAV
FT                   LDANSYVRAASEKRVKKIVELLEKKACELLNRFQD"
FT   gene            complement(2749903..2787305)
FT                   /gene="Rab40c"
FT                   /locus_tag="mCG_48763"
FT                   /note="gene_id=mCG48763.1"
FT   mRNA            complement(join(2749903..2751674,2752346..2752568,
FT                   2752841..2752918,2758400..2758460,2759048..2759108,
FT                   2787114..2787305))
FT                   /gene="Rab40c"
FT                   /locus_tag="mCG_48763"
FT                   /product="Rab40c, member RAS oncogene family"
FT                   /note="gene_id=mCG48763.1 transcript_id=mCT48946.1 created
FT                   on 03-JUN-2002"
FT   assembly_gap    2751058..2751082
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   CDS             complement(join(2751394..2751674,2752346..2752568,
FT                   2752841..2752918,2758400..2758460,2759048..2759108,
FT                   2787114..2787255))
FT                   /codon_start=1
FT                   /gene="Rab40c"
FT                   /locus_tag="mCG_48763"
FT                   /product="Rab40c, member RAS oncogene family"
FT                   /note="gene_id=mCG48763.1 transcript_id=mCT48946.1
FT                   protein_id=mCP42891.2 partial"
FT                   /db_xref="GOA:Q0PD11"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2183454"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD11"
FT                   /protein_id="EDL22473.1"
FT                   /translation="MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAY
FT                   SNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDG
FT                   IDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNV
FT                   IESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHL
FT                   KSFSMANGMNAVMMHGRSYSLASGAGGSGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
FT                   "
FT   assembly_gap    2760546..2760989
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    2762996..2763295
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   gene            2769647..2770016
FT                   /locus_tag="mCG_17670"
FT                   /note="gene_id=mCG17670.0"
FT   mRNA            2769647..2770016
FT                   /locus_tag="mCG_17670"
FT                   /product="mCG17670"
FT                   /note="gene_id=mCG17670.0 transcript_id=mCT14940.0 created
FT                   on 03-JUN-2002"
FT   CDS             2769701..2769892
FT                   /codon_start=1
FT                   /locus_tag="mCG_17670"
FT                   /product="mCG17670"
FT                   /note="gene_id=mCG17670.0 transcript_id=mCT14940.0
FT                   protein_id=mCP23142.1"
FT                   /protein_id="EDL22474.1"
FT                   /translation="MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWQLLAMMTVYF
FT                   GSGFAAPFFIVRHQLLKK"
FT   assembly_gap    2771559..2771601
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2783883..2783902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2794177..2809703)
FT                   /gene="Pigq"
FT                   /locus_tag="mCG_1573"
FT                   /note="gene_id=mCG1573.1"
FT   mRNA            complement(join(2794177..2795505,2796496..2796557,
FT                   2798280..2798394,2798717..2798797,2799221..2799332,
FT                   2799433..2799586,2799864..2799990,2802517..2802637,
FT                   2802762..2802893,2804523..2805221,2809574..2809703))
FT                   /gene="Pigq"
FT                   /locus_tag="mCG_1573"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class Q"
FT                   /note="gene_id=mCG1573.1 transcript_id=mCT8397.0 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(2795353..2795505,2796496..2796557,
FT                   2798280..2798394,2798717..2798797,2799221..2799332,
FT                   2799433..2799586,2799864..2799990,2802517..2802637,
FT                   2802762..2802893,2804523..2805211))
FT                   /codon_start=1
FT                   /gene="Pigq"
FT                   /locus_tag="mCG_1573"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class Q"
FT                   /note="gene_id=mCG1573.1 transcript_id=mCT8397.0
FT                   protein_id=mCP23249.1"
FT                   /db_xref="GOA:Q3TF56"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="MGI:MGI:1333114"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TF56"
FT                   /protein_id="EDL22475.1"
FT                   /translation="MVLKVFFPTCCASADSGLLVGRWVPGQSSAVILAVVHFPFIPIQV
FT                   KELLAQVQKASQVPVAVLGTWCHRQQEPQESLGNFLEGLGTIFSHDPWLQLCRERGTRL
FT                   WSCKATYPQMSNPLDMHPEEQVMLIFYDQRKLLLSWLHPPPVLPACQMGDTTASTGGLA
FT                   DIFDTVARSEVLFRNDQFDERPVRLSHWQSEGVEASILVELAKRASGPVCLLLASLLSL
FT                   ISAASACRLWKLWPLSFIRSKLSTCEQLHHRLKHLSFIFSTEKAQNPMQLMRKANMLVS
FT                   VLLDVALGLLLLSWLHSNNRIGQLANALVPVADRVAEELQHLLQWLMGAPAGLKMNRAL
FT                   DQVLGRFFLYHIHLWISYIHLMSPFIEHILWHVGLSACLGLTVALSIFSDIIALLTFHI
FT                   YCFYVYGARLYCLKIYGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLFTILVF
FT                   LLPTTALYYLVFTLLRLLVITVQGLIHLLVDLINSLPLYSLGLRLCRPYRLAAGVKFRV
FT                   LEKEAGRPLRLLMQINPLSYNHVMHIYRLPRCGCHPKHSWGTLCRKLVFGELIYPWRQR
FT                   EDKQD"
FT   assembly_gap    2795839..2795866
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    2797084..2797210
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            complement(<2811124..>2816273)
FT                   /locus_tag="mCG_48762"
FT                   /note="gene_id=mCG48762.1"
FT   mRNA            complement(join(<2811124..2811964,2814321..2814953,
FT                   2815204..>2816273))
FT                   /locus_tag="mCG_48762"
FT                   /product="mCG48762"
FT                   /note="gene_id=mCG48762.1 transcript_id=mCT48945.2 created
FT                   on 03-JUN-2002"
FT   CDS             complement(join(2811124..2811964,2814321..2814953,
FT                   2815204..2816273))
FT                   /codon_start=1
FT                   /locus_tag="mCG_48762"
FT                   /product="mCG48762"
FT                   /note="gene_id=mCG48762.1 transcript_id=mCT48945.2
FT                   protein_id=mCP42884.2"
FT                   /protein_id="EDL22476.1"
FT                   /translation="MSREAGSCRVGTGTRARSRKPKKPHYIPRPWGKPYNYKCFQCPFT
FT                   CLEKSHLYNHMKYSLCKDSLSLLLDSPDWACRRAPPSPRPRVPTPNCSTDFSDPSSKPT
FT                   EPDLIVTDSFSQRRSGRGPKPGPEESPGSLPPLARPIRKGPGTSGLLAESWKPGLSGGM
FT                   LSGTLGTIASTPGSESSVPCYPPPAQGEFPEAQSLHLSLLGVNYPLGPGLFSYLGPSLA
FT                   AAAAHMPFLASASPLLPPTAFPAPQTPERPGLAPRLYYPLLLEHSLGQSSGRAAPAKSS
FT                   VPLKGPPGALSAPGLLKVPVPGPGGPWPHGTSRDPGHEGELGRVTQSNPQKRLPTGNMP
FT                   ELPKAPLNLAKFGCQSSLPTGSSLLLWPEDKEPGDPEASGPEFHLLQHPQGQGLGSTVP
FT                   VGEDLTQAFGDYARVEQCLGQLAPAGGLAPRPLREQLGKIRRELFTIHQALARAARPLD
FT                   TPLDLSVKRVPTKGTEAPSESWRLHDPGPVLARGTSEPSSILGPVLESFSSRTTKCEAD
FT                   SSVPPPVLPLQAPEDPVIPGSGWGNRLGAGSSQTPKDTPSLQILPSADFCSLDQLRDAN
FT                   CSRQPRLLGQILVPAGAAGSPRGLHCSPDGLLFLTAGVASCVHVLDLEGRSICQLPCCI
FT                   PRTGAFVPEDVAVTAAGLVVVSDLIHGAVYALQYTSREPQGRWVTVGTFLSPRGLAVDA
FT                   LGHFLVTDYLPGTVHSFMLGPTWEPLAPTSMLGLEGPCWVGPGPDGGFAVSEEFGDVQL
FT                   FGSAHQPLGSLGTLTGHNFGHPAGVCSDAEGSIIVADEQRHQVTLFPRVGPPICLQLEG
FT                   LKRPLGMACAPQGQLVVADAGDNCIKLYQYLGEMA"
FT   assembly_gap    2812185..2812204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2819183..2831458
FT                   /gene="A930017K11Rik"
FT                   /locus_tag="mCG_145989"
FT                   /note="gene_id=mCG145989.0"
FT   mRNA            join(<2819183..2820470,2827088..2827172,2827553..2828018,
FT                   2829378..2829563,2829685..2829836,2829910..2830058,
FT                   2830820..2831458)
FT                   /gene="A930017K11Rik"
FT                   /locus_tag="mCG_145989"
FT                   /product="RIKEN cDNA A930017K11"
FT                   /note="gene_id=mCG145989.0 transcript_id=mCT186097.0
FT                   created on 04-JUL-2003"
FT   assembly_gap    2821537..2821658
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            complement(2826213..2853672)
FT                   /gene="Solh"
FT                   /locus_tag="mCG_1577"
FT                   /note="gene_id=mCG1577.3"
FT   mRNA            complement(join(2826213..2827577,2827651..2828407,
FT                   2828494..2828655,2829568..2829720,2829802..2829927,
FT                   2830519..2830742,2830810..2830993,2831095..2831303,
FT                   2831875..2833375,2853345..>2853580))
FT                   /gene="Solh"
FT                   /locus_tag="mCG_1577"
FT                   /product="small optic lobes homolog (Drosophila),
FT                   transcript variant mCT191642"
FT                   /note="gene_id=mCG1577.3 transcript_id=mCT191642.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2826215..2826868,2827651..2827829,
FT                   2828181..2828407,2828494..2828655,2829568..2829720,
FT                   2829802..2829927,2830519..2830993,2831875..2833375,
FT                   2853345..>2853556))
FT                   /gene="Solh"
FT                   /locus_tag="mCG_1577"
FT                   /product="small optic lobes homolog (Drosophila),
FT                   transcript variant mCT191641"
FT                   /note="gene_id=mCG1577.3 transcript_id=mCT191641.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2826250..2827577,2827651..2827829,
FT                   2827909..2828075,2828181..2828407,2828494..2828655,
FT                   2829568..2829720,2829802..2829927,2830519..2830742,
FT                   2830810..2830993,2831095..2831303,2831875..2833375,
FT                   2853345..2853672))
FT                   /gene="Solh"
FT                   /locus_tag="mCG_1577"
FT                   /product="small optic lobes homolog (Drosophila),
FT                   transcript variant mCT8403"
FT                   /note="gene_id=mCG1577.3 transcript_id=mCT8403.1 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(2827400..2827577,2827651..2827829,
FT                   2827909..2828075,2828181..2828407,2828494..2828655,
FT                   2829568..2829720,2829802..2829927,2830519..2830742,
FT                   2830810..2830993,2831095..2831303,2831875..2833353))
FT                   /codon_start=1
FT                   /gene="Solh"
FT                   /locus_tag="mCG_1577"
FT                   /product="small optic lobes homolog (Drosophila), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1577.3 transcript_id=mCT8403.1
FT                   protein_id=mCP23180.1 isoform=CRA_c"
FT                   /protein_id="EDL22480.1"
FT                   /translation="MATVGEWSCARCTFLNPAGQRQCSICEAPRHKPDLDQILRLSVEE
FT                   QKWPCARCTFRNFLGKEACEVCGFTPEPVPGAPLLPIINGVLPKPPTILVEPKGSGKEE
FT                   AGPVRTAGLVATEPARGRPEGEEEREERGEEEEKEQEGEGERAEPGSGWACQRCTLHNT
FT                   PVASSCSACGGPRKLSLPRIPPEALVVPEVVAPTGFHVVPAPSQPVLPGEGAEADSPST
FT                   SQGPTSTDQEPPRVPLFSPFSPTLQNNPVPRSRREVPPQLQPPVPEAVQSSASTSSKGP
FT                   QQGPGRAAAGASRLAELLSGKELLPGKRLSVLEEEVPESSPARCESCSDVIDLAGDIVR
FT                   YTPASPSSPDFTTWSCARCTLRNPTTAPRCSVCGGSKLHGFQEHSEPPTHCPDCGANKP
FT                   GPCVGSCGRAPSAHKAVRLLPDRPGQWACPACTLINTPRAKHCAACHTPQLLVTQCRGA
FT                   TPLRRRESMHVEKRRQTDEGEAKALWENIVAFCRENSVNFVDDSFPPGPASVGFPVGDS
FT                   VQQRVKQWLRPHEINCSVFRDHGTPWSVFHTLRPSDILQGLLGNCWFLSALAVLAERPD
FT                   LVERVMVTRSLCAEGAYQVRLCKDGTWTTVLVDDMLPCDEAGFLLFSQAQRKQLWVALI
FT                   EKALAKLHGSYFALQAGRAIEGLATLTGAPCESLALQVSSTNPREEPVDTDLIWAKMLS
FT                   SKEAGFLMGASCGGGNMKVDDAAYESLGLRPRHAYSVLDVRDVQGSRLLRLRNPWGRFS
FT                   WNGSWSDEWPHWPGHLRAELMPHGSSEGVFWMEYSDFIRYFDSVDICKVHSDWQEARVQ
FT                   GCFPSTAGGPVGVTALTVLERASLEFALFQEGSRRSDSVDSHLLDLCILVFRATFGTGG
FT                   RLSLGRLLAHSKRAVKKFVNCDVMLEPGEYAVVCCAFNHWNPAPPGPPAQASSPSAGVP
FT                   RGAPEPPGHVLAVYSSRLVMVEPVEAQPTTLADAIILLTESRGERHEGREGMTCYYLTH
FT                   GWAGLIVVVENRHPKSYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEG
FT                   NAGFSITHRLAHRKAAQAFLSDWTASRGTHSPPLTPDVAGLHGPRPL"
FT   CDS             complement(join(2827726..2828407,2828494..2828655,
FT                   2829568..2829720,2829802..2829927,2830519..2830742,
FT                   2830810..2830993,2831095..2831303,2831875..2833375,
FT                   2853345..>2853367))
FT                   /codon_start=1
FT                   /gene="Solh"
FT                   /locus_tag="mCG_1577"
FT                   /product="small optic lobes homolog (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1577.3 transcript_id=mCT191642.0
FT                   protein_id=mCP112643.0 isoform=CRA_b"
FT                   /protein_id="EDL22479.1"
FT                   /translation="GGAAGSLSHTHSPGSMATVGEWSCARCTFLNPAGQRQCSICEAPR
FT                   HKPDLDQILRLSVEEQKWPCARCTFRNFLGKEACEVCGFTPEPVPGAPLLPIINGVLPK
FT                   PPTILVEPKGSGKEEAGPVRTAGLVATEPARGRPEGEEEREERGEEEEKEQEGEGERAE
FT                   PGSGWACQRCTLHNTPVASSCSACGGPRKLSLPRIPPEALVVPEVVAPTGFHVVPAPSQ
FT                   PVLPGEGAEADSPSTSQGPTSTDQEPPRVPLFSPFSPTLQNNPVPRSRREVPPQLQPPV
FT                   PEAVQSSASTSSKGPQQGPGRAAAGASRLAELLSGKELLPGKRLSVLEEEVPESSPARC
FT                   ESCSDVIDLAGDIVRYTPASPSSPDFTTWSCARCTLRNPTTAPRCSVCGGSKLHGFQEH
FT                   SEPPTHCPDCGANKPGPCVGSCGRAPSAHKAVRLLPDRPGQWACPACTLINTPRAKHCA
FT                   ACHTPQLLVTQCRGATPLRRRESMHVEKRRQTDEGEAKALWENIVAFCRENSVNFVDDS
FT                   FPPGPASVGFPVGDSVQQRVKQWLRPHEINCSVFRDHGTPWSVFHTLRPSDILQGLLGN
FT                   CWFLSALAVLAERPDLVERVMVTRSLCAEGAYQVRLCKDGTWTTVLVDDMLPCDEAGFL
FT                   LFSQAQRKQLWVALIEKALAKLHGSYFALQAGRAIEGLATLTGAPCESLALQVSSTNPR
FT                   EEPVDTDLIWAKMLSSKEAGFLMGASCGGGNMKVDDAAYESLGLRPRHAYSVLDVRDVQ
FT                   GSRLLRLRNPWGRFSWNGSWSDEWPHWPGHLRAELMPHGSSEGVFWMEYSDFIRYFDSV
FT                   DICKVHSDWQEARVQGCFPSTAGGPVGVTALTVLERASLEFALFQEGSRRSDSVDSHLL
FT                   DLCILVFRATFGTGGRLSLGRLLAHSKRAVKKFVNCDVMLEPGEYAVVCCAFNHWNPAP
FT                   PGPPAQGKGPSQMRPTPSFPTSEPQSPPTGKLLAPLSTPPTASSPSAGVPRGAPEPPGH
FT                   VLAVYSSRLVMVEPVEAQPTTLADAIILLTESRGERHEVGGVLMGEGRGWATTSPGPPT
FT                   LCLCPGSRGHDLLLPDSWLGGTHRGSGEPAPQVLPACAM"
FT   CDS             join(<2827781..2828018,2829378..2829563,2829685..2829836,
FT                   2829910..2829993)
FT                   /codon_start=1
FT                   /gene="A930017K11Rik"
FT                   /locus_tag="mCG_145989"
FT                   /product="RIKEN cDNA A930017K11"
FT                   /note="gene_id=mCG145989.0 transcript_id=mCT186097.0
FT                   protein_id=mCP107359.0"
FT                   /protein_id="EDL22477.1"
FT                   /translation="VPPSHESGNSRSCPLDPGHRHRVGGPGLVVAHPLPSPIRTPPTSC
FT                   RSPRLSVSRMMASASVVGCASTGSTMTSLELYTAMCVTVKQTDSFSGHHKKQNDLHRAP
FT                   WVDQELPFRGLQELGPRQAAYLDQLPDALATGWVRHAGETAPWVPESQEPVDHRTENQS
FT                   CVPCANTLIHPQPIGPLPGALNITNIQDRDAPMRNLCGQSNPWLMKWMDSRGDRPP"
FT   CDS             complement(join(2830964..2830993,2831875..2833375,
FT                   2853345..>2853367))
FT                   /codon_start=1
FT                   /gene="Solh"
FT                   /locus_tag="mCG_1577"
FT                   /product="small optic lobes homolog (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1577.3 transcript_id=mCT191641.0
FT                   protein_id=mCP112642.0 isoform=CRA_a"
FT                   /protein_id="EDL22478.1"
FT                   /translation="GGAAGSLSHTHSPGSMATVGEWSCARCTFLNPAGQRQCSICEAPR
FT                   HKPDLDQILRLSVEEQKWPCARCTFRNFLGKEACEVCGFTPEPVPGAPLLPIINGVLPK
FT                   PPTILVEPKGSGKEEAGPVRTAGLVATEPARGRPEGEEEREERGEEEEKEQEGEGERAE
FT                   PGSGWACQRCTLHNTPVASSCSACGGPRKLSLPRIPPEALVVPEVVAPTGFHVVPAPSQ
FT                   PVLPGEGAEADSPSTSQGPTSTDQEPPRVPLFSPFSPTLQNNPVPRSRREVPPQLQPPV
FT                   PEAVQSSASTSSKGPQQGPGRAAAGASRLAELLSGKELLPGKRLSVLEEEVPESSPARC
FT                   ESCSDVIDLAGDIVRYTPASPSSPDFTTWSCARCTLRNPTTAPRCSVCGGSKLHGFQEH
FT                   SEPPTHCPDCGANKPGPCVGSCGRAPSAHKAVRLLPDRPGQWACPACTLINTPRAKHCA
FT                   ACHTPQLLVTQCRGATPLRRRESMHVEKRRQTDEGEAKALWENIVAFCREVPECVGSTG
FT                   "
FT   gene            <2853688..2856424
FT                   /locus_tag="mCG_1033971"
FT                   /note="gene_id=mCG1033971.1"
FT   mRNA            join(<2853688..2853910,2855857..2856343)
FT                   /locus_tag="mCG_1033971"
FT                   /product="mCG1033971, transcript variant mCT169842"
FT                   /note="gene_id=mCG1033971.1 transcript_id=mCT169842.0
FT                   created on 03-JUN-2002"
FT   mRNA            join(<2853942..2854145,2855857..2856424)
FT                   /locus_tag="mCG_1033971"
FT                   /product="mCG1033971, transcript variant mCT151675"
FT                   /note="gene_id=mCG1033971.1 transcript_id=mCT151675.0
FT                   created on 03-JUN-2002"
FT   CDS             <2855883..2856131
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033971"
FT                   /product="mCG1033971, isoform CRA_a"
FT                   /note="gene_id=mCG1033971.1 transcript_id=mCT169842.0
FT                   protein_id=mCP92675.0 isoform=CRA_a"
FT                   /protein_id="EDL22481.1"
FT                   /translation="KQCQRPTGDRICFGQSVPLAEGSRVGKSCGHSLHTPTIRSIVRSL
FT                   LEDANFWDYPLGIVVGPYRKFLDSFSWNVSTNNPSQT"
FT   CDS             <2855883..2856131
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033971"
FT                   /product="mCG1033971, isoform CRA_a"
FT                   /note="gene_id=mCG1033971.1 transcript_id=mCT151675.0
FT                   protein_id=mCP84688.0 isoform=CRA_a"
FT                   /protein_id="EDL22482.1"
FT                   /translation="KQCQRPTGDRICFGQSVPLAEGSRVGKSCGHSLHTPTIRSIVRSL
FT                   LEDANFWDYPLGIVVGPYRKFLDSFSWNVSTNNPSQT"
FT   gene            complement(2856916..2937551)
FT                   /locus_tag="mCG_132822"
FT                   /note="gene_id=mCG132822.2"
FT   mRNA            complement(join(2856916..2858759,2858850..2858990,
FT                   2859132..2859287,2859537..2859674,2860524..2860605,
FT                   2862127..2862267,2865872..2865975,2873128..2873221,
FT                   2877450..2877485,2880598..2880732,2882374..2882517,
FT                   2884544..2884755,2892965..2893056,2905153..2905246,
FT                   2936272..2937308))
FT                   /locus_tag="mCG_132822"
FT                   /product="mCG132822, transcript variant mCT134180"
FT                   /note="gene_id=mCG132822.2 transcript_id=mCT134180.2
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(2856919..2858759,2858850..2858990,
FT                   2859132..2859287,2859537..2859674,2860524..2860605,
FT                   2862127..2862267,2865872..2865975,2873128..2873221,
FT                   2877450..2877485,2882374..2882517,2884544..2884755,
FT                   2892965..2893056,2905153..2905246,2936272..2937551))
FT                   /locus_tag="mCG_132822"
FT                   /product="mCG132822, transcript variant mCT185258"
FT                   /note="gene_id=mCG132822.2 transcript_id=mCT185258.0
FT                   created on 12-JUN-2003"
FT   CDS             complement(join(2858646..2858759,2858850..2858990,
FT                   2859132..2859287,2859537..2859674,2860524..2860605,
FT                   2862127..2862267,2865872..2865975,2873128..2873221,
FT                   2877450..2877485,2882374..2882517,2884544..2884728))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132822"
FT                   /product="mCG132822, isoform CRA_b"
FT                   /note="gene_id=mCG132822.2 transcript_id=mCT185258.0
FT                   protein_id=mCP106516.0 isoform=CRA_b"
FT                   /protein_id="EDL22484.1"
FT                   /translation="MGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECL
FT                   DTMEEPDHGALLLLPGRSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDP
FT                   AFLTPSPAKRLSSRKVARYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSE
FT                   LEKDSAAAGEQHGRLRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKME
FT                   REKSIEIENLQARLQQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEE
FT                   QENKRKMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQ
FT                   EYNSRARESELEQEVRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAE
FT                   ISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAILETNPSILEVK"
FT   CDS             complement(join(2858646..2858759,2858850..2858990,
FT                   2859132..2859287,2859537..2859674,2860524..2860605,
FT                   2862127..2862267,2865872..2865975,2873128..2873221,
FT                   2877450..2877485,2880598..2880732,2882374..2882517,
FT                   2884544..2884728))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132822"
FT                   /product="mCG132822, isoform CRA_a"
FT                   /note="gene_id=mCG132822.2 transcript_id=mCT134180.2
FT                   protein_id=mCP84508.1 isoform=CRA_a"
FT                   /protein_id="EDL22483.1"
FT                   /translation="MGSESTYSECETFTDEDTSTLVHPELQPEGDVDSAGGSGVPSECL
FT                   DTMEEPDHGALLLLPGRSRPHSQAVVMVIGSEEHFEDYGEGNEAELSPETLCDGDGEDP
FT                   AFLTPSSNPLASKLCDVLTDEAFEFYCSQCHKQINRLEDLSARLTDLEMNSPAKRLSSR
FT                   KVARYLHQSGTLTMEALEDPPPEPVECPEEDIADKVIFLERRVSELEKDSAAAGEQHGR
FT                   LRQENLQLVHRANALEEQLKEQEFRAQEKVLEETRKQKELLCKMEREKSIEIENLQARL
FT                   QQLDEENSELRSCTPCLKANIERLEEEKQKMLDEIEELTQRLSEEQENKRKMGDRLSHE
FT                   RHQFQRDKEATQELIEDLRKQLEHLQLLRLEVEQRRGRSSSLGLQEYNSRARESELEQE
FT                   VRRLKQDNRNLKEQNDELNGQIITLSIQGAKSLFSTSFSESLAAEISSVSRDELMEAIQ
FT                   KQEEINFRLQDYIDRIIVAILETNPSILEVK"
FT   assembly_gap    2871274..2871293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2893239..2893258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2901517..2901627
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    2909137..2909156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2914581..2914600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2934705..2934724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2941730..2941749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2949948..2958849)
FT                   /gene="Decr2"
FT                   /locus_tag="mCG_1579"
FT                   /note="gene_id=mCG1579.1"
FT   mRNA            complement(join(2949948..2950998,2951593..2951810,
FT                   2952293..2952397,2952562..2952655,2952728..2952852,
FT                   2956009..2956144,2956707..2956758,2957614..2957682,
FT                   2958649..2958849))
FT                   /gene="Decr2"
FT                   /locus_tag="mCG_1579"
FT                   /product="2-4-dienoyl-Coenzyme A reductase 2, peroxisomal"
FT                   /note="gene_id=mCG1579.1 transcript_id=mCT8405.0 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(2951593..2951810,2952293..2952397,
FT                   2952562..2952655,2952728..2952852,2956009..2956144,
FT                   2956707..2956758,2957614..2957682,2958649..2958728))
FT                   /codon_start=1
FT                   /gene="Decr2"
FT                   /locus_tag="mCG_1579"
FT                   /product="2-4-dienoyl-Coenzyme A reductase 2, peroxisomal"
FT                   /note="gene_id=mCG1579.1 transcript_id=mCT8405.0
FT                   protein_id=mCP23202.1"
FT                   /db_xref="GOA:Q3UVJ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:1347059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UVJ7"
FT                   /protein_id="EDL22485.1"
FT                   /translation="MAQPPPDVEGDDCLPEYHHLFCPDLLQDKVAFITGGGSGIGFRIA
FT                   EIFMRHGCHTVIVGRSLQKVTTAAKKLVAATGKRCLPLSMDVRVPPEVMTAVDQALQEF
FT                   GKINILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHGGVIVNI
FT                   TATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLRG
FT                   SNASSKLKHFSNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQ
FT                   LLEFESFSAKL"
FT   assembly_gap    2955189..2955268
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            complement(2960430..2964147)
FT                   /gene="Nme4"
FT                   /locus_tag="mCG_1581"
FT                   /note="gene_id=mCG1581.0"
FT   mRNA            complement(join(2960430..2960837,2962293..2962405,
FT                   2962535..2962636,2962813..2962946,2964042..2964147))
FT                   /gene="Nme4"
FT                   /locus_tag="mCG_1581"
FT                   /product="expressed in non-metastatic cells 4, protein"
FT                   /note="gene_id=mCG1581.0 transcript_id=mCT8407.0 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(2960714..2960837,2962293..2962405,
FT                   2962535..2962636,2962813..2962946,2964042..2964129))
FT                   /codon_start=1
FT                   /gene="Nme4"
FT                   /locus_tag="mCG_1581"
FT                   /product="expressed in non-metastatic cells 4, protein"
FT                   /note="gene_id=mCG1581.0 transcript_id=mCT8407.0
FT                   protein_id=mCP23213.1"
FT                   /protein_id="EDL22486.1"
FT                   /translation="MGSLFGRVAALRALLCGPRFQCLLVRPSSGGPPWPQERTLVAVKP
FT                   DGVQRRLVGTVIQRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYMSSGP
FT                   VVAMVWEGPNVVHISRAMIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVDGAQREIE
FT                   LWFQSSELLNWADGGHHSSCYPA"
FT   assembly_gap    2965670..2966311
FT                   /estimated_length=642
FT                   /gap_type="unknown"
FT   assembly_gap    2967415..2968463
FT                   /estimated_length=1049
FT                   /gap_type="unknown"
FT   assembly_gap    2969221..2970708
FT                   /estimated_length=1488
FT                   /gap_type="unknown"
FT   assembly_gap    2974212..2974231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2981791..2991726
FT                   /gene="Tmem8"
FT                   /locus_tag="mCG_1585"
FT                   /note="gene_id=mCG1585.1"
FT   mRNA            join(2981791..2982041,2985234..2985408,2985494..2985701,
FT                   2985886..2986013,2986214..2986482,2986585..2986904,
FT                   2987337..2987427,2987508..2987631,2987874..2988010,
FT                   2988759..2988937,2989014..2989160,2990015..2990131,
FT                   2990413..2991726)
FT                   /gene="Tmem8"
FT                   /locus_tag="mCG_1585"
FT                   /product="transmembrane protein 8 (five membrane-spanning
FT                   domains)"
FT                   /note="gene_id=mCG1585.1 transcript_id=mCT8411.1 created on
FT                   03-JUN-2002"
FT   CDS             join(2981924..2982041,2985234..2985408,2985494..2985701,
FT                   2985886..2986013,2986214..2986482,2986585..2986904,
FT                   2987337..2987427,2987508..2987631,2987874..2988010,
FT                   2988759..2988937,2989014..2989160,2990015..2990131,
FT                   2990413..2990709)
FT                   /codon_start=1
FT                   /gene="Tmem8"
FT                   /locus_tag="mCG_1585"
FT                   /product="transmembrane protein 8 (five membrane-spanning
FT                   domains)"
FT                   /note="gene_id=mCG1585.1 transcript_id=mCT8411.1
FT                   protein_id=mCP23231.1"
FT                   /protein_id="EDL22487.1"
FT                   /translation="MGRVGAGGTAREAATGSLLLLLLLLARPPPAAASNSKESEAGLVS
FT                   EHFSQAPQKLSFYSWYGSTRLFHFRVPPDTVLLRWLLHVSQGGPSCTDEEITVHFRYGA
FT                   PPVINPLGTSFPDNTLSHASFHIRALLSTLMLDNTSVNISHPAPGDWFLVAHLPPSSQK
FT                   IQVKGFVPTCAYIFQPDMLVMRVVEVSTLEPDVPLPQTLLSYPSYLKIFVPEYTQELRL
FT                   ELQGCVSSVSPGCPVRVTVGATTLPRNFQRVLTCTGLAPSCHLLLSSPPWGRWLQVTFE
FT                   SLAEPHVTVGFTAKAVFTVCRPWSVTIHHLIQNNPNQTYDTSAIQLSQSAVHRDLGRSS
FT                   RVDSGPFCLLNYPVLREDTDVVSVHFQPLNGAFVLVHSSMPSVMQLRLDTGMDSGGSFI
FT                   IVLRTNKTEVTNGTLVAACVNAASPFLSFNTSLNCTTAFFQGYPMFLRASSHMANLIMP
FT                   FPETDNWYLSLQLVCPESPEDCEQAVVRVETILYLVPCLNDCGPYGQCLLLRRYGYVYA
FT                   GCSCKAGWRGWSCTDNSTAQTVAQQRAAALLLTLSNLMFLAPIAISLHRSFLVEASVYF
FT                   YTMFFSTFYHACDQPGEAVLCILSYDTLQYCDFLGSGASTWVTILCMARLKTILKQVLL
FT                   VLGTLVIAMSLQMDRRGIWNLMGPCVFAFVIMASMWIYRCGHRGQCYPTSWQRWVFYLL
FT                   PGISMASVGIAMYTSMMTSDNYYYTHSIWHILLAGSAAFLLPPREEKAGSWACLQKFPC
FT                   HYQICRNDRDELYTVT"
FT   gene            2992007..2995096
FT                   /gene="Mrpl28"
FT                   /locus_tag="mCG_1574"
FT                   /note="gene_id=mCG1574.1"
FT   mRNA            join(2992007..2992324,2993031..2993183,2993742..2993876,
FT                   2993963..2994049,2994756..2995096)
FT                   /gene="Mrpl28"
FT                   /locus_tag="mCG_1574"
FT                   /product="mitochondrial ribosomal protein L28"
FT                   /note="gene_id=mCG1574.1 transcript_id=mCT8399.1 created on
FT                   03-JUN-2002"
FT   CDS             join(2992037..2992324,2993031..2993183,2993742..2993876,
FT                   2993963..2994049,2994756..2994866)
FT                   /codon_start=1
FT                   /gene="Mrpl28"
FT                   /locus_tag="mCG_1574"
FT                   /product="mitochondrial ribosomal protein L28"
FT                   /note="gene_id=mCG1574.1 transcript_id=mCT8399.1
FT                   protein_id=mCP23265.1"
FT                   /protein_id="EDL22488.1"
FT                   /translation="MPLHRYPVHLWQKLRLRQGICARLPAHFLRSLEEERTPTPVHYKP
FT                   HGTKFKINPKNGQRERVEDVPIPVHYPPESQQGLWGGEGLILGYRYANNDKLSKRVKKV
FT                   WKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLGSKFGMDLKR
FT                   GMLLRLARQDPHLHPENPERRAAIYDKYRSFVIPEAEAEWVGLTLEEALEKQRLLEEKD
FT                   PVPLFKVYVEELVQRLQEQVLSRPAVVQKRAGDHA"
FT   assembly_gap    2993687..2993706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3007183..3007530
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   gene            3010999..3064297
FT                   /gene="Axin1"
FT                   /locus_tag="mCG_124196"
FT                   /note="gene_id=mCG124196.1"
FT   mRNA            join(3010999..3011959,3041999..3042139,3050956..3051052,
FT                   3052643..3052780,3056114..3056676,3057029..3057199,
FT                   3058441..3058686,3061004..3061111,3062426..3062593,
FT                   3063422..3064296)
FT                   /gene="Axin1"
FT                   /locus_tag="mCG_124196"
FT                   /product="axin 1, transcript variant mCT125434"
FT                   /note="gene_id=mCG124196.1 transcript_id=mCT125434.0
FT                   created on 03-JUN-2002"
FT   mRNA            join(<3011000..3011959,3041999..3042139,3050956..3051052,
FT                   3052643..3052780,3056159..3056676,3057029..3057199,
FT                   3058441..3058686,3061004..3061111,3062426..3062593,
FT                   3063422..3064297)
FT                   /gene="Axin1"
FT                   /locus_tag="mCG_124196"
FT                   /product="axin 1, transcript variant mCT191669"
FT                   /note="gene_id=mCG124196.1 transcript_id=mCT191669.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<3011001..3011959,3041999..3042139,3050956..3051052,
FT                   3052643..3052780,3056159..3056676,3057029..3057199,
FT                   3058441..3058686,3061004..3061111,3062426..3062593,
FT                   3063422..3063548)
FT                   /codon_start=1
FT                   /gene="Axin1"
FT                   /locus_tag="mCG_124196"
FT                   /product="axin 1, isoform CRA_b"
FT                   /note="gene_id=mCG124196.1 transcript_id=mCT191669.0
FT                   protein_id=mCP112614.0 isoform=CRA_b"
FT                   /protein_id="EDL22490.1"
FT                   /translation="ERLIPLGAVSTEVLGCSAHCSLMQSPKMNVQEQGFPLDLGASFTE
FT                   DAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSAS
FT                   PTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEK
FT                   RLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEE
FT                   NTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDAD
FT                   EDDGRDPLPPSRLTQKLLLETAAPRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALA
FT                   PATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESIQVNGRVPLPHIP
FT                   RTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGEMPSGP
FT                   MASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRTPGCQSPGPGH
FT                   RSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQME
FT                   AEVARRVQSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAFGGKTSAPSKRNTKKAESG
FT                   KNANAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGLRKQQAHESSRPLSIE
FT                   RPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLP
FT                   SKQRYVQAVMQRGRTCVRPACAPVLSVVPAVSDLELSETETKSQRKAGGGSAPPCDSIV
FT                   VAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVRED
FT                   EAVLPVFEEKIIGKVEKVD"
FT   CDS             join(3011067..3011959,3041999..3042139,3050956..3051052,
FT                   3052643..3052780,3056114..3056676,3057029..3057199,
FT                   3058441..3058686,3061004..3061111,3062426..3062593,
FT                   3063422..3063548)
FT                   /codon_start=1
FT                   /gene="Axin1"
FT                   /locus_tag="mCG_124196"
FT                   /product="axin 1, isoform CRA_a"
FT                   /note="gene_id=mCG124196.1 transcript_id=mCT125434.0
FT                   protein_id=mCP84729.1 isoform=CRA_a"
FT                   /protein_id="EDL22489.1"
FT                   /translation="MQSPKMNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPV
FT                   NHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGI
FT                   SLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSR
FT                   QTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSES
FT                   PKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKLLLETA
FT                   APRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSL
FT                   TDSSVDGIPPYRIRKQHRREMQESIQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIH
FT                   RLEAVQRTREAEEKLEERLKRVRMVCPYSCSDSTAVSPQEEEGEDGEMPSGPMASHKLP
FT                   SVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSGH
FT                   VAKTAVLGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQMEAEVARRV
FT                   QSSFSWGPETHGHAKPRSYSENAGTTLSAGDLAFGGKTSAPSKRNTKKAESGKNANAEV
FT                   PSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGLRKQQAHESSRPLSIERPGAVHP
FT                   WVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQRYVQ
FT                   AVMQRGRTCVRPACAPVLSVVPAVSDLELSETETKSQRKAGGGSAPPCDSIVVAYYFCG
FT                   EPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVF
FT                   EEKIIGKVEKVD"
FT   assembly_gap    3047861..3047997
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    3060020..3060039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3064489..>3067524)
FT                   /locus_tag="mCG_145990"
FT                   /note="gene_id=mCG145990.0"
FT   mRNA            complement(join(3064489..3064613,3064711..3064818,
FT                   3064907..3065088,3065169..3065289,3065379..3065576,
FT                   3065649..3065774,3065920..3066036,3066104..3066240,
FT                   3066318..3066451,3066540..3066746,3067312..>3067524))
FT                   /locus_tag="mCG_145990"
FT                   /product="mCG145990, transcript variant mCT191724"
FT                   /note="gene_id=mCG145990.0 transcript_id=mCT191724.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3064489..3064613,3064711..3064818,
FT                   3064907..3065088,3065169..3065289,3065379..3065576,
FT                   3065649..3065774,3065916..3066036,3066104..3066240,
FT                   3066318..3066451,3066540..3066746,3067312..>3067524))
FT                   /locus_tag="mCG_145990"
FT                   /product="mCG145990, transcript variant mCT186098"
FT                   /note="gene_id=mCG145990.0 transcript_id=mCT186098.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(3064569..3064613,3064711..3064818,
FT                   3064907..3065088,3065169..3065289,3065379..3065576,
FT                   3065649..3065774,3065920..3066036,3066104..3066240,
FT                   3066318..>3066375))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145990"
FT                   /product="mCG145990, isoform CRA_b"
FT                   /note="gene_id=mCG145990.0 transcript_id=mCT191724.0
FT                   protein_id=mCP112674.0 isoform=CRA_b"
FT                   /protein_id="EDL22492.1"
FT                   /translation="GRCPGTDGQMGYGGHWLLSGSTGKGYGNFPGLGQGCPGHDFGFTD
FT                   QPQLFEKFGLTKDTVVLFKKFDEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEFNSQ
FT                   TSPKIFAAKILNHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDVAADNSHVLN
FT                   YFGLKAEEAPTLRLINVETTKKYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPP
FT                   DWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIV
FT                   IAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGGHLPKEE
FT                   PKEPAASAPEAQANSTLGPKEEL"
FT   CDS             complement(join(3064569..3064613,3064711..3064818,
FT                   3064907..3065088,3065169..3065289,3065379..3065576,
FT                   3065649..3065774,3065916..>3066005))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145990"
FT                   /product="mCG145990, isoform CRA_a"
FT                   /note="gene_id=mCG145990.0 transcript_id=mCT186098.0
FT                   protein_id=mCP107357.0 isoform=CRA_a"
FT                   /protein_id="EDL22491.1"
FT                   /translation="TRRLAWTWGTCPASSSYIACTWSQNSTARQTSPKIFAAKILNHLL
FT                   LFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDVAADNSHVLNYFGLKAEEAPTLRLI
FT                   NVETTKKYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNF
FT                   EQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFS
FT                   VLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGGHLPKEEPKEPAASAPEAQANS
FT                   TLGPKEEL"
FT   gene            complement(3067669..3069674)
FT                   /gene="Arhgdig"
FT                   /locus_tag="mCG_1578"
FT                   /note="gene_id=mCG1578.1"
FT   mRNA            complement(join(3067669..3068015,3068099..3068162,
FT                   3068238..3068314,3068501..3068584,3068677..3068856,
FT                   3069557..3069674))
FT                   /gene="Arhgdig"
FT                   /locus_tag="mCG_1578"
FT                   /product="Rho GDP dissociation inhibitor (GDI) gamma"
FT                   /note="gene_id=mCG1578.1 transcript_id=mCT8404.1 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(3067816..3068015,3068099..3068162,
FT                   3068238..3068314,3068501..3068584,3068677..3068856,
FT                   3069557..3069629))
FT                   /codon_start=1
FT                   /gene="Arhgdig"
FT                   /locus_tag="mCG_1578"
FT                   /product="Rho GDP dissociation inhibitor (GDI) gamma"
FT                   /note="gene_id=mCG1578.1 transcript_id=mCT8404.1
FT                   protein_id=mCP23274.2"
FT                   /db_xref="GOA:Q3UNB6"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR024792"
FT                   /db_xref="MGI:MGI:108430"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UNB6"
FT                   /protein_id="EDL22493.1"
FT                   /translation="MLGLDACELGEQLLELLRLALCARVLLADKDGESTPSDEVLDEIV
FT                   PEYQAPGKKSMLAIWQLDPGDVSLVKYKQALLGPLPPIMDPSLPNVQVTRLTLLTEQAP
FT                   GPIIMDLTGDLDALKNQVFVLKEGIEYKVKITFKVNKEIVSGLKCLHHTYRRGLRVDKA
FT                   IFMVGSYGPRAQEYEFVTSVEEAPRGALARGLYVVRSLFTDDDRLNHLSWEWHLHVCQD
FT                   WKD"
FT   assembly_gap    3069784..3069808
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            <3071488..3079815
FT                   /locus_tag="mCG_1588"
FT                   /note="gene_id=mCG1588.3"
FT   mRNA            join(<3071488..3071580,3071753..3071931,3072005..3072051,
FT                   3072117..3072223,3072871..3072922,3073026..3073084,
FT                   3073390..3073466,3073647..3073728,3074246..3074314,
FT                   3075838..3075861,3075935..3075996,3076085..3076198,
FT                   3076298..3076413,3076531..3076618,3076703..3076841,
FT                   3078955..3079037,3079117..3079813)
FT                   /locus_tag="mCG_1588"
FT                   /product="mCG1588, transcript variant mCT191693"
FT                   /note="gene_id=mCG1588.3 transcript_id=mCT191693.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<3071512..3071580,3071835..3071931,3072001..3072051,
FT                   3072117..3072223,3072871..3072922,3073026..3073084,
FT                   3073390..3073466,3073647..3073728,3074246..3074314,
FT                   3075838..3075861,3075935..3075996,3076085..3076198,
FT                   3076298..3076413,3076531..3076618,3076703..3076841,
FT                   3078955..3079037,3079117..3079611)
FT                   /locus_tag="mCG_1588"
FT                   /product="mCG1588, transcript variant mCT8414"
FT                   /note="gene_id=mCG1588.3 transcript_id=mCT8414.2 created on
FT                   03-JUN-2002"
FT   CDS             join(3071512..3071580,3071835..3071931,3072001..3072051,
FT                   3072117..3072223,3072871..3072922,3073026..3073084,
FT                   3073390..3073466,3073647..3073728,3074246..3074314,
FT                   3075838..3075861,3075935..3075996,3076085..3076198,
FT                   3076298..3076413,3076531..3076618,3076703..3076841,
FT                   3078955..3079037,3079117..3079228)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1588"
FT                   /product="mCG1588, isoform CRA_c"
FT                   /note="gene_id=mCG1588.3 transcript_id=mCT8414.2
FT                   protein_id=mCP23314.2 isoform=CRA_c"
FT                   /db_xref="GOA:G3X8W6"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1354739"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8W6"
FT                   /protein_id="EDL22497.1"
FT                   /translation="MAMVTRCTPHGGCSRMQRPHLSKMERVVVSMQDPDQGVKMRSQRL
FT                   LITVIPHAVAGRDLVEWLVQKFCILEDEALHLGTLLAQHGYIYPLRESRDLTLRPDETP
FT                   YRFQTPYFWTSTMWPAAELDYAIYLAKKNIQKQGALVDYEKEHYALLHKKINHAWDLVL
FT                   MQAREQLRAAKQRRKGDRMVISCQEQTYWLVNKPPPGAPNILEQGPERGSYNPSHMQMS
FT                   SDFYKCEIECFRKALGRNRVKSSACLEAYLKFSSQHGPHDPIMSGCLPSNPWITDDVTY
FT                   WAMNAPNVAAPTKLRVERWSFSFRELLDDPVGRAHFMDFLQKEFSAENLSFWEACEELR
FT                   FGGQAQVPTLVDSVYQQFLAPGAARWINIDSRTMERTLEGLRQPHRYVLDAAQLHIYML
FT                   MKKDSYPRFLKSDIYKGLLEEAVIPLETKRWPFPFLRKPLHSSPSPALQSTPREPAATS
FT                   SPEGADGE"
FT   mRNA            join(<3071515..3071580,3071835..3071931,3072001..3072922,
FT                   3073026..3073084,3073390..3073466,3073647..3073728,
FT                   3074246..3074314,3075832..3075861,3075935..3075996,
FT                   3076085..3076198,3076298..3076413,3076531..3076618,
FT                   3076703..3076841,3078955..3079037,3079117..3079815)
FT                   /locus_tag="mCG_1588"
FT                   /product="mCG1588, transcript variant mCT191695"
FT                   /note="gene_id=mCG1588.3 transcript_id=mCT191695.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<3071531..3071580,3071835..3071931,3072001..3072051,
FT                   3072117..3072922,3073026..3073084,3073390..3073466,
FT                   3073647..3073728,3074246..3074314,3075832..3075861,
FT                   3075935..3075996,3076085..3076198,3076298..3076413,
FT                   3076531..3076618,3076703..3076841,3078955..3079037,
FT                   3079117..3079813)
FT                   /locus_tag="mCG_1588"
FT                   /product="mCG1588, transcript variant mCT191694"
FT                   /note="gene_id=mCG1588.3 transcript_id=mCT191694.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3071870..3071931,3072005..3072051,3072117..3072223,
FT                   3072871..3072922,3073026..3073084,3073390..3073466,
FT                   3073647..3073728,3074246..3074314,3075838..3075861,
FT                   3075935..3075996,3076085..3076198,3076298..3076413,
FT                   3076531..3076618,3076703..3076841,3078955..3079037,
FT                   3079117..3079228)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1588"
FT                   /product="mCG1588, isoform CRA_a"
FT                   /note="gene_id=mCG1588.3 transcript_id=mCT191693.0
FT                   protein_id=mCP112644.0 isoform=CRA_a"
FT                   /protein_id="EDL22494.1"
FT                   /translation="PRREDAEPAPSDHCHSPRGSGDLVEWLVQKFCILEDEALHLGTLL
FT                   AQHGYIYPLRESRDLTLRPDETPYRFQTPYFWTSTMWPAAELDYAIYLAKKNIQKQGAL
FT                   VDYEKEHYALLHKKINHAWDLVLMQAREQLRAAKQRRKGDRMVISCQEQTYWLVNKPPP
FT                   GAPNILEQGPERGSYNPSHMQMSSDFYKCEIECFRKALGRNRVKSSACLEAYLKFSSQH
FT                   GPHDPIMSGCLPSNPWITDDVTYWAMNAPNVAAPTKLRVERWSFSFRELLDDPVGRAHF
FT                   MDFLQKEFSAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLAPGAARWINIDSRTMER
FT                   TLEGLRQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGLLEEAVIPLETKRWPFPFL
FT                   RKPLHSSPSPALQSTPREPAATSSPEGADGE"
FT   CDS             join(<3075838..3075861,3075935..3075996,3076085..3076198,
FT                   3076298..3076413,3076531..3076618,3076703..3076841,
FT                   3078955..3079037,3079117..3079228)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1588"
FT                   /product="mCG1588, isoform CRA_b"
FT                   /note="gene_id=mCG1588.3 transcript_id=mCT191694.0
FT                   protein_id=mCP112645.0 isoform=CRA_b"
FT                   /protein_id="EDL22495.1"
FT                   /translation="SSDFYKCEIECFRKALGRNRVKSSACLEAYLKFSSQHGPHDPIMS
FT                   GCLPSNPWITDDVTYWAMNAPNVAAPTKLRVERWSFSFRELLDDPVGRAHFMDFLQKEF
FT                   SAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLAPGAARWINIDSRTMERTLEGLRQP
FT                   HRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGLLEEAVIPLETKRWPFPFLRKPLHSSP
FT                   SPALQSTPREPAATSSPEGADGE"
FT   CDS             join(<3075838..3075861,3075935..3075996,3076085..3076198,
FT                   3076298..3076413,3076531..3076618,3076703..3076841,
FT                   3078955..3079037,3079117..3079228)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1588"
FT                   /product="mCG1588, isoform CRA_b"
FT                   /note="gene_id=mCG1588.3 transcript_id=mCT191695.0
FT                   protein_id=mCP112646.0 isoform=CRA_b"
FT                   /protein_id="EDL22496.1"
FT                   /translation="SSDFYKCEIECFRKALGRNRVKSSACLEAYLKFSSQHGPHDPIMS
FT                   GCLPSNPWITDDVTYWAMNAPNVAAPTKLRVERWSFSFRELLDDPVGRAHFMDFLQKEF
FT                   SAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLAPGAARWINIDSRTMERTLEGLRQP
FT                   HRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGLLEEAVIPLETKRWPFPFLRKPLHSSP
FT                   SPALQSTPREPAATSSPEGADGE"
FT   gene            complement(3081195..3113185)
FT                   /gene="Itfg3"
FT                   /locus_tag="mCG_1567"
FT                   /note="gene_id=mCG1567.2"
FT   mRNA            complement(join(3081195..3082212,3082299..3082401,
FT                   3082823..3082978,3083147..3083222,3083620..3083760,
FT                   3084624..3084753,3084994..3085126,3085729..3085865,
FT                   3086559..3086753,3087070..3087186,3088716..3089015,
FT                   3094379..3094486,3112985..>3113072))
FT                   /gene="Itfg3"
FT                   /locus_tag="mCG_1567"
FT                   /product="integrin alpha FG-GAP repeat containing 3,
FT                   transcript variant mCT191685"
FT                   /note="gene_id=mCG1567.2 transcript_id=mCT191685.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3081204..3082212,3082299..3082401,
FT                   3082823..3082978,3083147..3083222,3083620..3083760,
FT                   3084624..3084753,3084994..3085126,3085729..3085865,
FT                   3086559..3086753,3088716..3089015,3112985..3113185))
FT                   /gene="Itfg3"
FT                   /locus_tag="mCG_1567"
FT                   /product="integrin alpha FG-GAP repeat containing 3,
FT                   transcript variant mCT8392"
FT                   /note="gene_id=mCG1567.2 transcript_id=mCT8392.1 created on
FT                   04-JUN-2002"
FT   mRNA            complement(join(3081208..3082212,3082299..3082401,
FT                   3082823..3082978,3083147..3083222,3083620..3083760,
FT                   3084624..3084753,3084994..3085126,3085729..3085865,
FT                   3086559..3086753,3087070..3087186,3088716..3089015,
FT                   3112985..>3113122))
FT                   /gene="Itfg3"
FT                   /locus_tag="mCG_1567"
FT                   /product="integrin alpha FG-GAP repeat containing 3,
FT                   transcript variant mCT191686"
FT                   /note="gene_id=mCG1567.2 transcript_id=mCT191686.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3082001..3082212,3082299..3082401,
FT                   3082823..3082978,3083147..3083222,3083620..3083760,
FT                   3084624..3084753,3084994..3085126,3085729..3085865,
FT                   3086559..3086753,3087070..3087186,3088716..3089015,
FT                   3112985..>3113120))
FT                   /codon_start=1
FT                   /gene="Itfg3"
FT                   /locus_tag="mCG_1567"
FT                   /product="integrin alpha FG-GAP repeat containing 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1567.2 transcript_id=mCT191686.0
FT                   protein_id=mCP112641.0 isoform=CRA_b"
FT                   /protein_id="EDL22499.1"
FT                   /translation="TPVQPLSSREPWGCGSRIPGTAVEPASPVLYHLLRSRISRTGPRA
FT                   VATVKLWNVLRMMDNKDLEAEIHPLKNEDKKSQENPGNLPRNEDNLKSKPVPSRLSRCR
FT                   TVAFFLSLFTCLFVVFVLSFIIPCPDRPSSQGTWKLDYNNAVMYDFLALGDINKDKVQD
FT                   VLFLYKNTNSSNNLTRSCADEGFSTPCAFVVAVSGANGSVLWERPVAQDVALVKCAMPQ
FT                   TLDSDEVSSACIVVGRAGSFVAVSFFTGETLWSHPSSFSGNVSILSPLLQVPDIDGDGD
FT                   GTPDLLILAQEGQEVSGALYSGSTGYQIGHRGSLGVDGDGVALLHVTRTGAQYILLPCA
FT                   SALCGFSVKSLYERITGRDGHFKEDPYWENMLNHSVHRRLLHRLGAVRYLMNIPGKAGQ
FT                   DLLLVTSEACVLLDGQDLEPRWTLGEVQVLRKPILGHYKPDTLAVVIENGTSIDRQILL
FT                   LDLSTGSILWSQPLPSLPGGPPSTSLMTADHRSAFFFWGLHDLVSTNEMDPPDVQHSLY
FT                   MFHPTLPGILLELANVSANIVAFDAVLLEPSRHAAYVLLTGPASSDVPGLVSVTKHKVQ
FT                   DLVPGSRVIHLGEGSSDSDQAIRDRFSRLRYRSEM"
FT   CDS             complement(join(3082001..3082212,3082299..3082401,
FT                   3082823..3082978,3083147..3083222,3083620..3083760,
FT                   3084624..3084753,3084994..3085126,3085729..3085865,
FT                   3086559..3086753,3087070..3087186,3088716..3089015,
FT                   3094379..>3094406))
FT                   /codon_start=1
FT                   /gene="Itfg3"
FT                   /locus_tag="mCG_1567"
FT                   /product="integrin alpha FG-GAP repeat containing 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1567.2 transcript_id=mCT191685.0
FT                   protein_id=mCP112640.0 isoform=CRA_a"
FT                   /protein_id="EDL22498.1"
FT                   /translation="TPPQVLHRPVATVKLWNVLRMMDNKDLEAEIHPLKNEDKKSQENP
FT                   GNLPRNEDNLKSKPVPSRLSRCRTVAFFLSLFTCLFVVFVLSFIIPCPDRPSSQGTWKL
FT                   DYNNAVMYDFLALGDINKDKVQDVLFLYKNTNSSNNLTRSCADEGFSTPCAFVVAVSGA
FT                   NGSVLWERPVAQDVALVKCAMPQTLDSDEVSSACIVVGRAGSFVAVSFFTGETLWSHPS
FT                   SFSGNVSILSPLLQVPDIDGDGDGTPDLLILAQEGQEVSGALYSGSTGYQIGHRGSLGV
FT                   DGDGVALLHVTRTGAQYILLPCASALCGFSVKSLYERITGRDGHFKEDPYWENMLNHSV
FT                   HRRLLHRLGAVRYLMNIPGKAGQDLLLVTSEACVLLDGQDLEPRWTLGEVQVLRKPILG
FT                   HYKPDTLAVVIENGTSIDRQILLLDLSTGSILWSQPLPSLPGGPPSTSLMTADHRSAFF
FT                   FWGLHDLVSTNEMDPPDVQHSLYMFHPTLPGILLELANVSANIVAFDAVLLEPSRHAAY
FT                   VLLTGPASSDVPGLVSVTKHKVQDLVPGSRVIHLGEGSSDSDQAIRDRFSRLRYRSEM"
FT   CDS             complement(join(3082001..3082212,3082299..3082401,
FT                   3082823..3082978,3083147..3083222,3083620..3083760,
FT                   3084624..3084753,3084994..3085126,3085729..3085865,
FT                   3086559..3086753,3088716..3088983))
FT                   /codon_start=1
FT                   /gene="Itfg3"
FT                   /locus_tag="mCG_1567"
FT                   /product="integrin alpha FG-GAP repeat containing 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG1567.2 transcript_id=mCT8392.1
FT                   protein_id=mCP23286.2 isoform=CRA_c"
FT                   /protein_id="EDL22500.1"
FT                   /translation="MMDNKDLEAEIHPLKNEDKKSQENPGNLPRNEDNLKSKPVPSRLS
FT                   RCRTVAFFLSLFTCLFVVFVLSFIIPCPDRPSSQGTWKLDYNNAGFSTPCAFVVAVSGA
FT                   NGSVLWERPVAQDVALVKCAMPQTLDSDEVSSACIVVGRAGSFVAVSFFTGETLWSHPS
FT                   SFSGNVSILSPLLQVPDIDGDGDGTPDLLILAQEGQEVSGALYSGSTGYQIGHRGSLGV
FT                   DGDGVALLHVTRTGAQYILLPCASALCGFSVKSLYERITGRDGHFKEDPYWENMLNHSV
FT                   HRRLLHRLGAVRYLMNIPGKAGQDLLLVTSEACVLLDGQDLEPRWTLGEVQVLRKPILG
FT                   HYKPDTLAVVIENGTSIDRQILLLDLSTGSILWSQPLPSLPGGPPSTSLMTADHRSAFF
FT                   FWGLHDLVSTNEMDPPDVQHSLYMFHPTLPGILLELANVSANIVAFDAVLLEPSRHAAY
FT                   VLLTGPASSDVPGLVSVTKHKVQDLVPGSRVIHLGEGSSDSDQAIRDRFSRLRYRSEM"
FT   assembly_gap    3097449..3097468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3114997..3115016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3119684..3119899
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   gene            3121801..3151181
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /note="gene_id=mCG49994.1"
FT   mRNA            join(3121801..3121993,3123933..3124027,3127232..3127330,
FT                   3135855..3135965,3136787..3136930,3145096..3145272,
FT                   3146948..3147036,3148555..3148584,3149183..3149350,
FT                   3150839..3151181)
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /product="Luc7 homolog (S. cerevisiae)-like, transcript
FT                   variant mCT50177"
FT                   /note="gene_id=mCG49994.1 transcript_id=mCT50177.2 created
FT                   on 04-JUN-2002"
FT   mRNA            join(3121859..3121993,3123933..3124027,3127232..3127330,
FT                   3135855..3135965,3136787..3136930,3145096..3145272,
FT                   3146948..3147036,3148555..3148584,3149183..3149941)
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /product="Luc7 homolog (S. cerevisiae)-like, transcript
FT                   variant mCT169855"
FT                   /note="gene_id=mCG49994.1 transcript_id=mCT169855.0 created
FT                   on 04-JUN-2002"
FT   mRNA            join(<3121886..3121993,3122876..3124027,3127232..3127330,
FT                   3135855..3135965,3136787..3136930,3145096..3145272,
FT                   3146948..3147036,3148555..3148584,3149183..3149941)
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /product="Luc7 homolog (S. cerevisiae)-like, transcript
FT                   variant mCT191708"
FT                   /note="gene_id=mCG49994.1 transcript_id=mCT191708.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<3121893..3121993,3122876..3122946,3123933..3124027,
FT                   3127232..3127330,3135855..3135965,3136787..3136930,
FT                   3145096..3145272,3146948..3147036,3148555..3148584,
FT                   3149183..3149944)
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /product="Luc7 homolog (S. cerevisiae)-like, transcript
FT                   variant mCT191707"
FT                   /note="gene_id=mCG49994.1 transcript_id=mCT191707.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3121893..3121993,3122876..3122946,3123933..3124027,
FT                   3127232..3127330,3135855..3135965,3136787..3136930,
FT                   3145096..3145272,3146948..3147036,3148555..3148584,
FT                   3149183..3149354)
FT                   /codon_start=1
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /product="Luc7 homolog (S. cerevisiae)-like, isoform CRA_a"
FT                   /note="gene_id=mCG49994.1 transcript_id=mCT191707.0
FT                   protein_id=mCP112682.0 isoform=CRA_a"
FT                   /protein_id="EDL22501.1"
FT                   /translation="RVVRSFSAVPTGHHVRPGADAGPVGPAHGHGSGRFSVSLPAYINL
FT                   QGSCRKASCSSSRDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLAL
FT                   RADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKV
FT                   HELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQ
FT                   KLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRL
FT                   RRREEREREERLGRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKFSRSRSRDRYRRHR
FT                   SRSRSHSRGHRRASRDRSTKYK"
FT   CDS             join(3121933..3121993,3123933..3124027,3127232..3127330,
FT                   3135855..3135965,3136787..3136930,3145096..3145272,
FT                   3146948..3147036,3148555..3148584,3149183..3149350,
FT                   3150839..3150980)
FT                   /codon_start=1
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /product="Luc7 homolog (S. cerevisiae)-like, isoform CRA_d"
FT                   /note="gene_id=mCG49994.1 transcript_id=mCT50177.2
FT                   protein_id=mCP42863.2 isoform=CRA_d"
FT                   /protein_id="EDL22504.1"
FT                   /translation="MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCP
FT                   HDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELA
FT                   KKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVR
FT                   AKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIR
FT                   EKLDQLRKTVAEKQEKRNQDRLRRREEREREERLGRRSGSRTRDRRRSRSRDRRRRRSR
FT                   STSRERRKFSRSRSRDRYRRHRSRSRSHSRGHRRASRDRSTKYKFSRERSLREESWEYG
FT                   RNERGPTDWRLENSNGKTASRRSEEKEAGEI"
FT   CDS             join(3121933..3121993,3123933..3124027,3127232..3127330,
FT                   3135855..3135965,3136787..3136930,3145096..3145272,
FT                   3146948..3147036,3148555..3148584,3149183..3149354)
FT                   /codon_start=1
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /product="Luc7 homolog (S. cerevisiae)-like, isoform CRA_c"
FT                   /note="gene_id=mCG49994.1 transcript_id=mCT169855.0
FT                   protein_id=mCP92690.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A0R4J047"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="MGI:MGI:1914228"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J047"
FT                   /protein_id="EDL22503.1"
FT                   /translation="MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCP
FT                   HDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELA
FT                   KKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVR
FT                   AKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIR
FT                   EKLDQLRKTVAEKQEKRNQDRLRRREEREREERLGRRSGSRTRDRRRSRSRDRRRRRSR
FT                   STSRERRKFSRSRSRDRYRRHRSRSRSHSRGHRRASRDRSTKYK"
FT   CDS             join(<3123926..3124027,3127232..3127330,3135855..3135965,
FT                   3136787..3136930,3145096..3145272,3146948..3147036,
FT                   3148555..3148584,3149183..3149354)
FT                   /codon_start=1
FT                   /gene="Luc7l"
FT                   /locus_tag="mCG_49994"
FT                   /product="Luc7 homolog (S. cerevisiae)-like, isoform CRA_b"
FT                   /note="gene_id=mCG49994.1 transcript_id=mCT191708.0
FT                   protein_id=mCP112683.0 isoform=CRA_b"
FT                   /protein_id="EDL22502.1"
FT                   /translation="ISGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIH
FT                   DLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAK
FT                   AEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASS
FT                   FQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKRN
FT                   QDRLRRREEREREERLGRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKFSRSRSRDRY
FT                   RRHRSRSRSHSRGHRRASRDRSTKYK"
FT   gene            3138920..3140056
FT                   /pseudo
FT                   /locus_tag="mCG_1580"
FT                   /note="gene_id=mCG1580.0"
FT   mRNA            3138920..3140056
FT                   /pseudo
FT                   /locus_tag="mCG_1580"
FT                   /note="gene_id=mCG1580.0 transcript_id=mCT8406.0 created on
FT                   04-JUN-2002"
FT   assembly_gap    3142880..3143372
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   gene            complement(<3155599..>3156261)
FT                   /locus_tag="mCG_1565"
FT                   /note="gene_id=mCG1565.1"
FT   mRNA            complement(join(<3155599..3155712,3155860..3156064,
FT                   3156170..>3156261))
FT                   /locus_tag="mCG_1565"
FT                   /product="mCG1565"
FT                   /note="gene_id=mCG1565.1 transcript_id=mCT8389.1 created on
FT                   04-JUN-2002"
FT   CDS             complement(join(<3155599..3155712,3155860..3156064,
FT                   3156170..3156261))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1565"
FT                   /product="mCG1565"
FT                   /note="gene_id=mCG1565.1 transcript_id=mCT8389.1
FT                   protein_id=mCP23248.1"
FT                   /protein_id="EDL22505.1"
FT                   /translation="MVISQEDKANLRTIWDKIAGHSDYGAEAIGRLFESFPTTKTYFPH
FT                   FDVSQRSPQVQAHGKKVMDVLTDAVNHVNDLPDALSTLSDLHAHKLCVDPANFKLLSHC
FT                   LLVTLAIHHSADFTPAVHAFLDKFLASVSTMLS"
FT   assembly_gap    3160635..3160722
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    3161907..3161926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3165418..3165437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3166640..3166659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3185656..3186095
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    3192351..3192370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3194884..3194903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3216181..3216757
FT                   /estimated_length=577
FT                   /gap_type="unknown"
FT   assembly_gap    3223043..3223062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3227890..3228277
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    3241831..3241916
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    3245860..3246302
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    3250200..3250219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3251639..3251658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3281738..3282095
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   gene            <3299055..>3308999
FT                   /locus_tag="mCG_1576"
FT                   /note="gene_id=mCG1576.1"
FT   mRNA            join(<3299055..3299600,3305867..3306559,3308282..3308407,
FT                   3308797..>3308999)
FT                   /locus_tag="mCG_1576"
FT                   /product="mCG1576"
FT                   /note="gene_id=mCG1576.1 transcript_id=mCT8401.1 created on
FT                   04-JUN-2002"
FT   CDS             join(<3299057..3299600,3305867..3306559,3308282..3308407,
FT                   3308797..3308999)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1576"
FT                   /product="mCG1576"
FT                   /note="gene_id=mCG1576.1 transcript_id=mCT8401.1
FT                   protein_id=mCP23272.1"
FT                   /protein_id="EDL22506.1"
FT                   /translation="SSPPARLLATRPCYGPGPERRAVLGEAPRFHAQAKGKNVRLDGHS
FT                   RRATRRNSFCNGVTFTQRPIRLYEQVRLRLVAVRPGWSGALRFGFTAHDPSLMSAQDIP
FT                   KYACPDLVTRPGYWAKALPENLALRDTVLAYWADRHGRVFYSVNDGEPVLFHCGVAVGG
FT                   PLWALIDVYGITDEVQLLESTFADTLTPLRLGQARLSACPPPGSHDAANFDNNELENNQ
FT                   VVAKLGHLALGRPDAAVPCVARERARPASSPALLDAELRFHATRGPDVSLSADRRLACA
FT                   PRPDGGRTLVFSERPLRPGESLCVEVGRPGLAAPAAVAFGITSCDPGALRPSELPADPA
FT                   ALLDRKEYWVVARAGPVPSGGDALSFTLRPGGDVLLAVNGRPRGRLLCVDTSQALWAFF
FT                   AVRGGVAGQLRLLGTLQSSSETMTPSGSFSGSQDDSDSDMTFGVNQSSSASESSLAFSA
FT                   PEPTGSRNGECTVCFDSEVDTVIYTCGHMCLCHGCGLRLRRQARACCPICRRPIKDVIK
FT                   IYRP"
FT   assembly_gap    3312105..3312124
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<3360884..>3361279)
FT                   /locus_tag="mCG_1033976"
FT                   /note="gene_id=mCG1033976.0"
FT   mRNA            complement(join(<3360884..3361213,3361222..>3361279))
FT                   /locus_tag="mCG_1033976"
FT                   /product="mCG1033976"
FT                   /note="gene_id=mCG1033976.0 transcript_id=mCT151680.0
FT                   created on 04-JUN-2002"
FT   CDS             complement(<3360884..>3361060)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033976"
FT                   /product="mCG1033976"
FT                   /note="gene_id=mCG1033976.0 transcript_id=mCT151680.0
FT                   protein_id=mCP84800.0"
FT                   /protein_id="EDL22507.1"
FT                   /translation="LVFLVFSNNALPTSLSCGFFSFKYLLTQLLGAPRSSTPAWCMTMG
FT                   PRALLNKNPLAICS"
FT   gene            complement(3372701..3375574)
FT                   /gene="Dusp1"
FT                   /locus_tag="mCG_1582"
FT                   /note="gene_id=mCG1582.0"
FT   mRNA            complement(join(3372701..3373761,3374096..3374315,
FT                   3374685..3374830,3375068..3375574))
FT                   /gene="Dusp1"
FT                   /locus_tag="mCG_1582"
FT                   /product="dual specificity phosphatase 1"
FT                   /note="gene_id=mCG1582.0 transcript_id=mCT8408.0 created on
FT                   04-JUN-2002"
FT   CDS             complement(join(3373391..3373761,3374096..3374315,
FT                   3374685..3374830,3375068..3375434))
FT                   /codon_start=1
FT                   /gene="Dusp1"
FT                   /locus_tag="mCG_1582"
FT                   /product="dual specificity phosphatase 1"
FT                   /note="gene_id=mCG1582.0 transcript_id=mCT8408.0
FT                   protein_id=mCP23288.1"
FT                   /db_xref="GOA:Q3U8K3"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR008343"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020417"
FT                   /db_xref="InterPro:IPR020420"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:105120"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U8K3"
FT                   /protein_id="EDL22508.1"
FT                   /translation="MVMEVGILDAGGLRALLREGAAQCLLLDCRSFFAFNAGHIAGSVN
FT                   VRFSTIVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSASLDGAKRDGTLAL
FT                   AAGALCREARSTQVFFLQGGYEAFSASCPELCSKQSTPTGLSLPLSTSVPDSAESGCSS
FT                   CSTPLYDQGGPVEILSFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKS
FT                   IPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKL
FT                   DEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFN
FT                   FPVSIPVHPTNSALNYLKSPITTSPSC"
FT   assembly_gap    3375667..3375686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3407948..3407967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3410350..3411367
FT                   /locus_tag="mCG_50669"
FT                   /note="gene_id=mCG50669.1"
FT   mRNA            join(3410350..3410543,3410621..3411367)
FT                   /locus_tag="mCG_50669"
FT                   /product="mCG50669"
FT                   /note="gene_id=mCG50669.1 transcript_id=mCT50852.1 created
FT                   on 04-JUN-2002"
FT   CDS             join(3410367..3410543,3410621..3411322)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50669"
FT                   /product="mCG50669"
FT                   /note="gene_id=mCG50669.1 transcript_id=mCT50852.1
FT                   protein_id=mCP42878.2"
FT                   /protein_id="EDL22509.1"
FT                   /translation="MAVDSSAAGGPRGSGGPGLGGRVNFCGGLCSSLWGCSRGRGRDRG
FT                   RDRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEITDFFLGASLKD
FT                   EVLKIMPVQKQTRAGQRTRFKAFVVIGDYDGHVDLGVKCSKEVATAIRGAIILAKLSIV
FT                   PVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVPKKLLMASIDDCY
FT                   TSARGCTATLSNFAKATFYATSKTCSYLTPDLWKVTVFTQSPYQEFTDHLVKTHTRVSV
FT                   QRTQAPVVATT"
FT   assembly_gap    3416363..3416382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3429862..3527964
FT                   /gene="1200007D18Rik"
FT                   /locus_tag="mCG_1583"
FT                   /note="gene_id=mCG1583.2"
FT   mRNA            join(3429862..3429976,3479762..3479823,3485494..3485566,
FT                   3495618..3495712,3500587..3500711,3505450..3505554,
FT                   3507019..3507079,3509778..3509878,3512617..3512739,
FT                   3526102..3527964)
FT                   /gene="1200007D18Rik"
FT                   /locus_tag="mCG_1583"
FT                   /product="RIKEN cDNA 1200007D18"
FT                   /note="gene_id=mCG1583.2 transcript_id=mCT8409.2 created on
FT                   05-JUN-2002"
FT   CDS             join(3429957..3429976,3479762..3479823,3485494..3485566,
FT                   3495618..3495712,3500587..3500711,3505450..3505554,
FT                   3507019..3507079,3509778..3509878,3512617..3512739,
FT                   3526102..3526209)
FT                   /codon_start=1
FT                   /gene="1200007D18Rik"
FT                   /locus_tag="mCG_1583"
FT                   /product="RIKEN cDNA 1200007D18"
FT                   /note="gene_id=mCG1583.2 transcript_id=mCT8409.2
FT                   protein_id=mCP23215.2"
FT                   /db_xref="GOA:Q4FK22"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="MGI:MGI:1914708"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK22"
FT                   /protein_id="EDL22510.1"
FT                   /translation="MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELT
FT                   GFITTEVVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNS
FT                   MKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQPQNPDMTHTIHKLSFGDTLQVQN
FT                   VHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHT
FT                   GRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAW
FT                   KKIQLGKIH"
FT   assembly_gap    3448734..3448753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3456363..3456382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3547430..3570985
FT                   /gene="Atp6v0e"
FT                   /locus_tag="mCG_1572"
FT                   /note="gene_id=mCG1572.1"
FT   mRNA            join(3547430..3547614,3553714..3553761,3566700..3566829,
FT                   3570557..3570985)
FT                   /gene="Atp6v0e"
FT                   /locus_tag="mCG_1572"
FT                   /product="ATPase, H+ transporting, lysosomal V0 subunit E"
FT                   /note="gene_id=mCG1572.1 transcript_id=mCT8396.0 created on
FT                   05-JUN-2002"
FT   CDS             join(3547511..3547614,3553714..3553761,3566700..3566793)
FT                   /codon_start=1
FT                   /gene="Atp6v0e"
FT                   /locus_tag="mCG_1572"
FT                   /product="ATPase, H+ transporting, lysosomal V0 subunit E"
FT                   /note="gene_id=mCG1572.1 transcript_id=mCT8396.0
FT                   protein_id=mCP23264.1"
FT                   /protein_id="EDL22511.1"
FT                   /translation="MAYHGLTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCS
FT                   VCCYLFWLIAILAQLNPLFGPQLKNETIWYLKYHWP"
FT   assembly_gap    3561640..3561659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3586993..>3642733
FT                   /gene="A930001N09Rik"
FT                   /locus_tag="mCG_124194"
FT                   /note="gene_id=mCG124194.1"
FT   mRNA            join(3586993..3587117,3608163..3608330,3610890..3611015,
FT                   3613389..3614313,3629131..3629325,3631086..3631275,
FT                   3633564..3633637,3634652..3634774,3642618..>3642733)
FT                   /gene="A930001N09Rik"
FT                   /locus_tag="mCG_124194"
FT                   /product="RIKEN cDNA A930001N09"
FT                   /note="gene_id=mCG124194.1 transcript_id=mCT125432.1
FT                   created on 05-JUN-2002"
FT   CDS             join(3608322..3608330,3610890..3611015,3613389..3614313,
FT                   3629131..3629325,3631086..3631275,3633564..3633637,
FT                   3634652..3634774,3642618..3642733)
FT                   /codon_start=1
FT                   /gene="A930001N09Rik"
FT                   /locus_tag="mCG_124194"
FT                   /product="RIKEN cDNA A930001N09"
FT                   /note="gene_id=mCG124194.1 transcript_id=mCT125432.1
FT                   protein_id=mCP84724.1"
FT                   /protein_id="EDL22512.1"
FT                   /translation="MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYEL
FT                   DREMNYQQNPRDNFLSLEDCKDIENLETFTDVLDNEDALTSNWEQWDTYCEDLTKYTKL
FT                   TSCDIWGTKEVDYLGLDDFSSPYQDEEVISKTPTLAQLNSEDSQSVSDSLYYPDSLFSV
FT                   KQNPLPPSSFPSKKITNRAAAPVCSSKTLQAEVPSSDCVQKASKPTSSTQIMVKTNMYH
FT                   NEKVNFHVECKDYVKKAKVKINPVQQGRPLLSQVHIDAAKENTCYCGAVAKRQERRGVE
FT                   PHQGRGTPALPFKETQELLLSPLTQDSPGLVATAESGSLSASTSVSDSSQKKEEHNYSL
FT                   FVSDNMREQPTKYSYENDSVEDLKEMTSISSRKRGKRRYFWEYSEQLTPSQQERILRPS
FT                   EWNRDTLPSNMYQKNGLHHGKYAVKKSRRTDVEDLTPNPKKLLQIGNELRKLNKVISDL
FT                   TPVSELPLTARPRSRKEKNKLASRACRLKKKAQYEANKVKLWGLNTEYDNLLFVINSIK
FT                   QDIVNRVQNPREEREPSMGQKLEILIKDTLGLPVAGQTSEFVNQVLGKTAEGNPTGGLV
FT                   GLRIPASKV"
FT   assembly_gap    3623034..3623053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3652404..3663842
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /note="gene_id=mCG1570.1"
FT   mRNA            join(3652404..3652498,3654769..3654861,3658021..3658112,
FT                   3661013..3661162,3662244..3662362,3663259..3663842)
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /product="BCL2/adenovirus E1B interacting protein 1, NIP1,
FT                   transcript variant mCT8394"
FT                   /note="gene_id=mCG1570.1 transcript_id=mCT8394.1 created on
FT                   05-JUN-2002"
FT   mRNA            join(<3652405..3652498,3654769..3654861,3658021..3658112,
FT                   3661013..3661114,3662244..3662362,3663259..3663836)
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /product="BCL2/adenovirus E1B interacting protein 1, NIP1,
FT                   transcript variant mCT191731"
FT                   /note="gene_id=mCG1570.1 transcript_id=mCT191731.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3652406..3652498,3654769..3654861,3658021..3658112,
FT                   3661013..3661114,3662244..3662362,3663259..3663455)
FT                   /codon_start=1
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /product="BCL2/adenovirus E1B interacting protein 1, NIP1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG1570.1 transcript_id=mCT191731.0
FT                   protein_id=mCP112680.0 isoform=CRA_c"
FT                   /protein_id="EDL22515.1"
FT                   /translation="ISNMAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSELTE
FT                   LNTKVKEKFQQLKQRIQELEQSAREQDKESEKQLLLQEVENHKKQMLSNQTSWRKANLT
FT                   CKLAIDNLEKAELLQGGDSLRQRKTTKESLAQTSSSITESLMGISRMMSQQVQQSEEAM
FT                   QTLVSSSRTLLDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYI
FT                   VKKRLFPFL"
FT   CDS             join(3652415..3652498,3654769..3654861,3658021..3658112,
FT                   3661013..3661162,3662244..3662362,3663259..3663455)
FT                   /codon_start=1
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /product="BCL2/adenovirus E1B interacting protein 1, NIP1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG1570.1 transcript_id=mCT8394.1
FT                   protein_id=mCP23130.2 isoform=CRA_d"
FT                   /protein_id="EDL22516.1"
FT                   /translation="MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSELTELNT
FT                   KVKEKFQQLKQRIQELEQSAREQDKESEKQLLLQEVENHKKQMLSNQTSWRKANLTCKL
FT                   AIDNLEKAELLQGGDSLRQRYHLSVLLGLMSQYHGRKTTKESLAQTSSSITESLMGISR
FT                   MMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIF
FT                   LALALFLATVLYIVKKRLFPFL"
FT   mRNA            join(<3652443..3652498,3654769..3654861,3658021..3658112,
FT                   3661013..3661114,3661238..3661282,3662244..3662362,
FT                   3663259..>3663276)
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /product="BCL2/adenovirus E1B interacting protein 1, NIP1,
FT                   transcript variant mCT191729"
FT                   /note="gene_id=mCG1570.1 transcript_id=mCT191729.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<3652457..3652480,3653900..3653953,3654769..3654861,
FT                   3658021..3658112,3661013..3661114,3662244..3662362,
FT                   3663259..>3663395)
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /product="BCL2/adenovirus E1B interacting protein 1, NIP1,
FT                   transcript variant mCT191730"
FT                   /note="gene_id=mCG1570.1 transcript_id=mCT191730.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3654769..3654861,3658021..3658112,3661013..3661114,
FT                   3662244..3662362,3663259..>3663395)
FT                   /codon_start=1
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /product="BCL2/adenovirus E1B interacting protein 1, NIP1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1570.1 transcript_id=mCT191730.0
FT                   protein_id=mCP112679.0 isoform=CRA_b"
FT                   /protein_id="EDL22514.1"
FT                   /translation="DIRDCSGPLSELTELNTKVKEKFQQLKQRIQELEQSAREQDKESE
FT                   KQLLLQEVENHKKQMLSNQTSWRKANLTCKLAIDNLEKAELLQGGDSLRQRKTTKESLA
FT                   QTSSSITESLMGISRMMSQQVQQSEEAMQTLVSSSRTLLDANEEFKSMSGTIQLGRKLI
FT                   TKYNRRELTDKLLIFLAL"
FT   CDS             join(<3654822..3654861,3658021..3658112,3661013..3661114,
FT                   3661238..3661282,3662244..3662362,3663259..>3663276)
FT                   /codon_start=1
FT                   /gene="Bnip1"
FT                   /locus_tag="mCG_1570"
FT                   /product="BCL2/adenovirus E1B interacting protein 1, NIP1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1570.1 transcript_id=mCT191729.0
FT                   protein_id=mCP112678.0 isoform=CRA_a"
FT                   /protein_id="EDL22513.1"
FT                   /translation="GERKVPTVKTEDPGARTVSKGARQGVREAASTSGSGEPQKADAQQ
FT                   PDLMAKSQSYLQACHRQPGEGRTSARRRLLTAKSHTSQSGLKRAVTLQENHQREFGPDL
FT                   QLHHRESHGDQQDDVTAGATERGGYADSSQLLTDS"
FT   assembly_gap    3665263..3665456
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    3669582..3669601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3671846..3672395
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   assembly_gap    3679062..3679662
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    3702115..3703031
FT                   /estimated_length=917
FT                   /gap_type="unknown"
FT   assembly_gap    3706977..3706996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3710017..3712966)
FT                   /gene="Nkx2-5"
FT                   /locus_tag="mCG_1575"
FT                   /note="gene_id=mCG1575.1"
FT   mRNA            complement(join(3710017..3711000,3712376..3712966))
FT                   /gene="Nkx2-5"
FT                   /locus_tag="mCG_1575"
FT                   /product="NK2 transcription factor related, locus 5
FT                   (Drosophila)"
FT                   /note="gene_id=mCG1575.1 transcript_id=mCT8400.1 created on
FT                   05-JUN-2002"
FT   CDS             complement(join(3710375..3711000,3712376..3712706))
FT                   /codon_start=1
FT                   /gene="Nkx2-5"
FT                   /locus_tag="mCG_1575"
FT                   /product="NK2 transcription factor related, locus 5
FT                   (Drosophila)"
FT                   /note="gene_id=mCG1575.1 transcript_id=mCT8400.1
FT                   protein_id=mCP23273.2"
FT                   /db_xref="GOA:Q3UQU2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="InterPro:IPR033629"
FT                   /db_xref="MGI:MGI:97350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UQU2"
FT                   /protein_id="EDL22517.1"
FT                   /translation="MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASC
FT                   MLAAFKPEAYSGPEAAASGLAELRAEMGPAPSPPKCSPAFPAAPTFYPGAYGDPDPAKD
FT                   PRADKKELCALQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLS
FT                   APERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRD
FT                   GKPCLGDPAAYAPAYGVGLNAYGYNAYPYPSYGGAACSPGYSCAAYPAAPPAAQPPAAS
FT                   ANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW"
FT   gene            3732664..3769122
FT                   /locus_tag="mCG_62109"
FT                   /note="gene_id=mCG62109.1"
FT   mRNA            join(3732664..3732832,3756688..3756828,3768904..3769122)
FT                   /locus_tag="mCG_62109"
FT                   /product="mCG62109"
FT                   /note="gene_id=mCG62109.1 transcript_id=mCT62292.1 created
FT                   on 05-JUN-2002"
FT   assembly_gap    3739544..3739563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3742099..3742615
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    3748057..3748090
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   CDS             join(3756716..3756828,3768904..3768931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_62109"
FT                   /product="mCG62109"
FT                   /note="gene_id=mCG62109.1 transcript_id=mCT62292.1
FT                   protein_id=mCP42898.2"
FT                   /protein_id="EDL22518.1"
FT                   /translation="MRSRAQDDWNILCDPRTLLLFPELCPLTLLRLQQTGTRYFASVMH
FT                   K"
FT   assembly_gap    3782500..3782765
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   gene            <3788469..3803621
FT                   /locus_tag="mCG_21702"
FT                   /note="gene_id=mCG21702.1"
FT   mRNA            join(<3788469..3788509,3792271..3792310,3792399..3792498,
FT                   3793186..3793239,3794054..3794101,3794551..3794641,
FT                   3795348..3796131,3796781..3797071,3797165..3797238,
FT                   3797559..3797634,3803443..3803621)
FT                   /locus_tag="mCG_21702"
FT                   /product="mCG21702"
FT                   /note="gene_id=mCG21702.1 transcript_id=mCT20717.1 created
FT                   on 05-JUN-2002"
FT   assembly_gap    3791670..3791954
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   CDS             join(<3793202..3793239,3794054..3794101,3794551..3794641,
FT                   3795348..3796131,3796781..3796842)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21702"
FT                   /product="mCG21702"
FT                   /note="gene_id=mCG21702.1 transcript_id=mCT20717.1
FT                   protein_id=mCP23127.1"
FT                   /protein_id="EDL22519.1"
FT                   /translation="EDRTWWVLCCWYSAEEPEASSRCSCEAWHRERLLQELQGERLQLQ
FT                   EERSTLSTQLEEQERRFQATEAALSSSQEEVVCLRQKTEAQVTLLAEQGDRLYGLEMER
FT                   RRLHNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDRPTGLSLSRSDDR
FT                   RSTLTGAPAPTVRHDFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSG
FT                   KTFTMEGGPRGDPQLAGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLA
FT                   TGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKEASGGPAPFGSPEPGCGPHCPE
FT                   "
FT   assembly_gap    3794146..3794517
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   gene            3804671..3809341
FT                   /gene="Phf1"
FT                   /locus_tag="mCG_21691"
FT                   /note="gene_id=mCG21691.1"
FT   mRNA            join(3804671..3804873,3805533..3805707,3805793..3805874,
FT                   3805970..3806065,3806393..3806493,3806588..3806736,
FT                   3806879..3806974,3807089..3807157,3807258..3807381,
FT                   3807463..3807530,3807626..3807730,3807948..3808116,
FT                   3808207..3808301,3808490..3808570,3808716..3808983,
FT                   3809183..3809341)
FT                   /gene="Phf1"
FT                   /locus_tag="mCG_21691"
FT                   /product="PHD finger protein 1"
FT                   /note="gene_id=mCG21691.1 transcript_id=mCT20706.1 created
FT                   on 05-JUN-2002"
FT   CDS             join(3805549..3805707,3805793..3805874,3805970..3806065,
FT                   3806393..3806493,3806588..3806736,3806879..3806974,
FT                   3807089..3807157,3807258..3807381,3807463..3807530,
FT                   3807626..3807730,3807948..3808116,3808207..3808301,
FT                   3808490..3808570,3808716..3808983,3809183..3809242)
FT                   /codon_start=1
FT                   /gene="Phf1"
FT                   /locus_tag="mCG_21691"
FT                   /product="PHD finger protein 1"
FT                   /note="gene_id=mCG21691.1 transcript_id=mCT20706.1
FT                   protein_id=mCP23300.2"
FT                   /protein_id="EDL22520.1"
FT                   /translation="MAQLPRLSRLGAPSLWDPASPAPTSGPRPRLWEGQDVLARWTDGL
FT                   LYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVPGNRL
FT                   VSCEKCRHAYHQDCHVPRAPAPGEGEGASWVCRQCVFAIATKRGGALKKGPYARAMLGM
FT                   KLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLKMLQCRSCLQWFHEACTQCLSKP
FT                   LLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFT
FT                   SENWDSLLLGELSDTPKGERSSQLLSALNSHKDRFISGREIKKRKCLFGLHARTPPPVE
FT                   LLTGDGAPTSFPSGQGPGGGVSRPLGKRWRSEPEPLRRRQKGKVEELGPPTAAHSRHGS
FT                   REQRALQASVSPPPPSPNQSYEGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSG
FT                   DSEPPDRSPLGLHIGFPTDTPKSSPHSVTASSSSVPALTPGFSRHSPPSPLCRSLSPGT
FT                   GGGVRGGVSYLSRGDPVRVLARRVRPDGSVQYLVEWGTPNAPPLISFDVILLQLLR"
FT   assembly_gap    3807831..3807896
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    3808985..3809182
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   gene            complement(3809418..3810996)
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /note="gene_id=mCG124201.0"
FT   mRNA            complement(join(3809418..3809628,3809870..3809919,
FT                   3810024..3810069,3810179..3810238,3810336..3810544,
FT                   3810769..3810820,3810903..3810996))
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   transcript variant mCT125439"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT125439.0
FT                   created on 05-JUN-2002"
FT   mRNA            complement(join(3809424..3809628,3809870..3810238,
FT                   3810336..3810820,3810903..>3810973))
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   transcript variant mCT191646"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT191646.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3809425..3809628,3809870..3809919,
FT                   3810024..3810069,3810179..3810238,3810336..3810544,
FT                   3810903..>3810930))
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   transcript variant mCT191645"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT191645.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3809425..3809628,3809870..3809919,
FT                   3810024..3810238,3810336..3810544,3810769..>3810876))
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   transcript variant mCT191647"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT191647.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3809425..3809628,3809870..3809919,
FT                   3810024..3810069,3810179..3810233,3810336..>3810748))
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   transcript variant mCT191644"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT191644.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(3809502..3809628,3809870..3809919,
FT                   3810024..3810069,3810179..3810238,3810336..3810544,
FT                   3810903..>3810929))
FT                   /codon_start=1
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT191645.0
FT                   protein_id=mCP112616.0 isoform=CRA_b"
FT                   /protein_id="EDL22522.1"
FT                   /translation="CFRVTWLLQATLLLSFLWMPALLPVASRLLLLPRALLSMASGSPP
FT                   SQPPPASGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKG
FT                   KIEEDSEVLMMIKTQSSLVPALTEFVRSVHPYEVAEVIALPVEQGNPPYLHWVHQVTES
FT                   VSNSGTALP"
FT   CDS             complement(join(3809502..3809628,3809870..3809919,
FT                   3810024..3810069,3810179..3810238,3810336..3810544,
FT                   3810769..3810810))
FT                   /codon_start=1
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT125439.0
FT                   protein_id=mCP84584.1 isoform=CRA_e"
FT                   /protein_id="EDL22525.1"
FT                   /translation="MNWGRAPGVLLGGGATLLLSFLWMPALLPVASRLLLLPRALLSMA
FT                   SGSPPSQPPPASGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSI
FT                   YEWKGKIEEDSEVLMMIKTQSSLVPALTEFVRSVHPYEVAEVIALPVEQGNPPYLHWVH
FT                   QVTESVSNSGTALP"
FT   CDS             complement(join(3809502..3809628,3809870..3809919,
FT                   3810024..3810069,3810179..3810233,3810336..>3810567))
FT                   /codon_start=1
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT191644.0
FT                   protein_id=mCP112615.0 isoform=CRA_a"
FT                   /protein_id="EDL22521.1"
FT                   /translation="IRPPPCSRPLCSCRFFGCQRYCRWLPAFCCYPELCCQWLLEALRP
FT                   SPLRPRAPATFQDQSLQPLSLVPTKKSPRRSPVVEKRLAACVNLIPQITSIYEWKGKIE
FT                   EDSEVLMMIKTQSSLVPALTEFVRSVHPYEVAEVIALPVEQGNPPYLHWVHQVTESVSN
FT                   SGTALP"
FT   CDS             complement(join(3810026..3810238,3810336..3810544,
FT                   3810769..>3810874))
FT                   /codon_start=1
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT191647.0
FT                   protein_id=mCP112618.0 isoform=CRA_d"
FT                   /db_xref="MGI:MGI:1914925"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CVL5"
FT                   /protein_id="EDL22524.1"
FT                   /translation="GVLRPCNERPLISSFLYQRGLHELGAGARRLARRRGHSAPVVSLD
FT                   ASATAGGFPPSVATPSSAVNGFWKPSVPAPSGLGLRLRSRISLCSLCHLSQRKSRQGDR
FT                   QGSGREASGSLRQPHPADHIHVSCQLETEIYPEGLRAFSGRNLPFPRLCSLLSLTSSAM
FT                   NGKERSRKIVRC"
FT   CDS             complement(join(3810175..3810238,3810336..3810820,
FT                   3810903..>3810971))
FT                   /codon_start=1
FT                   /gene="Cuta"
FT                   /locus_tag="mCG_124201"
FT                   /product="cutA divalent cation tolerance homolog (E. coli),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG124201.0 transcript_id=mCT191646.0
FT                   protein_id=mCP112617.0 isoform=CRA_c"
FT                   /protein_id="EDL22523.1"
FT                   /translation="DSGKAGLLLSRGAHCFRVTWLLQRGLHELGAGARRLARRRGESGP
FT                   AFSGLEVSPSFCSGTEELSQVSFKFQGHFFFSSWCRKGSAEAWCLPQKAAQVQFPGAVV
FT                   GTLNPPSPLLQATLLLSFLWMPALLPVASRLLLLPRALLSMASGSPPSQPPPASGSGYV
FT                   PGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSM"
FT   assembly_gap    3811310..3811329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3812435..3812727
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   gene            3812799..>3842027
FT                   /locus_tag="mCG_21690"
FT                   /note="gene_id=mCG21690.2"
FT   mRNA            join(3812799..3812870,3816000..3816121,3818000..3818105,
FT                   3823839..3823930,3824307..3824428,3826311..3826464,
FT                   3826656..3826754,3828365..3828988,3829115..3829259,
FT                   3829459..3829603,3830991..3831227,3831314..3831515,
FT                   3831725..3831903,3832451..3832492,3832818..3833880,
FT                   3834296..3834469,3836209..3836420,3838265..3838355,
FT                   3841881..>3842027)
FT                   /locus_tag="mCG_21690"
FT                   /product="mCG21690"
FT                   /note="gene_id=mCG21690.2 transcript_id=mCT20277.2 created
FT                   on 05-JUN-2002"
FT   CDS             join(3812849..3812870,3816000..3816121,3818000..3818105,
FT                   3823839..3823930,3824307..3824428,3826311..3826464,
FT                   3826656..3826754,3828365..3828988,3829115..3829259,
FT                   3829459..3829603,3830991..3831227,3831314..3831515,
FT                   3831725..3831903,3832451..3832492,3832818..3833880,
FT                   3834296..3834469,3836209..3836420,3838265..3838355,
FT                   3841881..3842027)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21690"
FT                   /product="mCG21690"
FT                   /note="gene_id=mCG21690.2 transcript_id=mCT20277.2
FT                   protein_id=mCP23201.2"
FT                   /protein_id="EDL22526.1"
FT                   /translation="MSYAPFRDVRGPPMHRTQYVHSPYDRPGWNPRFCIISGNQLLMLD
FT                   EDEIHPLLIRDRRSESSRNKLLRRTVSVPVEGRPHGEHEYHLGRSRRKSVPGGKQYSME
FT                   AAPAAPFRPSQGFLSRRLKSSIKRTKSQPKLDRTSSFRQILPRFRSADHDRARLMQSFK
FT                   ESHSHESLLSPSSAAEALELNLDEDSIIKPVHSSILGQEFCFEVTTSSGTKCFACRSAA
FT                   ERDKWIENLQRAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTS
FT                   KPRSASGDTVFWGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGYVGLVTVPVATLAG
FT                   RHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQTMSILPM
FT                   ELYKEFAEYVTNHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEV
FT                   DRFMEREHLIFRENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCT
FT                   ASSLAEHQANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISA
FT                   SLFLRFLCPAIMSPSLFGLMQEYPDEQTSRTLTLIAKVIQNLANFSKFTSKEDFLGFMN
FT                   EFLELEWGSMQQFLYEISNLDTLTNSSSFEGYIDLGRELSTLHALLWEVLPQLSKEALL
FT                   KLGPLPRLLNDISTALRNPNIQRQPSRQSERTRSQPMVLRGPSAEMQGYMMRDLNSSID
FT                   LQSFMARGLNSSMDMARLPSPTKEKPPPPPPGGGKDLFYVSRPPLARSSPAYCTSSSDI
FT                   TEPEQKMLSVNKSVSMLDLQGDGPGGRLNSSSVSNLAAVGDLLHSSQASLTAALGLRPA
FT                   PAGRLSQGSGSSITAAGMRLSQMGVTTDGVPAQQLRIPLSFQNPLFHMAADGPGPPAGH
FT                   GGSSGHGPPSSHHHHHHHHHHRGGEPPGDTFAPFHGYSKSEDLSSGVPKPPAASILHSH
FT                   SYSDEFGPSGTDFTRRQLSLQDSLQHMLSPPQITIGPQRPAPSGPGGGSGGGSGGGQPP
FT                   PLQRGKSQQLTVSAAQKPRPSSGNLLQSPEPSYGPARPRQQSLSKEGSIGGSGGSGGGG
FT                   GGGLKPSITKQHSQTPSTLNPTMPASERTVAWVSNMPHLSADIESAHIEREEYKLKEYS
FT                   KSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQ
FT                   SEKRLRQQQVEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPL
FT                   GPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH"
FT   assembly_gap    3819420..3820043
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    3820803..3820935
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    3825118..3825282
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            3844547..3847587
FT                   /gene="Zbtb9"
FT                   /locus_tag="mCG_21701"
FT                   /note="gene_id=mCG21701.1"
FT   mRNA            join(3844547..3844697,3844939..3847587)
FT                   /gene="Zbtb9"
FT                   /locus_tag="mCG_21701"
FT                   /product="zinc finger and BTB domain containing 9"
FT                   /note="gene_id=mCG21701.1 transcript_id=mCT20716.1 created
FT                   on 05-JUN-2002"
FT   CDS             3845006..3846385
FT                   /codon_start=1
FT                   /gene="Zbtb9"
FT                   /locus_tag="mCG_21701"
FT                   /product="zinc finger and BTB domain containing 9"
FT                   /note="gene_id=mCG21701.1 transcript_id=mCT20716.1
FT                   protein_id=mCP23295.1"
FT                   /protein_id="EDL22527.1"
FT                   /translation="MDASTPLPPASSSPRCNPAPQTIHIEFPHHSSSLLESLNRHRLEG
FT                   KFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPNVIEADAFEGLLQLIY
FT                   SGSLHLPLDALPAHLLVASGLQMWQVVDRCSEILRELETSGGISAGGRASSLTLISTTS
FT                   SGGWCIRSSPFQNPVRSSASTENSVLPESPAGGEGSELEGMLQIQVKVEEEEEQGSAAP
FT                   LFQTPQPERVSGGVSQACGSHPLPTPALPSKPSEDESSTVDPPAPPVQASQILYVNQEN
FT                   VECKEEIARGTKEKTKVLSGEDSEEKEELRYLLSSGGGESSGAGDPSWKPVDLHGNEIL
FT                   SGDGGPGGTGQAMHGPVKLGGTPPADGKCFACLCGKRFAVKPKRDRHIMLTFSLRPFGC
FT                   GICNKRFKLKHHLTEHMKTHARALHACPHCGRRFRVQAFFLRHRDLCKGQGWPTYHWTY
FT                   K"
FT   assembly_gap    3878826..3878845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3881423..3881446
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3886360..3886926
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    3890035..3890361
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   gene            complement(3890994..3899786)
FT                   /gene="Bak1"
FT                   /locus_tag="mCG_124181"
FT                   /note="gene_id=mCG124181.0"
FT   mRNA            complement(join(3890994..3892048,3892492..3892538,
FT                   3893622..3893765,3893925..3894060,3896958..3897058,
FT                   3899570..3899786))
FT                   /gene="Bak1"
FT                   /locus_tag="mCG_124181"
FT                   /product="BCL2-antagonist/killer 1"
FT                   /note="gene_id=mCG124181.0 transcript_id=mCT125419.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(3891990..3892048,3892492..3892538,
FT                   3893622..3893765,3893925..3894060,3896958..3897021))
FT                   /codon_start=1
FT                   /gene="Bak1"
FT                   /locus_tag="mCG_124181"
FT                   /product="BCL2-antagonist/killer 1"
FT                   /note="gene_id=mCG124181.0 transcript_id=mCT125419.0
FT                   protein_id=mCP84804.1"
FT                   /protein_id="EDL22528.1"
FT                   /translation="MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQ
FT                   ETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGN
FT                   AYELFTKIASSLFKSGIKLGPRGGSPDPLPPTPTVLSFLPRAKTL"
FT   assembly_gap    3892246..3892491
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    3900092..3900339
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   gene            3900340..3907457
FT                   /gene="Ggnbp1"
FT                   /locus_tag="mCG_21699"
FT                   /note="gene_id=mCG21699.2"
FT   mRNA            join(3900340..3901019,3901749..3901873,3903636..3903730,
FT                   3903834..3904044,3905845..3905984,3907195..3907457)
FT                   /gene="Ggnbp1"
FT                   /locus_tag="mCG_21699"
FT                   /product="gametogenetin binding protein 1"
FT                   /note="gene_id=mCG21699.2 transcript_id=mCT20714.2 created
FT                   on 26-AUG-2002"
FT   CDS             join(3900532..3901019,3901749..3901873,3903636..3903730,
FT                   3903834..3904044,3905845..3905984,3907195..3907248)
FT                   /codon_start=1
FT                   /gene="Ggnbp1"
FT                   /locus_tag="mCG_21699"
FT                   /product="gametogenetin binding protein 1"
FT                   /note="gene_id=mCG21699.2 transcript_id=mCT20714.2
FT                   protein_id=mCP23176.1"
FT                   /db_xref="GOA:Q6K1E7"
FT                   /db_xref="InterPro:IPR026670"
FT                   /db_xref="InterPro:IPR028135"
FT                   /db_xref="MGI:MGI:3055306"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6K1E7"
FT                   /protein_id="EDL22529.1"
FT                   /translation="MAAPARTPRSRILGCSSMLRFLRNLVGSKGGSKSTNKPLTRSQPS
FT                   SSWEQDVVSPMMGHQGGRGRKEPRAKVHSAASSNGKREPPPRVLSAAPSNPRHDAFELG
FT                   TGDSGSQTLTSKDVPKLRAQGVEVTSVPLRGTWEVLEQLPEKKGEEEEPVGEVSGASDR
FT                   EHFGQALETEQGCLQWVPGPLALTPGAFIKEEEDEHCPIEFGDLKPSSCKVGSTPWNYL
FT                   LGLYKQLQKSAMAKAQRPAAPQLALKDGLPHEEKGEREEAVDESCPKWCAPRASSDESC
FT                   PKWCAPRASTYQSPLQKKFRSTDTVGFVESELKKILSVQREARLWKVGNPEGRELLTQP
FT                   DITLEEAGMVDGQHLLLEEMDEMGNWPPPD"
FT   assembly_gap    3904503..3904552
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    3910722..3910795
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    3912230..3912249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3915127..3915209
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            complement(3919474..>3922745)
FT                   /locus_tag="mCG_1033981"
FT                   /note="gene_id=mCG1033981.0"
FT   mRNA            complement(join(3919474..3919949,3922571..>3922745))
FT                   /locus_tag="mCG_1033981"
FT                   /product="mCG1033981"
FT                   /note="gene_id=mCG1033981.0 transcript_id=mCT151685.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(3919765..3919949,3922571..3922745))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033981"
FT                   /product="mCG1033981"
FT                   /note="gene_id=mCG1033981.0 transcript_id=mCT151685.0
FT                   protein_id=mCP84518.0"
FT                   /protein_id="EDL22530.1"
FT                   /translation="MEIHAQCLENPRAETRLAFSVPHALIEVSISSRRWVTTYPIHRNS
FT                   EDRTTSCGSRNIRGAEQTLGPLSWGSGGGLGPDGEQPASSSHTPVQLPGLHEKNRDFPA
FT                   RPGEVRPDPSQTREL"
FT   assembly_gap    3922850..3922896
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   gene            3928459..3993231
FT                   /gene="Itpr3"
FT                   /locus_tag="mCG_21681"
FT                   /note="gene_id=mCG21681.1"
FT   mRNA            join(3928459..3928835,3944160..3944230,3954585..3954706,
FT                   3956151..3956237,3957902..3958060,3958209..3958307,
FT                   3958654..3958737,3960014..3960160,3960325..3960420,
FT                   3960683..3960733,3960897..3961039,3962386..3962485,
FT                   3962568..3962728,3962889..3963030,3964110..3964271,
FT                   3965720..3965892,3966389..3966508,3966953..3967135,
FT                   3969011..3969274,3969375..3969519,3970016..3970157,
FT                   3970642..3970847,3972141..3972270,3972619..3972676,
FT                   3973803..3973968,3974922..3975086,3975163..3975237,
FT                   3975614..3975739,3976588..3976710,3977304..3977504,
FT                   3978341..3978592,3978721..3978846,3978928..3979053,
FT                   3981607..3981727,3981958..3982148,3982325..3982473,
FT                   3982733..3983043,3984508..3984942,3985097..3985297,
FT                   3985412..3985522,3985864..3985980,3986045..3986146,
FT                   3986232..3986318,3986690..3986800,3986903..3987095,
FT                   3987189..3987314,3987626..3987798,3988183..3988347,
FT                   3988750..3988969,3989374..3989478,3989562..3989689,
FT                   3990232..3990397,3990885..3991045,3991948..3992109,
FT                   3992477..3993231)
FT                   /gene="Itpr3"
FT                   /locus_tag="mCG_21681"
FT                   /product="inositol 1,4,5-triphosphate receptor 3"
FT                   /note="gene_id=mCG21681.1 transcript_id=mCT20268.2 created
FT                   on 05-JUN-2002"
FT   CDS             join(3928747..3928835,3944160..3944230,3954585..3954706,
FT                   3956151..3956237,3957902..3958060,3958209..3958307,
FT                   3958654..3958737,3960014..3960160,3960325..3960420,
FT                   3960683..3960733,3960897..3961039,3962386..3962485,
FT                   3962568..3962728,3962889..3963030,3964110..3964271,
FT                   3965720..3965892,3966389..3966508,3966953..3967135,
FT                   3969011..3969274,3969375..3969519,3970016..3970157,
FT                   3970642..3970847,3972141..3972270,3972619..3972676,
FT                   3973803..3973968,3974922..3975086,3975163..3975237,
FT                   3975614..3975739,3976588..3976710,3977304..3977504,
FT                   3978341..3978592,3978721..3978846,3978928..3979053,
FT                   3981607..3981727,3981958..3982148,3982325..3982473,
FT                   3982733..3982952)
FT                   /codon_start=1
FT                   /gene="Itpr3"
FT                   /locus_tag="mCG_21681"
FT                   /product="inositol 1,4,5-triphosphate receptor 3"
FT                   /note="gene_id=mCG21681.1 transcript_id=mCT20268.2
FT                   protein_id=mCP23301.2"
FT                   /protein_id="EDL22531.1"
FT                   /translation="MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDL
FT                   DNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQN
FT                   DTENKKVHGDVVKYGSVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLF
FT                   IQPFWKLRSNGDNVVVGDKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKIN
FT                   LFMQFRDHLEEVLKGGDVVRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNA
FT                   LWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEENPSYKGDVSDPKAAGPGAQGR
FT                   TGRRNAGEKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQ
FT                   STNAPIDVEEERPIRLMLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEK
FT                   LNEGFISQNDRRFVIQLLEDLVFFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQ
FT                   IFGILKAPFRDKGGEGPLVRLEELSDQKNAPYQYMFRLCYRVLRHSQEDYRKNQEHIAK
FT                   QFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLS
FT                   DLCVSNRIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWL
FT                   TWTDRNNEHHEKSVRQLAQEARAGNAHDENVLSYYRATYRYQLKLFARMCLDRQYLAID
FT                   EISKQLGVELLFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPT
FT                   AITIKDYDSNLNSSRDDKKNKFASTMEFVEDYLNNVVSEAVPFANDEKNILTFEVVSLA
FT                   HNLIYFGFYSFSELLRLTRTLLGIIDCIQAPAAMLQAYEEPGGKNVRRSIQGVGHMMST
FT                   MVLSRKQSVFGASSLPAGVGVPEQLDRSKFEDNEHTVVMETKLKILEILQVLFILNVRL
FT                   DYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSSTATMNLDRIGEQAEAMFGVGKTS
FT                   SMLEVDDEGGRMFLRVLLHLTMHDYPSLVSGALQLLFKHFSQRQEAMHTFKQVQLLISA
FT                   QDVENYKVIKSELDRLRTMVEKSELWVDKKGSVKGEEVEAGATKDKKERPSDEEGFLQP
FT                   HGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKSDN
FT                   KMLEILRYTHQFLQKFCAGNPGNQALLHKHLQLFLTPGLLEAETMQHIFLNNYQLCSEI
FT                   SEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGDDVVVFYN
FT                   DKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDV
FT                   VTVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLDMALVCNKR
FT                   EKRLSDPTLEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLECPWL
FT                   QQQHKGSVEACVRTLAMVAKSRAILLPMDLDAHMSALLSSGGSCSAAAQRSAANYKTAT
FT                   RTFPRVIPTANQWDYKNIIEKLQDIIMALEERLKPLVQAELSVLVDMLHWPELLFPEGS
FT                   EAYQRCESGGFLSNLAPGASSLTPRALVSATAPPHPIPPCPAPHGWLLLQTAVSHPSFS
FT                   PRPGSGLVSHRRHPVPAGQGGGHQAGV"
FT   assembly_gap    3932729..3932929
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    3950272..3950332
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    3952193..3952558
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    3966780..3966799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3974468..3974556
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    3980337..3980676
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    3982538..3982715
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            complement(3993664..>4004863)
FT                   /locus_tag="mCG_140509"
FT                   /note="gene_id=mCG140509.0"
FT   mRNA            complement(join(3993664..3993839,3996144..3996213,
FT                   3996881..3996955,4004726..>4004863))
FT                   /locus_tag="mCG_140509"
FT                   /product="mCG140509"
FT                   /note="gene_id=mCG140509.0 transcript_id=mCT169854.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(3993712..3993839,3996144..3996213,
FT                   3996881..3996955,4004726..4004863))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140509"
FT                   /product="mCG140509"
FT                   /note="gene_id=mCG140509.0 transcript_id=mCT169854.0
FT                   protein_id=mCP92671.0"
FT                   /protein_id="EDL22532.1"
FT                   /translation="MAALRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENT
FT                   QIAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSVEEYKLILSTDTLEEFQEMN
FT                   KSMWKKLQEKFAPTRPEEKHKAWTRVLSRPRT"
FT   gene            complement(4014856..>4038150)
FT                   /gene="Ihpk3"
FT                   /locus_tag="mCG_21683"
FT                   /note="gene_id=mCG21683.2"
FT   mRNA            complement(join(4014856..4016207,4019539..4019714,
FT                   4020987..4021162,4022112..4022310,4028587..4028863,
FT                   4038025..>4038150))
FT                   /gene="Ihpk3"
FT                   /locus_tag="mCG_21683"
FT                   /product="inositol hexaphosphate kinase 3, transcript
FT                   variant mCT191723"
FT                   /note="gene_id=mCG21683.2 transcript_id=mCT191723.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(4015182..4016207,4019539..4019723,
FT                   4020987..4021162,4022112..4022310,4028587..4028863,
FT                   4038025..4038099))
FT                   /gene="Ihpk3"
FT                   /locus_tag="mCG_21683"
FT                   /product="inositol hexaphosphate kinase 3, transcript
FT                   variant mCT20270"
FT                   /note="gene_id=mCG21683.2 transcript_id=mCT20270.1 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(4015767..4016207,4019539..4019714,
FT                   4020987..4021162,4022112..4022310,4028587..4028863,
FT                   4038025..>4038150))
FT                   /codon_start=1
FT                   /gene="Ihpk3"
FT                   /locus_tag="mCG_21683"
FT                   /product="inositol hexaphosphate kinase 3, isoform CRA_a"
FT                   /note="gene_id=mCG21683.2 transcript_id=mCT191723.0
FT                   protein_id=mCP112681.0 isoform=CRA_a"
FT                   /protein_id="EDL22533.1"
FT                   /translation="HPGPSGRTELGQTFSCACRQRRALRDKSPYCTLPDTPQKEALRSQ
FT                   LPDNPPGGDSSFSLLPSLGGLGAMVVRHSSDKGKIGVGVPLEPFLHQVGGHLSVLQYDA
FT                   YTVCKPLVSQEQKFYESLPLAMRCFTPKYKGTITVRLRRDSRGHLGLVANPLKENLEPF
FT                   QVSPESRAVALWQTLQQTTGSESSPCPLTQLARSLKESAAKVLLRSDCHLSTQASPLVE
FT                   SEDGSQVERKGFNPWGLHCHQAHLTRLCSQYPEDKRHRFLLLENVVSQYKQPCILDLKM
FT                   GTRQHGDDASEEKKARHMKKCAQSTSACLGVRICGMQVYQTDQKSFLCKDKYYGRKLSV
FT                   EGFRQALSQFLHDGTRLRAELLEPILRRLQALLTVIRSQSSYRFYSSSVLIIYDGEPPQ
FT                   TTQGSTSGGVTSGDPAKVDVRMIDFAHTTFKGSWNEHTTYEGPDPGYIFGLENLIGILR
FT                   DIQEGE"
FT   CDS             complement(join(4015767..4016207,4019539..4019723,
FT                   4020987..4021162,4022112..4022310,4028587..4028785))
FT                   /codon_start=1
FT                   /gene="Ihpk3"
FT                   /locus_tag="mCG_21683"
FT                   /product="inositol hexaphosphate kinase 3, isoform CRA_b"
FT                   /note="gene_id=mCG21683.2 transcript_id=mCT20270.1
FT                   protein_id=mCP23175.2 isoform=CRA_b"
FT                   /protein_id="EDL22534.1"
FT                   /translation="MVVRHSSDKGKIGVGVPLEPFLHQVGGHLSVLQYDAYTVCKPLVS
FT                   QEQKFYESLPLAMRCFTPKYKGTITVRLRRDSRGHLGLVANPLKENLEPFQVSPESRAV
FT                   ALWQTLQQTTGSESSPCPLTQLARSLKESAAKVLLRSDCHLSTQASPLVESEDGSQVER
FT                   KGFNPWGLHCHQAHLTRLCSQYPEDKRHPHPGFLLLENVVSQYKQPCILDLKMGTRQHG
FT                   DDASEEKKARHMKKCAQSTSACLGVRICGMQVYQTDQKSFLCKDKYYGRKLSVEGFRQA
FT                   LSQFLHDGTRLRAELLEPILRRLQALLTVIRSQSSYRFYSSSVLIIYDGEPPQTTQGST
FT                   SGGVTSGDPAKVDVRMIDFAHTTFKGSWNEHTTYEGPDPGYIFGLENLIGILRDIQEGE
FT                   "
FT   assembly_gap    4019277..4019296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4035853..4035872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4048605..4048624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4060191..4074551)
FT                   /gene="Lemd2"
FT                   /locus_tag="mCG_21698"
FT                   /note="gene_id=mCG21698.2"
FT   mRNA            complement(join(4060191..4061382,4063524..4063626,
FT                   4063695..4063796,4064430..4064575,4065917..4065996,
FT                   4066728..4066804,4069955..4070030,4072229..4072269,
FT                   4074256..4074551))
FT                   /gene="Lemd2"
FT                   /locus_tag="mCG_21698"
FT                   /product="LEM domain containing 2"
FT                   /note="gene_id=mCG21698.2 transcript_id=mCT20712.2 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(4061232..4061382,4063524..4063626,
FT                   4063695..4063796,4064430..4064575,4065917..4065996,
FT                   4066728..4066804,4069955..4070030,4072229..4072269,
FT                   4074256..4074295))
FT                   /codon_start=1
FT                   /gene="Lemd2"
FT                   /locus_tag="mCG_21698"
FT                   /product="LEM domain containing 2"
FT                   /note="gene_id=mCG21698.2 transcript_id=mCT20712.2
FT                   protein_id=mCP23262.2"
FT                   /protein_id="EDL22535.1"
FT                   /translation="MGKPSAPQEAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELY
FT                   NFLAIQAGNFECGNPEKLKSKCIPVLEAQEYIANVTSSPSSRFKAALTWILSSNKDVGI
FT                   WLKGEDPSELATTVDKVVCLESARPRMGIGCRLSRALLTAVTHVLIFFWCLAFLWGLLI
FT                   LLKYRWRKLEEEEQAMYEMVKKIIDVVQDHYVDWEQDMERYPYVGILHVRDSLIPPQSR
FT                   RRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSER"
FT   assembly_gap    4074552..4074838
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    4089141..4089184
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    4102300..4102542
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   gene            complement(4106221..>4118957)
FT                   /locus_tag="mCG_120576"
FT                   /note="gene_id=mCG120576.1"
FT   mRNA            complement(join(4106221..4106379,4107793..4108001,
FT                   4113472..>4113523))
FT                   /locus_tag="mCG_120576"
FT                   /product="mCG120576, transcript variant mCT121767"
FT                   /note="gene_id=mCG120576.1 transcript_id=mCT121767.1
FT                   created on 05-JUN-2002"
FT   mRNA            complement(join(<4107476..4108001,4113472..>4113557))
FT                   /locus_tag="mCG_120576"
FT                   /product="mCG120576, transcript variant mCT169844"
FT                   /note="gene_id=mCG120576.1 transcript_id=mCT169844.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(<4107476..>4107767)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120576"
FT                   /product="mCG120576, isoform CRA_a"
FT                   /note="gene_id=mCG120576.1 transcript_id=mCT169844.0
FT                   protein_id=mCP92676.0 isoform=CRA_a"
FT                   /protein_id="EDL22536.1"
FT                   /translation="HPHSTTPPHTLSSRLPGASAHCSVSLYLKLLKEFRIVTDALTKHQ
FT                   AGATDPSCQTRLMFFKIVLNGEFQKQRNGAGEVTSGLKADPVLAEGLNSVPS"
FT   CDS             complement(join(4107837..4108001,4113472..>4113522))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120576"
FT                   /product="mCG120576, isoform CRA_b"
FT                   /note="gene_id=mCG120576.1 transcript_id=mCT121767.1
FT                   protein_id=mCP84779.1 isoform=CRA_b"
FT                   /protein_id="EDL22537.1"
FT                   /translation="CRAQPRELRPHPTSPHQEPNRDELKPSASSARPALKGPKRAALLS
FT                   SLFPKPEERVSPANGTRQVELDHRLK"
FT   mRNA            complement(join(<4107861..4108001,4110288..4110451,
FT                   4118604..>4118957))
FT                   /locus_tag="mCG_120576"
FT                   /product="mCG120576, transcript variant mCT169845"
FT                   /note="gene_id=mCG120576.1 transcript_id=mCT169845.0
FT                   created on 05-JUN-2002"
FT   CDS             complement(join(<4107861..4108001,4110288..4110451,
FT                   4118604..>4118622))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120576"
FT                   /product="mCG120576, isoform CRA_c"
FT                   /note="gene_id=mCG120576.1 transcript_id=mCT169845.0
FT                   protein_id=mCP92678.0 isoform=CRA_c"
FT                   /protein_id="EDL22538.1"
FT                   /translation="LLAGKALIGGQTREIKGGKKKNPQSSIGQLQLLQLKCPGKAQITL
FT                   DQQGPIGRWNTETGKAEPNRDELKPSASSARPALKGPKRAALLSSLFPKPEERVSPANG
FT                   TRQV"
FT   assembly_gap    4123523..4126774
FT                   /estimated_length=3252
FT                   /gap_type="unknown"
FT   assembly_gap    4131803..4131822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4137337..4137782
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    4168579..4169038
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    4202918..4203260
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    4204110..4210842
FT                   /estimated_length=6733
FT                   /gap_type="unknown"
FT   assembly_gap    4226499..4226531
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    4240051..4240136
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    4291191..4292464
FT                   /estimated_length=1274
FT                   /gap_type="unknown"
FT   assembly_gap    4293641..4293660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4295798..4295817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4297226..4297245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4298774..4298793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4301794..4301813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4304175..4304194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4305589..4305608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4307691..4307710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4309065..4309084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4310709..4310728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4316914..4399630)
FT                   /gene="Grm4"
FT                   /locus_tag="mCG_21686"
FT                   /note="gene_id=mCG21686.2"
FT   mRNA            complement(join(4316914..4317846,4322341..4322587,
FT                   4325545..4326480,4329315..4329451,4329681..4329881,
FT                   4341216..4341356,4342996..4343150,4345579..4345714,
FT                   4359517..4359733,4389451..4390337,4399593..4399630))
FT                   /gene="Grm4"
FT                   /locus_tag="mCG_21686"
FT                   /product="glutamate receptor, metabotropic 4"
FT                   /note="gene_id=mCG21686.2 transcript_id=mCT20275.1 created
FT                   on 17-APR-2003"
FT   CDS             complement(join(4317797..4317846,4322341..4322587,
FT                   4325545..4326480,4329315..4329451,4329681..4329881,
FT                   4341216..4341356,4342996..4343150,4345579..4345714,
FT                   4359517..4359733,4389451..4389969))
FT                   /codon_start=1
FT                   /gene="Grm4"
FT                   /locus_tag="mCG_21686"
FT                   /product="glutamate receptor, metabotropic 4"
FT                   /note="gene_id=mCG21686.2 transcript_id=mCT20275.1
FT                   protein_id=mCP23178.0"
FT                   /db_xref="GOA:G3XA00"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001786"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351341"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA00"
FT                   /protein_id="EDL22539.1"
FT                   /translation="MSGKGGWAWWWARLPLCLLLSLYGSWVPSSLGKPKGHPHMNSIRI
FT                   DGDITLGGLFPVHGRGSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGAR
FT                   ILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSI
FT                   MVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVS
FT                   TLASEGSYGESGVEAFIQKSRENGGVCIAQSVKIPREPKTGEFDKIIKRLLETSNARAI
FT                   IIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKSAPVLRLEEVAEGAVTILPKRTS
FT                   VRGFDRYFSSRTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHIKKCTNRERIGQDSA
FT                   YEQEGKVQFVIDAVYAMGHALHAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGI
FT                   AGNPVTFNENGDAPGRYDIYQYQRRNGSAEYKVIGSWTDHLHLRIERMQWPGSGQQLPR
FT                   SICSLPCQPGERKKTVKGMACCWHCEPCTGYQYQVDRYTCKTCPYDMRPTENRTSCQPI
FT                   PIVKLEWDSPWAVLPLFLAVVGIAATLFVVVTFVRYNDTPIVKASGRELSYVLLAGIFL
FT                   CYATTFLMIAEPDLGTCSLRRIFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFI
FT                   SPASQLAITFVLISLQLLGICVWFVVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLSL
FT                   ICLLGYSMLLMVTCTVYAIKTRGVPETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSA
FT                   DKLYIQTTTLTVSVSLSASVSLGMLYMPKVYIILFHPEQNVPKRKRSLKAVVTAATMSN
FT                   KFTQKGNFRPNGEAKSELCENLEAPALATKQTYVTYTNHAI"
FT   assembly_gap    4335293..4335394
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    4346801..4354527
FT                   /estimated_length=7727
FT                   /gap_type="unknown"
FT   assembly_gap    4357363..4357779
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    4366042..4366444
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    4368280..4368344
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    4368858..4369090
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    4373612..4373865
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    4384274..4384394
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    4386707..4387042
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    4399781..4400400
FT                   /estimated_length=620
FT                   /gap_type="unknown"
FT   assembly_gap    4411821..4411840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4416903..4417388
FT                   /locus_tag="mCG_21680"
FT                   /note="gene_id=mCG21680.1"
FT   mRNA            4416903..4417388
FT                   /locus_tag="mCG_21680"
FT                   /product="mCG21680"
FT                   /note="gene_id=mCG21680.1 transcript_id=mCT20267.2 created
FT                   on 05-JUN-2002"
FT   CDS             4416973..4417239
FT                   /codon_start=1
FT                   /locus_tag="mCG_21680"
FT                   /product="mCG21680"
FT                   /note="gene_id=mCG21680.1 transcript_id=mCT20267.2
FT                   protein_id=mCP23329.1"
FT                   /protein_id="EDL22540.1"
FT                   /translation="MVAAKKTKKSLESINSRLQLVMKSGKYMLGYKQTLKMIGQGKAKL
FT                   VILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKY"
FT   assembly_gap    4421228..4421270
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    4429721..4429740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4431933..4431952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4443444..4450501
FT                   /locus_tag="mCG_120563"
FT                   /note="gene_id=mCG120563.1"
FT   mRNA            join(4443444..4443505,4446326..4446463,4447739..4447822,
FT                   4448272..4448322,4449271..4450501)
FT                   /locus_tag="mCG_120563"
FT                   /product="mCG120563, transcript variant mCT169843"
FT                   /note="gene_id=mCG120563.1 transcript_id=mCT169843.0
FT                   created on 05-JUN-2002"
FT   mRNA            join(4443693..4443860,4446326..4446463,4447739..4447822,
FT                   4448272..4448322,4449271..4450496)
FT                   /locus_tag="mCG_120563"
FT                   /product="mCG120563, transcript variant mCT121753"
FT                   /note="gene_id=mCG120563.1 transcript_id=mCT121753.0
FT                   created on 05-JUN-2002"
FT   CDS             join(4446362..4446463,4447739..4447822,4448272..4448322,
FT                   4449271..4449324)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120563"
FT                   /product="mCG120563, isoform CRA_a"
FT                   /note="gene_id=mCG120563.1 transcript_id=mCT169843.0
FT                   protein_id=mCP92696.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TVP0"
FT                   /db_xref="InterPro:IPR000116"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR031079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TVP0"
FT                   /protein_id="EDL22541.1"
FT                   /translation="MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKR
FT                   PRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ"
FT   CDS             join(4446362..4446463,4447739..4447822,4448272..4448322,
FT                   4449271..4449324)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120563"
FT                   /product="mCG120563, isoform CRA_a"
FT                   /note="gene_id=mCG120563.1 transcript_id=mCT121753.0
FT                   protein_id=mCP84611.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TVP0"
FT                   /db_xref="InterPro:IPR000116"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR031079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TVP0"
FT                   /protein_id="EDL22542.1"
FT                   /translation="MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKR
FT                   PRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ"
FT   gene            complement(4450604..>4452732)
FT                   /locus_tag="mCG_56521"
FT                   /note="gene_id=mCG56521.2"
FT   mRNA            complement(join(4450604..4450849,4450982..4451087,
FT                   4451218..4451243,4451395..4451583,4452493..>4452732))
FT                   /locus_tag="mCG_56521"
FT                   /product="mCG56521"
FT                   /note="gene_id=mCG56521.2 transcript_id=mCT56704.2 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(4450784..4450849,4450982..4451087,
FT                   4451218..4451243,4451395..4451583,4452493..>4452732))
FT                   /codon_start=1
FT                   /locus_tag="mCG_56521"
FT                   /product="mCG56521"
FT                   /note="gene_id=mCG56521.2 transcript_id=mCT56704.2
FT                   protein_id=mCP42865.1"
FT                   /protein_id="EDL22543.1"
FT                   /translation="PGKRAVPQPSRCAALGRPLLPRRGRCRTPSGPPTRIRIGHHAGLG
FT                   RQGPAFSPAPLITRWRTLPGPGPTQGVAVRAARREGAQRRRPPEATTAHAVHPFSHLAT
FT                   DVMSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLPM
FT                   YSYDPAEELQEAEQELLSDVGDPKVVHGWQSSYQHKRMPLLDIKT"
FT   assembly_gap    4461828..4461847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4466160..>4483651)
FT                   /gene="Nudt3"
FT                   /locus_tag="mCG_21685"
FT                   /note="gene_id=mCG21685.1"
FT   mRNA            complement(join(4466160..4467725,4468797..4468881,
FT                   4470001..4470045,4483539..>4483651))
FT                   /gene="Nudt3"
FT                   /locus_tag="mCG_21685"
FT                   /product="nudix (nucleotide diphosphate linked moiety
FT                   X)-type motif 3"
FT                   /note="gene_id=mCG21685.1 transcript_id=mCT20272.1 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(4467559..4467725,4468797..4468881,
FT                   4470001..4470045,4483539..>4483649))
FT                   /codon_start=1
FT                   /gene="Nudt3"
FT                   /locus_tag="mCG_21685"
FT                   /product="nudix (nucleotide diphosphate linked moiety
FT                   X)-type motif 3"
FT                   /note="gene_id=mCG21685.1 transcript_id=mCT20272.1
FT                   protein_id=mCP23131.1"
FT                   /protein_id="EDL22544.1"
FT                   /translation="VLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLG
FT                   RLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQCHKPVQA
FT                   SYFETLRQGYPANNGTPVVPTTYSSSVSGIR"
FT   assembly_gap    4470710..4470729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4473248..4473297
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    4484614..4484633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4509759..4510355
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    4515019..4515616
FT                   /estimated_length=598
FT                   /gap_type="unknown"
FT   gene            complement(4517127..4521939)
FT                   /locus_tag="mCG_21688"
FT                   /note="gene_id=mCG21688.1"
FT   mRNA            complement(join(4517127..4517204,4517898..4517953,
FT                   4518974..4519051,4520767..4520938,4521021..4521170,
FT                   4521899..4521939))
FT                   /locus_tag="mCG_21688"
FT                   /product="mCG21688"
FT                   /note="gene_id=mCG21688.1 transcript_id=mCT20274.0 created
FT                   on 05-JUN-2002"
FT   CDS             complement(join(4517163..4517204,4517898..4517953,
FT                   4518974..4519051,4520767..4520938,4521021..4521170))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21688"
FT                   /product="mCG21688"
FT                   /note="gene_id=mCG21688.1 transcript_id=mCT20274.0
FT                   protein_id=mCP23132.1"
FT                   /db_xref="GOA:Q5M9K7"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="MGI:MGI:1914347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9K7"
FT                   /protein_id="EDL22545.1"
FT                   /translation="MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHV
FT                   MKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRP
FT                   RPKGPEGERPARFTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQP
FT                   PQ"
FT   assembly_gap    4522253..4522439
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    4524701..4525219
FT                   /estimated_length=519
FT                   /gap_type="unknown"
FT   assembly_gap    4527294..4527453
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    4528590..4529227
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    4531346..4531730
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   gene            4543057..4597616
FT                   /gene="Pacsin1"
FT                   /locus_tag="mCG_21689"
FT                   /note="gene_id=mCG21689.1"
FT   mRNA            join(4543057..4543103,4588028..4588202,4588934..4589090,
FT                   4591052..4591287,4592040..4592195,4592336..4592511,
FT                   4593392..4593512,4593618..4593745,4594279..4594466,
FT                   4594825..4596961,4597139..4597616)
FT                   /gene="Pacsin1"
FT                   /locus_tag="mCG_21689"
FT                   /product="protein kinase C and casein kinase substrate in
FT                   neurons 1"
FT                   /note="gene_id=mCG21689.1 transcript_id=mCT20276.1 created
FT                   on 06-JUN-2002"
FT   assembly_gap    4543366..4543385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4550740..4550759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4570549..4570962
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    4573323..4573342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4583404..4583423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(4588149..4588202,4588934..4589090,4591052..4591287,
FT                   4592040..4592195,4592336..4592511,4593392..4593512,
FT                   4593618..4593745,4594279..4594466,4594825..4594934)
FT                   /codon_start=1
FT                   /gene="Pacsin1"
FT                   /locus_tag="mCG_21689"
FT                   /product="protein kinase C and casein kinase substrate in
FT                   neurons 1"
FT                   /note="gene_id=mCG21689.1 transcript_id=mCT20276.1
FT                   protein_id=mCP23189.2"
FT                   /protein_id="EDL22546.1"
FT                   /translation="MSGSYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQE
FT                   RAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLN
FT                   EDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKE
FT                   ERLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYME
FT                   GMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYMHVYRELEQAIRGADAQEDL
FT                   RWFRSTSGPGMPMNWPQFEEWNPDLPHTTAKKEKQPKKAEGATLSNATGAVESTSQAGD
FT                   RGSVSSYDRGQTYATEWSDDESGNPFGGNEANGGANPFDDDAKGVRVRALYDYDGQEQD
FT                   ELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI"
FT   assembly_gap    4589778..4589995
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    4592575..4592918
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    4596962..4597138
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            complement(4600956..>4615435)
FT                   /gene="Spdef"
FT                   /locus_tag="mCG_21692"
FT                   /note="gene_id=mCG21692.2"
FT   mRNA            complement(join(4600956..4601120,4601176..4601553,
FT                   4603672..4603818,4603921..4603968,4604527..4604724,
FT                   4606466..4606897,4615040..4615372))
FT                   /gene="Spdef"
FT                   /locus_tag="mCG_21692"
FT                   /product="SAM pointed domain containing ets transcription
FT                   factor, transcript variant mCT20707"
FT                   /note="gene_id=mCG21692.2 transcript_id=mCT20707.0 created
FT                   on 06-JUN-2002"
FT   mRNA            complement(join(4600963..4601553,4603672..4603818,
FT                   4603921..4603968,4604527..4604724,4606466..4606897,
FT                   4615040..>4615435))
FT                   /gene="Spdef"
FT                   /locus_tag="mCG_21692"
FT                   /product="SAM pointed domain containing ets transcription
FT                   factor, transcript variant mCT191668"
FT                   /note="gene_id=mCG21692.2 transcript_id=mCT191668.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4601375..4601553,4603672..4603818,
FT                   4603921..4603968,4604527..4604724,4606466..4606897,
FT                   4615040..>4615142))
FT                   /codon_start=1
FT                   /gene="Spdef"
FT                   /locus_tag="mCG_21692"
FT                   /product="SAM pointed domain containing ets transcription
FT                   factor, isoform CRA_a"
FT                   /note="gene_id=mCG21692.2 transcript_id=mCT191668.0
FT                   protein_id=mCP112612.0 isoform=CRA_a"
FT                   /protein_id="EDL22547.1"
FT                   /translation="LRPSSDPELPAHCLLLVPEVGSAEDDSSDSRRLTEAAPSLHRSMG
FT                   SASPGLSNVSPGCLLLFPDVAPRTGTEKAASGAMGPEKQEWSPSPPATPEQGLSAFYLS
FT                   YFNMYPDDSSWVAKVPEARAGEDHPEEPEQCPVIDSQASGSTLDEHSLEQVQSMVVGEV
FT                   LKDIETACKLLNITADPGDWSPGNVQKWLLWTEHQYRLPPAGKAFQELGGKELCAMSEE
FT                   QFRQRAPLGGDVLHAHLDIWKSAAWMKERTSPGTLHYCASTSEEGWTDGEVDSSCSGQP
FT                   IHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGVRKNRPAMNYDKLSR
FT                   SIRQYYKKGIIRKPDISQRLVYQFVHPV"
FT   CDS             complement(join(4601375..4601553,4603672..4603818,
FT                   4603921..4603968,4604527..4604724,4606466..4606871))
FT                   /codon_start=1
FT                   /gene="Spdef"
FT                   /locus_tag="mCG_21692"
FT                   /product="SAM pointed domain containing ets transcription
FT                   factor, isoform CRA_b"
FT                   /note="gene_id=mCG21692.2 transcript_id=mCT20707.0
FT                   protein_id=mCP23149.1 isoform=CRA_b"
FT                   /protein_id="EDL22548.1"
FT                   /translation="MGSASPGLSNVSPGCLLLFPDVAPRTGTEKAASGAMGPEKQEWSP
FT                   SPPATPEQGLSAFYLSYFNMYPDDSSWVAKVPEARAGEDHPEEPEQCPVIDSQASGSTL
FT                   DEHSLEQVQSMVVGEVLKDIETACKLLNITADPGDWSPGNVQKWLLWTEHQYRLPPAGK
FT                   AFQELGGKELCAMSEEQFRQRAPLGGDVLHAHLDIWKSAAWMKERTSPGTLHYCASTSE
FT                   EGWTDGEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLW
FT                   GVRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPV"
FT   assembly_gap    4621104..4621123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4622721..4622740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4627480..4628409
FT                   /locus_tag="mCG_1033990"
FT                   /note="gene_id=mCG1033990.0"
FT   mRNA            join(<4627480..4627700,4627911..4628409)
FT                   /locus_tag="mCG_1033990"
FT                   /product="mCG1033990"
FT                   /note="gene_id=mCG1033990.0 transcript_id=mCT151694.0
FT                   created on 06-JUN-2002"
FT   CDS             join(4627480..4627700,4627911..4628013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033990"
FT                   /product="mCG1033990"
FT                   /note="gene_id=mCG1033990.0 transcript_id=mCT151694.0
FT                   protein_id=mCP84687.0"
FT                   /protein_id="EDL22549.1"
FT                   /translation="MPLPLPQARPSLGSEDITAGFSSPGLPGDGFRMVASQPVWPHALP
FT                   GEISPLLAGSRGDLVPPPSSTACLLFLKSHEKGDNGDESSGFGRNKQAVCDQEPRMETL
FT                   AST"
FT   assembly_gap    4632372..4632449
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4635197..4635264
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            complement(4638282..4707700)
FT                   /locus_tag="mCG_21704"
FT                   /note="gene_id=mCG21704.1"
FT   mRNA            complement(join(4638282..4641023,4654950..4655278,
FT                   4673092..4673289,4680948..4681102,4707518..4707700))
FT                   /locus_tag="mCG_21704"
FT                   /product="mCG21704"
FT                   /note="gene_id=mCG21704.1 transcript_id=mCT20719.1 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(4640988..4641023,4654950..4655278,
FT                   4673092..4673289,4680948..4681102,4707518..4707675))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21704"
FT                   /product="mCG21704"
FT                   /note="gene_id=mCG21704.1 transcript_id=mCT20719.1
FT                   protein_id=mCP23139.2"
FT                   /db_xref="GOA:Q3TT38"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR032350"
FT                   /db_xref="MGI:MGI:106281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TT38"
FT                   /protein_id="EDL22550.1"
FT                   /translation="MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCA
FT                   FFLDMTNWNLQAAIGAYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFIKTWRIQNS
FT                   GAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCT
FT                   ATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQS
FT                   DENNLTDPGGSEFDSISKNTWAPVPEQSEQDQDRLSQSSVNLSPSSPANNLSVVTYSKG
FT                   LHGPYPFGQS"
FT   gene            4671429..4672248
FT                   /pseudo
FT                   /locus_tag="mCG_21687"
FT                   /note="gene_id=mCG21687.2"
FT   mRNA            4671429..4672248
FT                   /pseudo
FT                   /locus_tag="mCG_21687"
FT                   /note="gene_id=mCG21687.2 transcript_id=mCT20273.2 created
FT                   on 06-JUN-2002"
FT   assembly_gap    4697381..4697400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4707702..4707809
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    4714161..4714191
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    4717433..4717513
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   gene            4725446..4739473
FT                   /locus_tag="mCG_21696"
FT                   /note="gene_id=mCG21696.2"
FT   mRNA            join(4725446..4725534,4727248..4727443,4727738..4727780,
FT                   4729545..4729653,4732452..4732541,4735217..4735321,
FT                   4739146..4739473)
FT                   /locus_tag="mCG_21696"
FT                   /product="mCG21696"
FT                   /note="gene_id=mCG21696.2 transcript_id=mCT20711.2 created
FT                   on 06-JUN-2002"
FT   CDS             join(4727436..4727443,4727738..4727780,4729545..4729653,
FT                   4732452..4732541,4735217..4735321,4739146..4739270)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21696"
FT                   /product="mCG21696"
FT                   /note="gene_id=mCG21696.2 transcript_id=mCT20711.2
FT                   protein_id=mCP23162.1"
FT                   /db_xref="GOA:Q569X3"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017340"
FT                   /db_xref="MGI:MGI:109489"
FT                   /db_xref="UniProtKB/TrEMBL:Q569X3"
FT                   /protein_id="EDL22551.1"
FT                   /translation="MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQ
FT                   AQSLIDKTTAAFQQGKIPPAPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMP
FT                   MMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR"
FT   gene            <4743992..4785183
FT                   /locus_tag="mCG_120568"
FT                   /note="gene_id=mCG120568.2"
FT   mRNA            join(<4743992..4744297,4764132..4764294,4764393..4764431,
FT                   4764794..4764885,4766680..4766869,4767107..4767247,
FT                   4767591..4767761,4768886..4769072,4771454..4771540,
FT                   4771867..4772041,4772346..4772485,4772840..4772981,
FT                   4773334..4773527,4773696..4775125,4777911..4778107,
FT                   4781052..4781203,4781290..4781440,4782458..4782720,
FT                   4783181..4783289,4783371..4783471,4783793..4784542,
FT                   4784598..4785183)
FT                   /locus_tag="mCG_120568"
FT                   /product="mCG120568, transcript variant mCT191709"
FT                   /note="gene_id=mCG120568.2 transcript_id=mCT191709.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(4744746..4744807,4764132..4764294,4764393..4764431,
FT                   4764794..4764885,4766680..4766869,4767107..4767247,
FT                   4767591..4767761,4768916..4769072,4771454..4771540,
FT                   4771867..4771983,4772346..4772485,4772840..4772981,
FT                   4773334..4773527,4773696..4775125,4777911..4778106,
FT                   4781048..4781203,4781290..4781440,4782458..4782720,
FT                   4783181..4783289,4783371..4783471,4783793..4784261)
FT                   /locus_tag="mCG_120568"
FT                   /product="mCG120568, transcript variant mCT121758"
FT                   /note="gene_id=mCG120568.2 transcript_id=mCT121758.1
FT                   created on 06-JUN-2002"
FT   CDS             join(4764818..4764885,4766680..4766869,4767107..4767247,
FT                   4767591..4767761,4768916..4769072,4771454..4771540,
FT                   4771867..4771983,4772346..4772485,4772840..4772981,
FT                   4773334..4773527,4773696..4775125,4777911..4778106,
FT                   4781048..4781203,4781290..4781440,4782458..4782720,
FT                   4783181..4783289,4783371..4783471,4783793..4783918)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120568"
FT                   /product="mCG120568, isoform CRA_a"
FT                   /note="gene_id=mCG120568.2 transcript_id=mCT121758.1
FT                   protein_id=mCP84626.1 isoform=CRA_a"
FT                   /protein_id="EDL22552.1"
FT                   /translation="MQTCEDPRPPNGQSPIALASGQSEYGFAEKVVEGMFIVVNSITIK
FT                   IHSKAFHASFELWQLQGYSVNPNWQQSDLRLTRITDPRRGEVLTFKEITWQTLRVEADA
FT                   IENGDQDPVTTPLRLITNQGRIQIALKRRTKDCNVVASKLTLLLDDLLWVLTDSQLKAM
FT                   MKYAESLSEAMEKSAQQRKSLAPEPVQTWAQAFGGSQGSSSSSRLSQYFEKFDVKESSY
FT                   HLLISRLDLHICDDSQSREPGVSANRLTGGAMQLTFRRMAFDYYPFHRAGDSCKHWVRH
FT                   CEAMETRGHWAQQLVTEFQSRVEKQCEGGNSFSSPGKTPLDKSPTQGRQAAFGAPAWNR
FT                   LRSSCLVVRVDDLDIHQVSTAGQPSKKPSTLLSCSRKRHHLPPQVAAIHVQFTEYYFPD
FT                   NQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEASRGRDEH
FT                   VDVRLDAFWLKVSFPLETRELAKLHRPQALVLSTSSMIATNTRHAPNCTRPDLQSLFRG
FT                   FAATEFFRCSYGHFPQVAGGFSLLHMLFLHHAFQMDSLPPQRLAASQDLWSLHFTQISL
FT                   DFEGTENFRGHTLNFVAPFPLSIWACLPLRWQQAQARRLLLASEGRLKPSASFGSPVHS
FT                   EALAPESVSHQRSKTERDLKSLSGSTEGPAAAVREGDAGVDHKGRVADLEDVADIHMLV
FT                   HSTAHVRVRLDHYQYLALLRLKEVLEGLQEQLTKDTEAMTGSPLQDQTVCIGVLFPSAE
FT                   VALLMHPAPGTAHADSAGSDTTSLIDSELSPSEDREPKSDASSDQGAVSPEKVLRDGSG
FT                   ENLAASQERLPSDGELPDPGPCAQQPVGKSHEAVESLQAKKLSRAQSARSPATLKSPAD
FT                   RDAALNGQGEPVPLRSIEGDLSSAIHMTKDATKEALHATVDLTKEAVSLTRDAFSLGRD
FT                   RMTSTMHKMLSLPPAKEAMAKPDEGVVASVSGGAARLRFFSMKRTVSQQSFDGVSLDSG
FT                   GPDDRISVDSDGSDSFVMLLESAESGPESVPPGSVTSVLDDSGIQGSPVTDSGGQGLPE
FT                   TNSSASASGDLVMHSVSILVLKVNEVSLGIEVRGEDLAVALQAEELALQQLGTVGLWQF
FT                   LHGQCPGAGFQEPSNLKTNPIRPAVGLRFEVGPGAAVHSPLATQNGFLQFLLRGCDLEL
FT                   FTSVLNGLGPFLEDEEVPVVVPMQIELLDCRVTLKDDIPPVYPTSPGPVPITLAMERLV
FT                   LKRGDDGVFHLGAPAHDRPLTDVPEKLRLPKEQVLLVPLGQGLGCQEKESPTLQQELMD
FT                   TKQALAIANQDKEKLLQEVRKYNPLFEL"
FT   CDS             join(<4771990..4772041,4772346..4772485,4772840..4772981,
FT                   4773334..4773527,4773696..4775125,4777911..4778107,
FT                   4781052..4781203,4781290..4781440,4782458..4782720,
FT                   4783181..4783289,4783371..4783471,4783793..4783918)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120568"
FT                   /product="mCG120568, isoform CRA_b"
FT                   /note="gene_id=mCG120568.2 transcript_id=mCT191709.0
FT                   protein_id=mCP112662.0 isoform=CRA_b"
FT                   /protein_id="EDL22553.1"
FT                   /translation="SPRGCWGWTLPSGGKQADSFSSPGKTPLDKSPTQGRQAAFGAPAW
FT                   NRLRSSCLVVRVDDLDIHQVSTAGQPSKKPSTLLSCSRKRHHLPPQVAAIHVQFTEYYF
FT                   PDNQELPVPCPNLYIQLNGLTFTVDPVSLLWGNLFCLDLYRSLEQFKAIYKLEASRGRD
FT                   EHVDVRLDAFWLKVSFPLETRELAKLHRPQALVLSTSSMIATNTRHAPNCTRPDLQSLF
FT                   RGFAATEFFRCSYGHFPQVAGGFSLLHMLFLHHAFQMDSLPPQRLAASQDLWSLHFTQI
FT                   SLDFEGTENFRGHTLNFVAPFPLSIWACLPLRWQQAQARRLLLASEGRLKPSASFGSPV
FT                   HSEALAPESVSHQRSKTERDLKSLSGSTEGPAAAVREGDAGVDHKGRVADLEDVADIHM
FT                   LVHSTAHVRVRLDHYQYLALLRLKEVLEGLQEQLTKDTEAMTGSPLQDQTVCIGVLFPS
FT                   AEVALLMHPAPGTAHADSAGSDTTSLIDSELSPSEDREPKSDASSDQGAVSPEKVLRDG
FT                   SGENLAASQERLPSDGELPDPGPCAQQPVGKSHEAVESLQAKKLSRAQSARSPATLKSP
FT                   ADRDAALNGQGEPVPLRSIEGDLSSAIHMTKDATKEALHATVDLTKEAVSLTRDAFSLG
FT                   RDRMTSTMHKMLSLPPAKEAMAKPDEGVVASVSGGAARLRFFSMKRTVSQQSFDGVSLD
FT                   SGGPDDRISVDSDGSDSFVMLLESESGPESVPPGSVTSVLDDSGIQGSPVTDSGGQGLP
FT                   ETNSSASASGDLVMHSVSILVLKVNEVSLGIEVRGEDLAVALQAEELALQQLGTVGLWQ
FT                   FLHGQCPGAGFQEPSNLKTNPIRPAVGLRFEVGPGAAVHSPLATQNGFLQFLLRGCDLE
FT                   LFTSVLNGLGPFLEDEEVPVVVPMQIELLDCRVTLKDDIPPVYPTSPGPVPITLAMERL
FT                   VLKRGDDGVFHLGAPAHDRPLTDVPEKLRLPKEQVLLVPLGQGLGCQEKESPTLQQELM
FT                   DTKQALAIANQDKEKLLQEVRKYNPLFEL"
FT   assembly_gap    4776341..4776360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4786186..>4788003)
FT                   /locus_tag="mCG_1033931"
FT                   /note="gene_id=mCG1033931.0"
FT   mRNA            complement(join(4786186..4786682,4787896..>4788003))
FT                   /locus_tag="mCG_1033931"
FT                   /product="mCG1033931"
FT                   /note="gene_id=mCG1033931.0 transcript_id=mCT151635.0
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(4786480..4786682,4787896..>4787992))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1033931"
FT                   /product="mCG1033931"
FT                   /note="gene_id=mCG1033931.0 transcript_id=mCT151635.0
FT                   protein_id=mCP84622.0"
FT                   /protein_id="EDL22554.1"
FT                   /translation="FAFQVVHRTSTLGVGLAIATVNLPNTDQCSVHPKLQMCCPICVFH
FT                   HPYPGHPHSQFHYSQVSPVYSPVKRGTESQDIIEMPQNNLTFLRDGFRTQKAKA"
FT   gene            complement(4788924..4796966)
FT                   /gene="Taf11"
FT                   /locus_tag="mCG_21700"
FT                   /note="gene_id=mCG21700.1"
FT   mRNA            complement(join(4788924..4789588,4790328..4790424,
FT                   4790903..4790990,4793064..4793212,4795305..4796047,
FT                   4796574..4796966))
FT                   /gene="Taf11"
FT                   /locus_tag="mCG_21700"
FT                   /product="TAF11 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG21700.1 transcript_id=mCT20715.1 created
FT                   on 06-JUN-2002"
FT   CDS             complement(join(4789458..4789588,4790328..4790424,
FT                   4790903..4790990,4793064..4793212,4795305..4795475))
FT                   /codon_start=1
FT                   /gene="Taf11"
FT                   /locus_tag="mCG_21700"
FT                   /product="TAF11 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG21700.1 transcript_id=mCT20715.1
FT                   protein_id=mCP23212.1"
FT                   /protein_id="EDL22555.1"
FT                   /translation="MDNLGESPTDKGGEPGESEETRATPGALVAADTEGIPEETDRDGD
FT                   ADLKEAAAEESELKSQDVSDVTAAERENSSLLTPAAKKLKLDIKDKKEKKQKVDEDEIQ
FT                   KMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVG
FT                   EVVEEALDVCEKWGETPPLQPKHMREAVRRLKSKGQIPNSKHKKITFF"
FT   gene            4797142..4950862
FT                   /gene="Anks1"
FT                   /locus_tag="mCG_18526"
FT                   /note="gene_id=mCG18526.2"
FT   mRNA            join(4797142..4797450,4862912..4862992,4864568..4864724,
FT                   4873072..4873368,4874250..4874325,4874549..4874650,
FT                   4874743..4874844,4876718..4876905,4879305..4879397,
FT                   4883943..4884063,4895796..4896379,4926017..4926083,
FT                   4930507..4930613,4938651..4938749,4939582..4939734,
FT                   4939810..4939917,4940724..4940888,4941975..4942100,
FT                   4942377..4942448,4942755..4942841,4945412..4945549,
FT                   4946375..4946545,4947379..4947476,4948647..4950862)
FT                   /gene="Anks1"
FT                   /locus_tag="mCG_18526"
FT                   /product="ankyrin repeat and SAM domain containing 1,
FT                   transcript variant mCT14585"
FT                   /note="gene_id=mCG18526.2 transcript_id=mCT14585.2 created
FT                   on 06-JUN-2002"
FT   mRNA            join(<4797144..4797450,4862912..4862992,4864568..4864724,
FT                   4866434..4866496,4873072..4873368,4874250..4874325,
FT                   4874549..4874650,4874743..4874844,4876718..4876914,
FT                   4879305..4879397,4883943..4884063,4895796..4896379,
FT                   4926017..4926083,4930507..4930613,4938651..4938749,
FT                   4939582..4939734,4939810..4939917,4940724..4940888,
FT                   4941975..4942100,4942377..4942448,4942755..4942841,
FT                   4945412..4945549,4946375..4946545,4947379..4947476,
FT                   4948647..4950719)
FT                   /gene="Anks1"
FT                   /locus_tag="mCG_18526"
FT                   /product="ankyrin repeat and SAM domain containing 1,
FT                   transcript variant mCT191688"
FT                   /note="gene_id=mCG18526.2 transcript_id=mCT191688.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4797176..4797450,4862912..4862992,4864568..4864724,
FT                   4873072..4873368,4874250..4874325,4874549..4874650,
FT                   4874743..4874844,4876718..4876914,4879305..4879397,
FT                   4883943..4884063,4895796..4896379,4926017..4926083,
FT                   4930507..4930613,4938651..4938749,4939582..4939734,
FT                   4939810..4939917,4940724..4940888,4941975..4942100,
FT                   4942377..4942448,4942755..4942841,4945412..4945549,
FT                   4946375..4946545,4946833..4946931,4947379..4950684)
FT                   /gene="Anks1"
FT                   /locus_tag="mCG_18526"
FT                   /product="ankyrin repeat and SAM domain containing 1,
FT                   transcript variant mCT191687"
FT                   /note="gene_id=mCG18526.2 transcript_id=mCT191687.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<4797176..4797450,4862912..4862992,4864568..4864724,
FT                   4866434..4866496,4873072..4873368,4874250..4874325,
FT                   4874549..4874650,4874743..4874844,4876718..4876914,
FT                   4879305..4879397,4883943..4884063,4895796..4896379,
FT                   4926017..4926083,4930507..4930613,4938651..4938749,
FT                   4939582..4939734,4939810..4939917,4940724..4940888,
FT                   4941975..4942100,4942377..4942448,4942755..4942841,
FT                   4945412..4945549,4946375..4946545,4947379..4947476,
FT                   4948647..4948650)
FT                   /codon_start=1
FT                   /gene="Anks1"
FT                   /locus_tag="mCG_18526"
FT                   /product="ankyrin repeat and SAM domain containing 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG18526.2 transcript_id=mCT191688.0
FT                   protein_id=mCP112604.0 isoform=CRA_c"
FT                   /protein_id="EDL22558.1"
FT                   /translation="GVRCPETESFGAGAGSARLRVEVRGVAVLGMGKEQELLEAARTGH
FT                   LPAVEKLLSGKRLSSGFGGGGGGSGSGGGSGGGGLGSSSHPLSSLLSMWRGPNVNCVDS
FT                   TGYTPLHHAALNGHRDVVEVLLRNDALTNVADSKGCYPLHLAAWKGDAQIVRLLIQQGP
FT                   SHTRVNEQNALEIRELKKYGPFDPYINAKNNDNETALHCAAQYGHTEVVKALLEELTDP
FT                   TMRNNKFETPLDLAALYGRLEVVKLLLGAHPNLLSCSTRKHTPLHLAARNGHKAVVQVL
FT                   LDAGMDSNYQTEMGSALHEAALFGKTDVVQILLAAGIDVNIKDNRGLTALDTVRDLPSQ
FT                   KSQQIAALIEDHMTGKRSVKEVDRTSTAQLPLLSNTDAIAPMSQGSMEKTVTELILHFD
FT                   THADEEGPYEALYNAVSCHSLDSTASGRSSDRDSMNKEAEATGTRAAGVRPRERPPPPA
FT                   KPPPDEEEEERVDKKYFPLAASEGLAVRPRIQSSAPQEEEEHPYELLLTAETKKLGTTD
FT                   GRTEDHRQSGSGRSQDSVEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLTAPSQSHPE
FT                   SSQQDACHEASMQLEEPGVQGTEPPQPGVPDQSKRVGLPAGLTALASRTYLDALTHTVP
FT                   LRPAGAEEEDQSGPRSRAPPTSKPKAELKLSRSLSKSDSDLLTCSPTEDATMGSRSESL
FT                   SNCSIGKKRLEKSPSFASEWDEIEKIMSSIGEGIDFSQEQQKISGSRTLEQSVGEWLES
FT                   IGLQQYESKLLLNGFDDVRFLGSNVMEEQDLREIGISDPQHRRKLLQAARSLPKVKALG
FT                   YDGVSPTSVPSWLDSLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVHLLGHRKRI
FT                   IASLADRPYEEPPQKPPRFSQLRCQDLISQTSSPLSQNDSCTGRSADLLLPSADTSRRR
FT                   HDSLPDPGTASRADRFRVQEEPSETKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYE
FT                   ANYLGSMLIKDLRGTESTQDACAKMRKSTEHMKKIPTIILSITYKGVKFIDASNKNVIA
FT                   EHEIRNISCAAQDPEDLCTFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVA
FT                   YQLALQAQKSRTMAASAASMIETKSSKPVPKPRVGMRKSALEPPDSDQEAPSHASVSWI
FT                   VDPKPDSKRSLSTN"
FT   CDS             join(<4797176..4797450,4862912..4862992,4864568..4864724,
FT                   4873072..4873368,4874250..4874325,4874549..4874650,
FT                   4874743..4874844,4876718..4876914,4879305..4879397,
FT                   4883943..4884063,4895796..4896379,4926017..4926083,
FT                   4930507..4930613,4938651..4938749,4939582..4939734,
FT                   4939810..4939917,4940724..4940888,4941975..4942100,
FT                   4942377..4942448,4942755..4942841,4945412..4945549,
FT                   4946375..4946545,4946833..4946931,4947379..4947498)
FT                   /codon_start=1
FT                   /gene="Anks1"
FT                   /locus_tag="mCG_18526"
FT                   /product="ankyrin repeat and SAM domain containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18526.2 transcript_id=mCT191687.0
FT                   protein_id=mCP112603.0 isoform=CRA_b"
FT                   /protein_id="EDL22557.1"
FT                   /translation="GVRCPETESFGAGAGSARLRVEVRGVAVLGMGKEQELLEAARTGH
FT                   LPAVEKLLSGKRLSSGFGGGGGGSGSGGGSGGGGLGSSSHPLSSLLSMWRGPNVNCVDS
FT                   TGYTPLHHAALNGHRDVVEVLLRNDALTNVADSKGCYPLHLAAWKGDAQIVRLLIQQGP
FT                   SHTRVNEQNNDNETALHCAAQYGHTEVVKALLEELTDPTMRNNKFETPLDLAALYGRLE
FT                   VVKLLLGAHPNLLSCSTRKHTPLHLAARNGHKAVVQVLLDAGMDSNYQTEMGSALHEAA
FT                   LFGKTDVVQILLAAGIDVNIKDNRGLTALDTVRDLPSQKSQQIAALIEDHMTGKRSVKE
FT                   VDRTSTAQLPLLSNTDAIAPMSQGSMEKTVTELILHFDTHADEEGPYEALYNAVSCHSL
FT                   DSTASGRSSDRDSMNKEAEATGTRAAGVRPRERPPPPAKPPPDEEEEERVDKKYFPLAA
FT                   SEGLAVRPRIQSSAPQEEEEHPYELLLTAETKKLGTTDGRTEDHRQSGSGRSQDSVEGQ
FT                   DGQVPEQFSGLLHGSSPVCEVGQDPFQLLTAPSQSHPESSQQDACHEASMQLEEPGVQG
FT                   TEPPQPGVPDQSKRVGLPAGLTALASRTYLDALTHTVPLRPAGAEEEDQSGPRSRAPPT
FT                   SKPKAELKLSRSLSKSDSDLLTCSPTEDATMGSRSESLSNCSIGKKRLEKSPSFASEWD
FT                   EIEKIMSSIGEGIDFSQEQQKISGSRTLEQSVGEWLESIGLQQYESKLLLNGFDDVRFL
FT                   GSNVMEEQDLREIGISDPQHRRKLLQAARSLPKVKALGYDGVSPTSVPSWLDSLGLQDY
FT                   VHSFLSSGYSSIDTVKNLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQ
FT                   LRCQDLISQTSSPLSQNDSCTGRSADLLLPSADTSRRRHDSLPDPGTASRADRFRVQEE
FT                   PSETKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSMLIKDLRGTESTQDA
FT                   CAKMRKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEHEIRNISCAAQDPEDLCTFA
FT                   YITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRTMAASAASMI
FT                   ETKSSKPVPKPRVGMRKSAVPVPPDSRCCHCHTCTTHRPSYLPLPSVSPGVKLEPPDSD
FT                   QEAPSHASVSWIVDPKPDSKRSLSTKYETTIF"
FT   CDS             join(4797266..4797450,4862912..4862992,4864568..4864724,
FT                   4873072..4873368,4874250..4874325,4874549..4874650,
FT                   4874743..4874844,4876718..4876905,4879305..4879397,
FT                   4883943..4884063,4895796..4896379,4926017..4926083,
FT                   4930507..4930613,4938651..4938749,4939582..4939734,
FT                   4939810..4939917,4940724..4940888,4941975..4942100,
FT                   4942377..4942448,4942755..4942841,4945412..4945549,
FT                   4946375..4946545,4947379..4947476,4948647..4948650)
FT                   /codon_start=1
FT                   /gene="Anks1"
FT                   /locus_tag="mCG_18526"
FT                   /product="ankyrin repeat and SAM domain containing 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18526.2 transcript_id=mCT14585.2
FT                   protein_id=mCP23326.2 isoform=CRA_a"
FT                   /protein_id="EDL22556.1"
FT                   /translation="MGKEQELLEAARTGHLPAVEKLLSGKRLSSGFGGGGGGSGSGGGS
FT                   GGGGLGSSSHPLSSLLSMWRGPNVNCVDSTGYTPLHHAALNGHRDVVEVLLRNDALTNV
FT                   ADSKGCYPLHLAAWKGDAQIVRLLIQQGPSHTRVNEQNNDNETALHCAAQYGHTEVVKA
FT                   LLEELTDPTMRNNKFETPLDLAALYGRLEVVKLLLGAHPNLLSCSTRKHTPLHLAARNG
FT                   HKAVVQVLLDAGMDSNYQTEMGSALHEAALFGKTDVVQILLAAGIDVNIKDNRGLTALD
FT                   TVRDLPSQKSQQIAALIEDHMTGKRSVKEVDRTSTAQLPLLSNTDAIAPMSQGSMEKTV
FT                   TELILHFDTHADEEGPYEALYNAVSCHSLDSTASGRSSDRDSMNKEAEATGTRAAGRER
FT                   PPPPAKPPPDEEEEERVDKKYFPLAASEGLAVRPRIQSSAPQEEEEHPYELLLTAETKK
FT                   LGTTDGRTEDHRQSGSGRSQDSVEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLTAPS
FT                   QSHPESSQQDACHEASMQLEEPGVQGTEPPQPGVPDQSKRVGLPAGLTALASRTYLDAL
FT                   THTVPLRPAGAEEEDQSGPRSRAPPTSKPKAELKLSRSLSKSDSDLLTCSPTEDATMGS
FT                   RSESLSNCSIGKKRLEKSPSFASEWDEIEKIMSSIGEGIDFSQEQQKISGSRTLEQSVG
FT                   EWLESIGLQQYESKLLLNGFDDVRFLGSNVMEEQDLREIGISDPQHRRKLLQAARSLPK
FT                   VKALGYDGVSPTSVPSWLDSLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVHLLG
FT                   HRKRIIASLADRPYEEPPQKPPRFSQLRCQDLISQTSSPLSQNDSCTGRSADLLLPSAD
FT                   TSRRRHDSLPDPGTASRADRFRVQEEPSETKLTLRPPSLAAPYAPVQSWQHQPEKLIFE
FT                   SCGYEANYLGSMLIKDLRGTESTQDACAKMRKSTEHMKKIPTIILSITYKGVKFIDASN
FT                   KNVIAEHEIRNISCAAQDPEDLCTFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQ
FT                   AFEVAYQLALQAQKSRTMAASAASMIETKSSKPVPKPRVGMRKSALEPPDSDQEAPSHA
FT                   SVSWIVDPKPDSKRSLSTN"
FT   assembly_gap    4834994..4835013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4887220..4887293
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    4901969..4902035
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            complement(4954833..4968595)
FT                   /gene="Tcp11"
FT                   /locus_tag="mCG_18527"
FT                   /note="gene_id=mCG18527.1"
FT   mRNA            complement(join(4954833..4955249,4955871..4956034,
FT                   4957275..4957456,4957550..4957764,4958520..4958656,
FT                   4959727..4959947,4962771..4962891,4966075..4966147,
FT                   4968011..4968344,4968511..4968595))
FT                   /gene="Tcp11"
FT                   /locus_tag="mCG_18527"
FT                   /product="t-complex protein 11"
FT                   /note="gene_id=mCG18527.1 transcript_id=mCT14782.1 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(4955017..4955249,4955871..4956034,
FT                   4957275..4957456,4957550..4957764,4958520..4958656,
FT                   4959727..4959947,4962771..4962891,4966075..4966147,
FT                   4968011..4968344,4968511..4968528))
FT                   /codon_start=1
FT                   /gene="Tcp11"
FT                   /locus_tag="mCG_18527"
FT                   /product="t-complex protein 11"
FT                   /note="gene_id=mCG18527.1 transcript_id=mCT14782.1
FT                   protein_id=mCP23229.2"
FT                   /protein_id="EDL22559.1"
FT                   /translation="MKEGKGARKEPGAAESASRESRGGNTRESASSAQGHRSCRFNRRP
FT                   STAALTPGSAQGRGVKTAPRGPVGHGGLRTGPTSRCPQPSARAKLPSVTRGAPLPPSPG
FT                   KGHLGGTPSSHRLGMTERVHDASKLDCQLEERSLSSSSLKGKVKDTMPSDFWEHLNEQL
FT                   SAVPPDFSCALELLKEIKEILLSLLLPRQSRLKNEIEEALDMEFLQQQADRGDLNVSYL
FT                   SKYILNMMVLLCAPIRDEAVQRLENISDPVRLLRGIFQVLGQMKMDMVNYTIQSLQPQL
FT                   QEHSVQFERAQFQERLNKEPRLLNHTTKWLTQAATQLIAPSASSSDLQDCSSSAGPSPS
FT                   DVAVPEPLSPAMVLSQGFLNLLTWDPENEEFPETLVADRPRLQELESQQSQLTILASVL
FT                   LVASSFSDSGLFSSPQFVDKLKQITKSLVEDFNSRPEEVMQSVSEQVVEEVHQGLESMG
FT                   LAALSSENTASLVGQLQNIAKKENCVRSVIDQRIHLFLKCCFVLGVQRSLLDLPGGLTL
FT                   IEAELAELGQKFVSLTHHNQQVFAPYYTEILKTLISPAQTLATKGGSL"
FT   gene            complement(4963230..>4964493)
FT                   /locus_tag="mCG_18530"
FT                   /note="gene_id=mCG18530.1"
FT   mRNA            complement(4963230..>4964493)
FT                   /locus_tag="mCG_18530"
FT                   /product="mCG18530"
FT                   /note="gene_id=mCG18530.1 transcript_id=mCT14785.1 created
FT                   on 06-JUN-2002"
FT   CDS             complement(4963523..>4964107)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18530"
FT                   /product="mCG18530"
FT                   /note="gene_id=mCG18530.1 transcript_id=mCT14785.1
FT                   protein_id=mCP23140.2"
FT                   /protein_id="EDL22560.1"
FT                   /translation="KKQKLEQDSGADEEGQEAGGSEATQGSENSDDGQPSAEQEGAAPS
FT                   LDSLSPQPGPSNGVTPLPRSALLIQLATARPRPVKAKPLDWRVQSKDWPHAGRPAHELR
FT                   YSIYRDLWERGFFLSAAGKFGGDFLVYPGDPLRFHAHYIAQCWSAEDPIPLQDLLSAGR
FT                   LGTSVRKTLLLCSPQPDGKVVYTSLQWASLQ"
FT   assembly_gap    4968345..4968510
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4970219..4970321
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    4974126..4974351
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    4977261..4977853
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    4981377..4981396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4983779..4984127
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    4987393..4987543
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    4999741..4999828
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    5004138..5004157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5010525..5010585
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    5030147..5031805
FT                   /estimated_length=1659
FT                   /gap_type="unknown"
FT   assembly_gap    5033283..5033385
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            <5044021..>5116989
FT                   /locus_tag="mCG_126425"
FT                   /note="gene_id=mCG126425.0"
FT   mRNA            join(<5044021..5044180,5044916..5045041,5045227..5045343,
FT                   5048964..5049080,5050469..5050591,5051107..5051223,
FT                   5051885..5052010,5053580..5053795,5083539..5083619,
FT                   5083721..5083822,5086379..5086578,5088721..5088837,
FT                   5089049..5089124,5089618..5089743,5089871..5090050,
FT                   5090716..5090958,5091045..5091208,5091696..5091860,
FT                   5096384..5096548,5105333..5105473,5105971..5106156,
FT                   5108116..5108352,5108448..5108594,5112051..5112159,
FT                   5112492..5112565,5114224..5114390,5114480..5114678,
FT                   5116187..5116277,5116449..5116550,5116637..5116785,
FT                   5116866..>5116989)
FT                   /locus_tag="mCG_126425"
FT                   /product="mCG126425"
FT                   /note="gene_id=mCG126425.0 transcript_id=mCT127707.0
FT                   created on 21-NOV-2001"
FT   CDS             join(<5044021..5044180,5044916..5045041,5045227..5045343,
FT                   5048964..5049080,5050469..5050591,5051107..5051223,
FT                   5051885..5052010,5053580..5053795,5083539..5083619,
FT                   5083721..5083822,5086379..5086578,5088721..5088837,
FT                   5089049..5089124,5089618..5089743,5089871..5090050,
FT                   5090716..5090958,5091045..5091208,5091696..5091860,
FT                   5096384..5096548,5105333..5105473,5105971..5106156,
FT                   5108116..5108352,5108448..5108594,5112051..5112159,
FT                   5112492..5112565,5114224..5114390,5114480..5114678,
FT                   5116187..5116277,5116449..5116550,5116637..5116785,
FT                   5116866..>5116989)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126425"
FT                   /product="mCG126425"
FT                   /note="gene_id=mCG126425.0 transcript_id=mCT127707.0
FT                   protein_id=mCP84680.0"
FT                   /protein_id="EDL22561.1"
FT                   /translation="SHQAPVFTDVDECAEGNGGCQQSCVNMMGSYECHCRDGFFLSDNQ
FT                   HTCIQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGG
FT                   CQHTCDDTEQGPRCGCHVKFVLHTDGKTCIETCAVNNGGCDSKCHDAATGVHCSCPVGF
FT                   MLQPDRKTCKDIDECRLNNGGCDHICRNTVGSFECSCKKGYKLLINERSCQDIDECSFD
FT                   RTCDHMCVNTPGSFQCLCHRGYLLYGVTHCGDVDECSINKGGCRFGCINTPGSYQCTCP
FT                   AGQGRLHWNGKDCTAGCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRLAGLDYELAH
FT                   KPGLGAGDRAELVEVCRPGQHRAGTKCGEKLLEGQVIQLEDGTTAYIHQVTIQKESFSF
FT                   EDGQPVQLEDGSMAYIHHTPKGGPVGIVAEGCDPSALEAVQLEDGSTAYIHHPVPVPSD
FT                   SAILAVQTEAGLEDLAAEDEEGFGTDTVVALEQYASKVLHDSPASHNGKGQQVGDRAFR
FT                   CGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHTGEKPY
FT                   KCPEELCSKAFKTSGDLQKHVRTHTGERPFRCPFEGCGRSFTTSNIRKVHVRTHTGERP
FT                   YTCPEPHCGRGFTSATNYKNHVRIHTVSPGEKPYVCTVPGCGKRFTEYSSLYKHHVVHT
FT                   HCKPYTCSSCGKTYRQTSTLAMHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPP
FT                   KPTHIAYLSEVKEESSAIPTQVAMVTEEDGPPQVALITQDGTQQVSLSPEDLQALGSAI
FT                   SVVTQHGSTTLTIPGHHEELATSGTHTVTMVSADGTQTQPPFAFPETGSWCQSRPWAGA
FT                   GASAMALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLNIPHDPVALEEHF
FT                   RDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADGIGSSPLS
FT                   NQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKLLGSLSLEMGLGELEELLAQDAQSA
FT                   QTAVGLSVWQFLELFNSGRCLRGVGRDSLSMAIQEVYQELIQDVLKQGYLWKRGHLRRN
FT                   WAERWFQLQPSSLCYFGSEECKEKRGTIPLDAHCCVEVLPDREGKRCMFCVKTASRTYE
FT                   MSASDTRQRQEWTAEEERRRSQHKELQQALEGQLREAEQARASMQAEMELKKEEAARQR
FT                   QRIAELEEMQERLQEALQLEVKARRDEEAVRLAQTRLLEEEEEKLKQLMHLKEEQERYI
FT                   ERAQQEKQELQQEMALQSRSLQHAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHW
FT                   NVQMNRLMHPIEPGDKRPTTSSSFTGFQPPPLARRDSSLKRLTRWGSQGRKTGSSTREL
FT                   APTTPLFFRCCVYGLGHSRPVGDSWCYHLPTKSRSRIELSRIWDQNWERKGMTKTRSYA
FT                   PPSRPSYGDILPNKTAHNCPL"
FT   assembly_gap    5065526..5066066
FT                   /estimated_length=541
FT                   /gap_type="unknown"
FT   assembly_gap    5073177..5073196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5084294..5084334
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    5098532..5099844
FT                   /estimated_length=1313
FT                   /gap_type="unknown"
FT   gene            <5121186..5188537
FT                   /gene="Ppard"
FT                   /locus_tag="mCG_145354"
FT                   /note="gene_id=mCG145354.0"
FT   mRNA            join(<5121186..5121244,5125392..5125475,5174863..5175069,
FT                   5183939..5184093,5185684..5185822,5186875..5187632,
FT                   5188200..5188537)
FT                   /gene="Ppard"
FT                   /locus_tag="mCG_145354"
FT                   /product="peroxisome proliferator activator receptor delta"
FT                   /note="gene_id=mCG145354.0 transcript_id=mCT184778.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<5125457..5125475,5174863..5175069,5183939..5184093,
FT                   5185684..5185822,5186875..5187251)
FT                   /codon_start=1
FT                   /gene="Ppard"
FT                   /locus_tag="mCG_145354"
FT                   /product="peroxisome proliferator activator receptor delta"
FT                   /note="gene_id=mCG145354.0 transcript_id=mCT184778.0
FT                   protein_id=mCP105320.0"
FT                   /protein_id="EDL22562.1"
FT                   /translation="RQTHGKGSPSALRPRWWQSYDQACRRHAKWGSVMEQPQEETPEAR
FT                   EEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMGCDGASGGSLNM
FT                   ECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKNRNKCQYCRFQ
FT                   KCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNF
FT                   NMTKKKARSILTGKSSHNAVSVTGQPSHEVGFRGHEGGVPVLPQAWPLMGLVFSPLSST
FT                   TSRHCGRQRRAWCGNSW"
FT   assembly_gap    5135783..5135837
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5143001..5143394
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    5156384..5156985
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   gene            <5160315..5161771
FT                   /locus_tag="mCG_145991"
FT                   /note="gene_id=mCG145991.0"
FT   mRNA            join(<5160315..5160495,5160809..5160852,5161579..5161771)
FT                   /locus_tag="mCG_145991"
FT                   /product="mCG145991"
FT                   /note="gene_id=mCG145991.0 transcript_id=mCT186099.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<5160363..5160495,5160809..5160852,5161579..5161620)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145991"
FT                   /product="mCG145991"
FT                   /note="gene_id=mCG145991.0 transcript_id=mCT186099.0
FT                   protein_id=mCP107358.0"
FT                   /protein_id="EDL22563.1"
FT                   /translation="LQAPCLLSASFRGKAVSKVSCRHPSNPHLLPRGRAGCKEQTVSHV
FT                   CSIRILKEAAPEPWGPGKPWGLPAFQS"
FT   assembly_gap    5188591..5188610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5200027..5200198
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   gene            5202120..5215118
FT                   /locus_tag="mCG_18528"
FT                   /note="gene_id=mCG18528.3"
FT   mRNA            join(5202120..5202438,5204155..5204743,5205415..5205459,
FT                   5206024..5206167,5206618..5206712,5206885..5206963,
FT                   5209341..5209407,5214703..5215117)
FT                   /locus_tag="mCG_18528"
FT                   /product="mCG18528, transcript variant mCT14783"
FT                   /note="gene_id=mCG18528.3 transcript_id=mCT14783.2 created
FT                   on 12-AUG-2002"
FT   mRNA            join(<5202123..5202438,5204155..5204743,5205415..5205459,
FT                   5205714..5205779,5206024..5206167,5206618..5206712,
FT                   5206885..5206963,5209341..5209407,5211197..5211322,
FT                   5214703..5215117)
FT                   /locus_tag="mCG_18528"
FT                   /product="mCG18528, transcript variant mCT191691"
FT                   /note="gene_id=mCG18528.3 transcript_id=mCT191691.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<5202128..5202438,5204155..5204743,5205415..5205459,
FT                   5205714..5205779,5206024..5206167,5206589..5206712,
FT                   5206885..5206963,5209341..5209407,5214703..5215118)
FT                   /locus_tag="mCG_18528"
FT                   /product="mCG18528, transcript variant mCT191690"
FT                   /note="gene_id=mCG18528.3 transcript_id=mCT191690.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5202176..5202438,5204155..5204743,5205415..5205459,
FT                   5205714..5205779,5206024..5206167,5206589..5206712,
FT                   5206885..5206963,5209341..5209407,5214703..5214804)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18528"
FT                   /product="mCG18528, isoform CRA_a"
FT                   /note="gene_id=mCG18528.3 transcript_id=mCT191690.0
FT                   protein_id=mCP112605.0 isoform=CRA_a"
FT                   /protein_id="EDL22564.1"
FT                   /translation="PPPRVRSALATPGSDSVASAGAAPWASLEAPARLLLQALQAGPEG
FT                   ARRGLGVLRALGRRAEHFPWDGFLEALGHLEPEVRGPDGRLELVPLLLRLPGVCQKNLL
FT                   SLLLALLPSLPESGLRSVLQLHHQDVSSTTDAWLHALGELLRRDVGVGVAEGSSPLTRS
FT                   CQLQLRDLCGRLGQGGRGLKLALAPDPEQEDRLSQLCGKRTKEPEEAASPESERSPKRF
FT                   RGCEEAVEGKEPEERPTLESLGSPPDAGGVLPDTDAQAPETGPGVEGPKGPAESVELPK
FT                   VVQDQVPRLQLLLKAFQEGLEGQEKPLVDLQFLHECSPSEMELLCSELQLPQLPDGGLL
FT                   QLCSHLMGLTPALSLSNASVLARSLFLDRIRSLPSSASRLLRVALVSFCVKYTYAICRA
FT                   VLCPLLQDPRVGPAQTELLCSLIKDESLESDMQVQILGQVLELAWREETFLVLQTLLER
FT                   QITEQQSLDLAVALEPNATFLKKALQAALRHVTH"
FT   CDS             join(<5202176..5202438,5204155..5204743,5205415..5205459,
FT                   5205714..5205779,5206024..5206167,5206618..5206712,
FT                   5206885..5206927)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18528"
FT                   /product="mCG18528, isoform CRA_b"
FT                   /note="gene_id=mCG18528.3 transcript_id=mCT191691.0
FT                   protein_id=mCP112606.0 isoform=CRA_b"
FT                   /protein_id="EDL22565.1"
FT                   /translation="PPPRVRSALATPGSDSVASAGAAPWASLEAPARLLLQALQAGPEG
FT                   ARRGLGVLRALGRRAEHFPWDGFLEALGHLEPEVRGPDGRLELVPLLLRLPGVCQKNLL
FT                   SLLLALLPSLPESGLRSVLQLHHQDVSSTTDAWLHALGELLRRDVGVGVAEGSSPLTRS
FT                   CQLQLRDLCGRLGQGGRGLKLALAPDPEQEDRLSQLCGKRTKEPEEAASPESERSPKRF
FT                   RGCEEAVEGKEPEERPTLESLGSPPDAGGVLPDTDAQAPETGPGVEGPKGPAESVELPK
FT                   VVQDQVPRLQLLLKAFQEGLEGQEKPLVDLQFLHECSPSEMELLCSELQLPQLPDGGLL
FT                   QLCSHLMGLTPALSLSNASVLARSLFLDRASQSGPRLLLCKVHLRHLQGCPLSLAPGPS
FT                   CRSCADRVTVFPHKG"
FT   CDS             join(5206130..5206167,5206618..5206712,5206885..5206963,
FT                   5209341..5209407,5214703..5214804)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18528"
FT                   /product="mCG18528, isoform CRA_c"
FT                   /note="gene_id=mCG18528.3 transcript_id=mCT14783.2
FT                   protein_id=mCP23239.2 isoform=CRA_c"
FT                   /db_xref="GOA:B8JJD5"
FT                   /db_xref="InterPro:IPR021025"
FT                   /db_xref="MGI:MGI:1920025"
FT                   /db_xref="UniProtKB/TrEMBL:B8JJD5"
FT                   /protein_id="EDL22566.1"
FT                   /translation="MPLCWPGASFLTGLLRVALVSFCVKYTYAICRAVLCPLLQDPRVG
FT                   PAQTELLCSLIKDESLESDMQVQILGQVLELAWREETFLVLQTLLERQITEQQSLDLAV
FT                   ALEPNATFLKKALQAALRHVTH"
FT   gene            5217137..5219585
FT                   /locus_tag="mCG_18533"
FT                   /note="gene_id=mCG18533.2"
FT   mRNA            join(5217137..5217171,5217364..5217438,5217520..5217600,
FT                   5217927..5218075,5219078..5219250,5219383..5219584)
FT                   /locus_tag="mCG_18533"
FT                   /product="mCG18533, transcript variant mCT14586"
FT                   /note="gene_id=mCG18533.2 transcript_id=mCT14586.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(5217167..5217171,5217364..5217438,5217520..5217600,
FT                   5217927..5218075,5219078..5219250,5219383..5219553)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18533"
FT                   /product="mCG18533, isoform CRA_a"
FT                   /note="gene_id=mCG18533.2 transcript_id=mCT14586.1
FT                   protein_id=mCP23143.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5XJF6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="MGI:MGI:1343877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XJF6"
FT                   /protein_id="EDL22567.1"
FT                   /translation="MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQK
FT                   DKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLA
FT                   KKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVL
FT                   CLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY"
FT   mRNA            join(5217209..5217438,5217520..5217833,5217927..5218075,
FT                   5219078..5219250,5219383..5219585)
FT                   /locus_tag="mCG_18533"
FT                   /product="mCG18533, transcript variant mCT171784"
FT                   /note="gene_id=mCG18533.2 transcript_id=mCT171784.0 created
FT                   on 07-AUG-2002"
FT   mRNA            join(<5217357..5217438,5217520..5218075,5219078..5219250,
FT                   5219383..5219580)
FT                   /locus_tag="mCG_18533"
FT                   /product="mCG18533, transcript variant mCT191633"
FT                   /note="gene_id=mCG18533.2 transcript_id=mCT191633.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<5217838..5218075,5219078..5219250,5219383..5219553)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18533"
FT                   /product="mCG18533, isoform CRA_c"
FT                   /note="gene_id=mCG18533.2 transcript_id=mCT191633.0
FT                   protein_id=mCP112607.0 isoform=CRA_c"
FT                   /protein_id="EDL22569.1"
FT                   /translation="GLPLPAMRSDLAGWPAPTMTCSVFSPPKRRLKSTPRPKFSVCVLG
FT                   DQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGL
FT                   NKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAV
FT                   NFLVSLLKKNWQNVRALYIKSTMGKPQRLY"
FT   CDS             join(5218018..5218075,5219078..5219250,5219383..5219553)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18533"
FT                   /product="mCG18533, isoform CRA_b"
FT                   /note="gene_id=mCG18533.2 transcript_id=mCT171784.0
FT                   protein_id=mCP94703.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99JL6"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="MGI:MGI:1343877"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JL6"
FT                   /protein_id="EDL22568.1"
FT                   /translation="MDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLN
FT                   KAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVN
FT                   FLVSLLKKNWQNVRALYIKSTMGKPQRLY"
FT   gene            complement(5220223..>5239212)
FT                   /gene="Tead3"
FT                   /locus_tag="mCG_140902"
FT                   /note="gene_id=mCG140902.1"
FT   mRNA            complement(join(5220223..5221385,5221503..5221655,
FT                   5221744..5221884,5222058..5222231,5222343..5222488,
FT                   5222936..5222997,5223256..5223305,5223451..5223588,
FT                   5225063..5225125,5228706..5228770,5229901..5230152,
FT                   5238548..>5238897))
FT                   /gene="Tead3"
FT                   /locus_tag="mCG_140902"
FT                   /product="TEA domain family member 3, transcript variant
FT                   mCT172033"
FT                   /note="gene_id=mCG140902.1 transcript_id=mCT172033.0
FT                   created on 14-AUG-2002"
FT   mRNA            complement(join(5220224..5221385,5221503..5221655,
FT                   5221744..5221884,5222058..5222231,5222343..5222488,
FT                   5222936..5222997,5223256..5223305,5223451..5223588,
FT                   5225054..5225125,5228706..5228770,5229901..5230152,
FT                   5238542..>5238697))
FT                   /gene="Tead3"
FT                   /locus_tag="mCG_140902"
FT                   /product="TEA domain family member 3, transcript variant
FT                   mCT191718"
FT                   /note="gene_id=mCG140902.1 transcript_id=mCT191718.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(5220228..5221385,5221503..5221655,
FT                   5221744..5221884,5222058..5222231,5222343..5222488,
FT                   5222936..5222997,5223256..5223305,5223451..5223588,
FT                   5225054..5225125,5228706..5228770,5229901..5230152,
FT                   5239119..>5239152))
FT                   /gene="Tead3"
FT                   /locus_tag="mCG_140902"
FT                   /product="TEA domain family member 3, transcript variant
FT                   mCT191717"
FT                   /note="gene_id=mCG140902.1 transcript_id=mCT191717.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(5220269..5221385,5221503..5221655,
FT                   5221744..5221884,5222058..5222231,5222343..5222488,
FT                   5222936..5222997,5223256..5223305,5223451..5223588,
FT                   5225054..5225125,5228706..5228770,5229901..5230152,
FT                   5239160..>5239212))
FT                   /gene="Tead3"
FT                   /