spacer

EBI Dbfetch

ID   CH466604; SV 2; linear; genomic DNA; CON; MUS; 7415860 BP.
XX
AC   CH466604;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009792898 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7415860
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-7415860
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-7415860
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 3a41b4dd243de8895ee6c1c2cbd03bfa.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000219.
DR   Ensembl-Gn; ENSMUSG00000002699; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020155; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020270; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020295; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020297; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020303; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020458; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020460; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040767; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043999; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055609; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020535; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020537; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037746; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109365; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109430; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169878; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70976938.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7415860
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(<1403393..>1410683)
FT                   /gene="Ccdc85a"
FT                   /locus_tag="mCG_10019"
FT                   /note="gene_id=mCG10019.2"
FT   mRNA            complement(join(<1403393..1404394,1410324..>1410683))
FT                   /gene="Ccdc85a"
FT                   /locus_tag="mCG_10019"
FT                   /product="coiled-coil domain containing 85A"
FT                   /note="gene_id=mCG10019.2 transcript_id=mCT9893.2 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(1403393..1404394,1410324..>1410683))
FT                   /codon_start=1
FT                   /gene="Ccdc85a"
FT                   /locus_tag="mCG_10019"
FT                   /product="coiled-coil domain containing 85A"
FT                   /note="gene_id=mCG10019.2 transcript_id=mCT9893.2
FT                   protein_id=mCP2376.1"
FT                   /protein_id="EDL23817.1"
FT                   /translation="AYRGVGGGHPAAPAPSPVVSPLPPTRTCRRADTMSKAAGGSAPAA
FT                   ESCPSAPAGASTPTGVDDLSKVTDEELLQWSKEELIRSLRRAEAEKVSAMLDHSNLIRE
FT                   VNRRLQLHLGEIRGLKDINQKLQEDNQELRDLCCFLDDDRQKGKRVSREWQRLGRYTAG
FT                   VMHKEVALYLQKLKELEVKQEEVVKENMELKELCMLLDEEKGVGCAGSRCSIDSQASLC
FT                   QLVASATPYVRDVGDGSSTSSTGSTDSPDHHKHHASGGSPEHLQKPRSEGSPEHTKHRS
FT                   TSPEHLHKPRASGTPDHSKALKGPSPEHHKPLCKGSPEQQRHPHPGSSPEVLPKHVLSG
FT                   SPEHFQKHRPGGSPEHTRHSGGSPEHLQKHALGGSLEHLPRARGTSPEHLKQHYGASPD
FT                   HKHASGSGGSGGGSREGTLRRPAQEDSSSHHRNVYSGMNGGSVYAGSCFGLATQ"
FT   gene            <1504727..>1516377
FT                   /locus_tag="mCG_144731"
FT                   /note="gene_id=mCG144731.0"
FT   mRNA            join(<1504727..1505283,1506688..1506840,1515490..>1516377)
FT                   /locus_tag="mCG_144731"
FT                   /product="mCG144731"
FT                   /note="gene_id=mCG144731.0 transcript_id=mCT184155.0
FT                   created on 05-JUN-2003"
FT   CDS             <1516036..>1516377
FT                   /codon_start=1
FT                   /locus_tag="mCG_144731"
FT                   /product="mCG144731"
FT                   /note="gene_id=mCG144731.0 transcript_id=mCT184155.0
FT                   protein_id=mCP105847.0"
FT                   /protein_id="EDL23816.1"
FT                   /translation="DTRCFPIKPCPHPPLLLAQTSEPSGSAVICSRMPFLSLSNTNSFS
FT                   QGPQGISCAFLTILLFNVVSPHLVCVFLFKELRAVPVPSKYLLDFSNSLPPIIRRIQSV
FT                   NIQNKSRDPL"
FT   gene            <1678251..1755348
FT                   /gene="Efemp1"
FT                   /locus_tag="mCG_147809"
FT                   /note="gene_id=mCG147809.0"
FT   mRNA            join(<1678251..1678372,1679513..1679602,1736985..1737107,
FT                   1740953..1741072,1742026..1742145,1743215..1743334,
FT                   1747759..1747882,1747967..1748162,1754766..1755348)
FT                   /gene="Efemp1"
FT                   /locus_tag="mCG_147809"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 1"
FT                   /note="gene_id=mCG147809.0 transcript_id=mCT188072.1
FT                   created on 29-SEP-2004"
FT   CDS             join(<1678252..1678372,1679513..1679602,1736985..1737107,
FT                   1740953..1741072,1742026..1742145,1743215..1743334,
FT                   1747759..1747882,1747967..1748162,1754766..1754927)
FT                   /codon_start=1
FT                   /gene="Efemp1"
FT                   /locus_tag="mCG_147809"
FT                   /product="epidermal growth factor-containing fibulin-like
FT                   extracellular matrix protein 1"
FT                   /note="gene_id=mCG147809.0 transcript_id=mCT188072.1
FT                   protein_id=mCP108532.1"
FT                   /protein_id="EDL23815.1"
FT                   /translation="LFPPPVAAAAARPRQFRPTRLPSPTHSFAARAGKLRGPPAENHDV
FT                   ANTFPNYADSGAGQVTVHRGNHHIHDIDECTSGTHNCRTDQVCINLRGSFTCQCLPGYQ
FT                   KRGEQCVDIDECTVPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCA
FT                   QQCYNILGSFICQCNQGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGY
FT                   EVVRSRTCQDINECETTNECREDEMCWNYHGGFRCYPRNPCQDHYVLTSENRCVCPVSN
FT                   TMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQT
FT                   SPVSAMLVLVKSLSGPREYIVDLEMLTVSSIGTFRTSSVLRLTIIVGPFSF"
FT   gene            1785885..1787023
FT                   /pseudo
FT                   /locus_tag="mCG_49023"
FT                   /note="gene_id=mCG49023.2"
FT   mRNA            1785885..1787023
FT                   /pseudo
FT                   /locus_tag="mCG_49023"
FT                   /note="gene_id=mCG49023.2 transcript_id=mCT49206.2 created
FT                   on 30-MAY-2002"
FT   gene            <1945228..1978087
FT                   /gene="Pnpt1"
FT                   /locus_tag="mCG_13431"
FT                   /note="gene_id=mCG13431.3"
FT   mRNA            join(<1945228..1945402,1947329..1947389,1948336..1948410,
FT                   1949084..1949189,1949995..1950044,1952555..1952618,
FT                   1952712..1952759,1953612..1953725,1953874..1954060,
FT                   1954680..1954731,1955404..1955461,1956681..1956777,
FT                   1957121..1957223,1960827..1960897,1962215..1962251,
FT                   1962709..1962775,1962855..1962944,1964872..1964925,
FT                   1969727..1970711,1970798..1970861,1971312..1971395,
FT                   1972301..1972384,1973424..1973530,1973612..1973667,
FT                   1975817..1975895,1976650..1976697,1977820..1978087)
FT                   /gene="Pnpt1"
FT                   /locus_tag="mCG_13431"
FT                   /product="polyribonucleotide nucleotidyltransferase 1,
FT                   transcript variant mCT191881"
FT                   /note="gene_id=mCG13431.3 transcript_id=mCT191881.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1945230..1945402,1947329..1947389,1948336..1948410,
FT                   1949084..1949189,1949995..1950044,1952555..1952618,
FT                   1952712..1952759,1953612..1953725,1953874..1954060,
FT                   1954680..1954731,1955404..1955461,1956681..1956777,
FT                   1957121..1957223,1960827..1960897,1962215..1962251,
FT                   1962709..1962775,1962855..1962944,1964872..1964925,
FT                   1969727..1969875)
FT                   /codon_start=1
FT                   /gene="Pnpt1"
FT                   /locus_tag="mCG_13431"
FT                   /product="polyribonucleotide nucleotidyltransferase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13431.3 transcript_id=mCT191881.0
FT                   protein_id=mCP112838.0 isoform=CRA_b"
FT                   /protein_id="EDL23814.1"
FT                   /translation="ALGVMAACRLCCLCPCLRPLGCGPLGRPGRNRALSYLQMRALWSS
FT                   TGSRAVTVDLGHRKLEISSGKLARFADGCAVIQSGDTAVMVTAVSKTKASPSQFMPLVV
FT                   DYRQKAAAAGRIPTNYLRREIGSSDREVLTSRVIDRSIRPLFPAGYFYDTQVLCNLLAV
FT                   DGINEPDILAVNGASVALSLSDIPWNGPVGAVRIGMIDGECVVNPTRREMSSSTLNLVV
FT                   AGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKEIGVAKRTPQKIF
FT                   TPSAEIVKYTKIIAMEKLYAVFTDYEHDKVSRDEAVNKIRLDTEEHLKEKFPEVDQFEI
FT                   IESFNIVAKEVFRSIILNEYKRCDGRDLTSLRNISCEVDMFKTLHGSALFQRGQTQVLC
FT                   TVTFDSLESSIKSDQIITAINGVKDKNFMLHYEFPPYATNETGKVTGVNRRELGHGALA
FT                   EKALCPVIPKDFPFTIRVTSEVLESNGSSSMASACGGSLALMDAGVPISSAVAGVAVGL
FT                   VTKTNPEKGEIEDYRLLTDILASIFPVLNIYKYI"
FT   mRNA            join(1945235..1945402,1947329..1947389,1948336..1948410,
FT                   1949084..1949189,1949995..1950044,1952555..1952618,
FT                   1952712..1952759,1953612..1953725,1953874..1954060,
FT                   1954680..1954731,1955404..1955461,1956681..1956777,
FT                   1957121..1957223,1960827..1960897,1962215..1962251,
FT                   1962709..1962775,1962855..1962944,1964872..1964925,
FT                   1969727..1969833,1970640..1970711,1970798..1970861,
FT                   1971312..1971395,1972301..1972384,1973424..1973530,
FT                   1973612..1973667,1975817..1975895,1976650..1976697,
FT                   1977820..1978087)
FT                   /gene="Pnpt1"
FT                   /locus_tag="mCG_13431"
FT                   /product="polyribonucleotide nucleotidyltransferase 1,
FT                   transcript variant mCT11694"
FT                   /note="gene_id=mCG13431.3 transcript_id=mCT11694.3 created
FT                   on 10-DEC-2002"
FT   CDS             join(1945242..1945402,1947329..1947389,1948336..1948410,
FT                   1949084..1949189,1949995..1950044,1952555..1952618,
FT                   1952712..1952759,1953612..1953725,1953874..1954060,
FT                   1954680..1954731,1955404..1955461,1956681..1956777,
FT                   1957121..1957223,1960827..1960897,1962215..1962251,
FT                   1962709..1962775,1962855..1962944,1964872..1964925,
FT                   1969727..1969833,1970640..1970711,1970798..1970861,
FT                   1971312..1971395,1972301..1972384,1973424..1973530,
FT                   1973612..1973667,1975817..1975895,1976650..1976697,
FT                   1977820..1977975)
FT                   /codon_start=1
FT                   /gene="Pnpt1"
FT                   /locus_tag="mCG_13431"
FT                   /product="polyribonucleotide nucleotidyltransferase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13431.3 transcript_id=mCT11694.3
FT                   protein_id=mCP2372.3 isoform=CRA_a"
FT                   /protein_id="EDL23813.1"
FT                   /translation="MAACRLCCLCPCLRPLGCGPLGRPGRNRALSYLQMRALWSSTGSR
FT                   AVTVDLGHRKLEISSGKLARFADGCAVIQSGDTAVMVTAVSKTKASPSQFMPLVVDYRQ
FT                   KAAAAGRIPTNYLRREIGSSDREVLTSRVIDRSIRPLFPAGYFYDTQVLCNLLAVDGIN
FT                   EPDILAVNGASVALSLSDIPWNGPVGAVRIGMIDGECVVNPTRREMSSSTLNLVVAGAP
FT                   KSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKEIGVAKRTPQKIFTPSA
FT                   EIVKYTKIIAMEKLYAVFTDYEHDKVSRDEAVNKIRLDTEEHLKEKFPEVDQFEIIESF
FT                   NIVAKEVFRSIILNEYKRCDGRDLTSLRNISCEVDMFKTLHGSALFQRGQTQVLCTVTF
FT                   DSLESSIKSDQIITAINGVKDKNFMLHYEFPPYATNETGKVTGVNRRELGHGALAEKAL
FT                   CPVIPKDFPFTIRVTSEVLESNGSSSMASACGGSLALMDAGVPISSAVAGVAVGLVTKT
FT                   NPEKGEIEDYRLLTDILGIEDYNGDMDFKIAGTNKGITALQADIKLPGVPIKIIMEAIQ
FT                   QASVAKKEILQIMNKTISKPRASRKENGPVVETVKVPLSKRAKFVGPGGYHLKKLQAET
FT                   GVTISQVDEETFSIFAPTPTAMHEARDFITEICRDDQEQQLEFGAVYTATITEIRDTGV
FT                   MVKLYPNMTAVLLHNSQLDQRKIKHPTALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQ
FT                   SPATTALKTLNDRSSIVMGEPVSQSSNSNP"
FT   gene            complement(1986063..>1988851)
FT                   /gene="A630052C17Rik"
FT                   /locus_tag="mCG_117961"
FT                   /note="gene_id=mCG117961.2"
FT   mRNA            complement(join(1986063..1986150,1986195..1988243,
FT                   1988688..1988830))
FT                   /gene="A630052C17Rik"
FT                   /locus_tag="mCG_117961"
FT                   /product="RIKEN cDNA A630052C17, transcript variant
FT                   mCT119108"
FT                   /note="gene_id=mCG117961.2 transcript_id=mCT119108.1
FT                   created on 29-MAY-2002"
FT   mRNA            complement(join(1986622..1988240,1988688..>1988851))
FT                   /gene="A630052C17Rik"
FT                   /locus_tag="mCG_117961"
FT                   /product="RIKEN cDNA A630052C17, transcript variant
FT                   mCT191887"
FT                   /note="gene_id=mCG117961.2 transcript_id=mCT191887.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1987949..1988240,1988688..>1988827))
FT                   /codon_start=1
FT                   /gene="A630052C17Rik"
FT                   /locus_tag="mCG_117961"
FT                   /product="RIKEN cDNA A630052C17, isoform CRA_a"
FT                   /note="gene_id=mCG117961.2 transcript_id=mCT191887.0
FT                   protein_id=mCP112835.0 isoform=CRA_a"
FT                   /protein_id="EDL23811.1"
FT                   /translation="SEYSTGAQRLTLRLCRNRCTIPYPTVPIPLPSDSARTSSDIPLSS
FT                   STFVRAALAGATAADESNAQYLYLRTHFRRVRPRRSREECAAEVSRPRRDFLLFRPRFL
FT                   IRESQLGGEVPRAFLPAPGGSVCRRLPWRWCCGVVLRDL"
FT   CDS             complement(join(1987998..1988243,1988688..1988774))
FT                   /codon_start=1
FT                   /gene="A630052C17Rik"
FT                   /locus_tag="mCG_117961"
FT                   /product="RIKEN cDNA A630052C17, isoform CRA_b"
FT                   /note="gene_id=mCG117961.2 transcript_id=mCT119108.1
FT                   protein_id=mCP58640.1 isoform=CRA_b"
FT                   /protein_id="EDL23812.1"
FT                   /translation="MHYPLPHRSNTLTVGLGTNQQRHPLELLYQVRTGCPSRGYGGRRV
FT                   QRTVPLPPNTLPESQTSAISRGVRRRGEPAKEGLPPLSAPLPDSGISVGRGSPASFSTC
FT                   AGRKRV"
FT   gene            1988255..2037691
FT                   /gene="AW011752"
FT                   /locus_tag="mCG_13444"
FT                   /note="gene_id=mCG13444.2"
FT   mRNA            join(1988255..1988736,1989959..1990014,1999411..1999509,
FT                   2004917..2005540,2011535..2011612,2013136..2013252,
FT                   2014030..2014146,2015745..2015876,2017744..2017846,
FT                   2019909..2019950,2022541..2022699,2026327..2026496,
FT                   2028144..2028283,2028635..2028819,2030622..2030824,
FT                   2035364..2035593,2037458..2037691)
FT                   /gene="AW011752"
FT                   /locus_tag="mCG_13444"
FT                   /product="expressed sequence AW011752, transcript variant
FT                   mCT169611"
FT                   /note="gene_id=mCG13444.2 transcript_id=mCT169611.1 created
FT                   on 13-DEC-2002"
FT   mRNA            join(1988255..1988736,1989959..1990014,1999411..1999509,
FT                   2004917..2005540,2011535..2011612,2013136..2013252,
FT                   2014030..2014146,2015745..2015876,2017744..2017846,
FT                   2019909..2019950,2022541..2022699,2026327..2026496,
FT                   2028144..2028283,2028635..2028819,2030622..2030824,
FT                   2035364..2037688)
FT                   /gene="AW011752"
FT                   /locus_tag="mCG_13444"
FT                   /product="expressed sequence AW011752, transcript variant
FT                   mCT11709"
FT                   /note="gene_id=mCG13444.2 transcript_id=mCT11709.2 created
FT                   on 13-DEC-2002"
FT   CDS             join(1988595..1988736,1989959..1990014,1999411..1999509,
FT                   2004917..2005540,2011535..2011612,2013136..2013252,
FT                   2014030..2014146,2015745..2015876,2017744..2017846,
FT                   2019909..2019950,2022541..2022699,2026327..2026496,
FT                   2028144..2028283,2028635..2028819,2030622..2030824,
FT                   2035364..2035459)
FT                   /codon_start=1
FT                   /gene="AW011752"
FT                   /locus_tag="mCG_13444"
FT                   /product="expressed sequence AW011752, isoform CRA_a"
FT                   /note="gene_id=mCG13444.2 transcript_id=mCT11709.2
FT                   protein_id=mCP2386.2 isoform=CRA_a"
FT                   /protein_id="EDL23807.1"
FT                   /translation="MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAE
FT                   SDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKD
FT                   PSVEVTQDLIDESEEERFEEMPETSHLIDLPTCELSKLEEIADLVTSVLSSPIRREKLA
FT                   LALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDV
FT                   VGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPS
FT                   VFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEF
FT                   CAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVR
FT                   EFVMQEAQQSDDDVLLINVVIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTE
FT                   KSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDNMLGSNTTNTICPDNYQTAQLLALILE
FT                   LLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRY
FT                   ITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVENFYKALESIE
FT                   YVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDDDEEGK
FT                   AVITPVEKSKTEDDFPDSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNG
FT                   TNSTNSKSVVSQTTPASSNVASSKTTSLATSVTATKGNLVGLVDYPDDEEEDEEEESSP
FT                   RKRPRLGS"
FT   CDS             join(1988595..1988736,1989959..1990014,1999411..1999509,
FT                   2004917..2005540,2011535..2011612,2013136..2013252,
FT                   2014030..2014146,2015745..2015876,2017744..2017846,
FT                   2019909..2019950,2022541..2022699,2026327..2026496,
FT                   2028144..2028283,2028635..2028819,2030622..2030824,
FT                   2035364..2035459)
FT                   /codon_start=1
FT                   /gene="AW011752"
FT                   /locus_tag="mCG_13444"
FT                   /product="expressed sequence AW011752, isoform CRA_a"
FT                   /note="gene_id=mCG13444.2 transcript_id=mCT169611.1
FT                   protein_id=mCP92494.1 isoform=CRA_a"
FT                   /protein_id="EDL23808.1"
FT                   /translation="MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAE
FT                   SDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKD
FT                   PSVEVTQDLIDESEEERFEEMPETSHLIDLPTCELSKLEEIADLVTSVLSSPIRREKLA
FT                   LALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDV
FT                   VGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPS
FT                   VFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEF
FT                   CAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVR
FT                   EFVMQEAQQSDDDVLLINVVIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTE
FT                   KSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDNMLGSNTTNTICPDNYQTAQLLALILE
FT                   LLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRY
FT                   ITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVENFYKALESIE
FT                   YVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDDDEEGK
FT                   AVITPVEKSKTEDDFPDSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNG
FT                   TNSTNSKSVVSQTTPASSNVASSKTTSLATSVTATKGNLVGLVDYPDDEEEDEEEESSP
FT                   RKRPRLGS"
FT   mRNA            join(1989031..1989093,1989959..1990014,1999411..1999509,
FT                   2004917..2005540,2011535..2011612,2013136..2013252,
FT                   2014030..2014146,2015745..2015876,2017744..2017846,
FT                   2019909..2019950,2022541..2022699,2026327..2026496,
FT                   2028144..2028283,2028635..2028819,2030622..2030824,
FT                   2035364..2037688)
FT                   /gene="AW011752"
FT                   /locus_tag="mCG_13444"
FT                   /product="expressed sequence AW011752, transcript variant
FT                   mCT169612"
FT                   /note="gene_id=mCG13444.2 transcript_id=mCT169612.1 created
FT                   on 13-DEC-2002"
FT   CDS             join(1989066..1989093,1989959..1990014,1999411..1999509,
FT                   2004917..2005540,2011535..2011612,2013136..2013252,
FT                   2014030..2014146,2015745..2015876,2017744..2017846,
FT                   2019909..2019950,2022541..2022699,2026327..2026496,
FT                   2028144..2028283,2028635..2028819,2030622..2030824,
FT                   2035364..2035459)
FT                   /codon_start=1
FT                   /gene="AW011752"
FT                   /locus_tag="mCG_13444"
FT                   /product="expressed sequence AW011752, isoform CRA_b"
FT                   /note="gene_id=mCG13444.2 transcript_id=mCT169612.1
FT                   protein_id=mCP92489.1 isoform=CRA_b"
FT                   /protein_id="EDL23809.1"
FT                   /translation="MTPDSRAALGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALS
FT                   FQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEERFEEMPETSHLIDLPTCELSKL
FT                   EEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGI
FT                   LFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELR
FT                   QKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQ
FT                   LTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQ
FT                   VRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDVLLINVVIEQMICDTDPELGGAVQL
FT                   MGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDNMLGSN
FT                   TTNTICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLA
FT                   LCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVE
FT                   DIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRD
FT                   AKALEEDEEMWFNEDDDEEGKAVITPVEKSKTEDDFPDSYEKFMETKKAKESEDKENLP
FT                   KRASSGGFKFTFSHSPSATNGTNSTNSKSVVSQTTPASSNVASSKTTSLATSVTATKGN
FT                   LVGLVDYPDDEEEDEEEESSPRKRPRLGS"
FT   gene            complement(1996127..1997225)
FT                   /locus_tag="mCG_117952"
FT                   /note="gene_id=mCG117952.0"
FT   mRNA            complement(1996127..1997225)
FT                   /locus_tag="mCG_117952"
FT                   /product="mCG117952"
FT                   /note="gene_id=mCG117952.0 transcript_id=mCT119099.0
FT                   created on 29-MAY-2002"
FT   CDS             complement(1996468..1997127)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117952"
FT                   /product="mCG117952"
FT                   /note="gene_id=mCG117952.0 transcript_id=mCT119099.0
FT                   protein_id=mCP58708.1"
FT                   /protein_id="EDL23810.1"
FT                   /translation="MSHLVEPPPPLHNNNNNNCEEGEQPLPPPAGLNSSWVELPMNSSN
FT                   GNENGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQI
FT                   MFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKR
FT                   AASLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY"
FT   gene            complement(2038446..2066051)
FT                   /gene="Ccdc104"
FT                   /locus_tag="mCG_13433"
FT                   /note="gene_id=mCG13433.2"
FT   mRNA            complement(join(2038446..2038900,2039349..2039498,
FT                   2039659..2039798,2042774..2042876,2046819..2046870,
FT                   2047497..2047584,2051269..2051383,2062700..2062801,
FT                   2063727..2063791,2065656..2066051))
FT                   /gene="Ccdc104"
FT                   /locus_tag="mCG_13433"
FT                   /product="coiled-coil domain containing 104, transcript
FT                   variant mCT11693"
FT                   /note="gene_id=mCG13433.2 transcript_id=mCT11693.3 created
FT                   on 13-DEC-2002"
FT   mRNA            complement(join(2038446..2038900,2039349..2039498,
FT                   2039659..2039798,2042774..2042876,2046819..2046870,
FT                   2047497..2047584,2053949..2054063,2062700..2062801,
FT                   2063727..2063791,2065656..2066051))
FT                   /gene="Ccdc104"
FT                   /locus_tag="mCG_13433"
FT                   /product="coiled-coil domain containing 104, transcript
FT                   variant mCT169610"
FT                   /note="gene_id=mCG13433.2 transcript_id=mCT169610.1 created
FT                   on 13-DEC-2002"
FT   CDS             complement(join(2038799..2038900,2039349..2039498,
FT                   2039659..2039798,2042774..2042876,2046819..2046870,
FT                   2047497..2047584,2051269..2051383,2062700..2062801,
FT                   2063727..2063791,2065656..2065770))
FT                   /codon_start=1
FT                   /gene="Ccdc104"
FT                   /locus_tag="mCG_13433"
FT                   /product="coiled-coil domain containing 104, isoform CRA_a"
FT                   /note="gene_id=mCG13433.2 transcript_id=mCT11693.3
FT                   protein_id=mCP2393.3 isoform=CRA_a"
FT                   /protein_id="EDL23805.1"
FT                   /translation="MAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEE
FT                   SKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAE
FT                   DFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLTDGADVVSDLEQEEMKILREVLRK
FT                   SKEEYDQEEERKRKKQSSEAKMEELPVYTSEAEKMSNSQGDGEHFVQPPSEVKVHFANQ
FT                   SVQPLARKMELLPETSSLTQKGLKIPGLEHASMEGPIANLSALGTEELRQREHYLKQKR
FT                   DKLLSMRKDTRTKQIQNTEQKGKPTREAEEMTEKPEMTAEEKQTLLKRRLLAEKLKEEV
FT                   INK"
FT   CDS             complement(join(2038799..2038900,2039349..2039498,
FT                   2039659..2039798,2042774..2042876,2046819..2046870,
FT                   2047497..2047584,2053949..2054063,2062700..2062801,
FT                   2063727..2063791,2065656..2065770))
FT                   /codon_start=1
FT                   /gene="Ccdc104"
FT                   /locus_tag="mCG_13433"
FT                   /product="coiled-coil domain containing 104, isoform CRA_b"
FT                   /note="gene_id=mCG13433.2 transcript_id=mCT169610.1
FT                   protein_id=mCP92493.1 isoform=CRA_b"
FT                   /protein_id="EDL23806.1"
FT                   /translation="MAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEE
FT                   SKLTYTEIHQEYKELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAE
FT                   DFTIFKAMMVQKNIEMQLQAIRIIQERNGVLPDCLTDGADVVSDLEQEEMKILREVLRK
FT                   SKEEYDQEEERKRKKQSSEAKMEELPVYTSEAEKMSNSQGDGEHFVQPPSEVKVHFANQ
FT                   SVQPLARKMELLPETSSLTQKGLKIPGLEHASMEGPIANLSALGTEELRQREHYLKQKR
FT                   DKLLSMRKDTRTKQIQNTEQKGKPTREAEEMTEKPEMTAEEKQTLLKRRLLAEKLKEEV
FT                   INK"
FT   gene            complement(2146151..2146833)
FT                   /pseudo
FT                   /locus_tag="mCG_1039747"
FT                   /note="gene_id=mCG1039747.1"
FT   mRNA            complement(2146151..2146833)
FT                   /pseudo
FT                   /locus_tag="mCG_1039747"
FT                   /note="gene_id=mCG1039747.1 transcript_id=mCT157451.1
FT                   created on 10-DEC-2002"
FT   gene            2190591..2357914
FT                   /locus_tag="mCG_13426"
FT                   /note="gene_id=mCG13426.1"
FT   mRNA            join(2190591..2190987,2191084..2191184,2216773..2216881,
FT                   2239213..2239282,2241444..2241502,2246054..2246137,
FT                   2246834..2246974,2259824..2259996,2264967..2265090,
FT                   2267168..2267314,2268274..2268418,2272644..2272828,
FT                   2273506..2273643,2274915..2275985,2277406..2277533,
FT                   2282112..2282253,2289099..2289263,2292293..2292454,
FT                   2293937..2294214,2294426..2294569,2297865..2298051,
FT                   2301821..2301966,2306259..2306473,2310788..2310991,
FT                   2311714..2311785,2315964..2316064,2316265..2317196,
FT                   2342317..2342383,2342969..2343080,2345608..2345779,
FT                   2346214..2346374,2347473..2347649,2349208..2349347,
FT                   2351044..2351168,2352440..2352644,2352981..2353233,
FT                   2353715..2353873,2354717..2354881,2356639..2356779,
FT                   2357282..2357914)
FT                   /locus_tag="mCG_13426"
FT                   /product="mCG13426"
FT                   /note="gene_id=mCG13426.1 transcript_id=mCT11688.1 created
FT                   on 29-MAY-2002"
FT   CDS             join(2190925..2190987,2191084..2191184,2216773..2216881,
FT                   2239213..2239282,2241444..2241502,2246054..2246137,
FT                   2246834..2246974,2259824..2259996,2264967..2265090,
FT                   2267168..2267314,2268274..2268418,2272644..2272828,
FT                   2273506..2273643,2274915..2275985,2277406..2277533,
FT                   2282112..2282253,2289099..2289263,2292293..2292454,
FT                   2293937..2294214,2294426..2294569,2297865..2298051,
FT                   2301821..2301966,2306259..2306473,2310788..2310991,
FT                   2311714..2311785,2315964..2316064,2316265..2317196,
FT                   2342317..2342383,2342969..2343080,2345608..2345779,
FT                   2346214..2346374,2347473..2347649,2349208..2349347,
FT                   2351044..2351168,2352440..2352644,2352981..2353233,
FT                   2353715..2353873,2354717..2354881,2356639..2356779,
FT                   2357282..2357454)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13426"
FT                   /product="mCG13426"
FT                   /note="gene_id=mCG13426.1 transcript_id=mCT11688.1
FT                   protein_id=mCP2368.2"
FT                   /protein_id="EDL23802.1"
FT                   /translation="MENEIFTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALVDG
FT                   VFLNQVMLQINPKSESQRVNKKVNNDASLRIHNLSILVKQIKFYYQETLQQLIMMPLPD
FT                   ILIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEEFIEKIQGLDFDTKAAVAAHIQEV
FT                   THNQENVFDLQWMEVTDMSQEDIEPLLKNMVSHLRRLIDERDEHSETIVELSEERDGVH
FT                   FLPHASSSAQSPCGSPGMKRTESRQHLSVELADAKAKIRRLRQELMYRDELDALREKAV
FT                   RVDKLESELSRYKERLHDIEFYKARVEELKEDNQVLLETKTMLEDQLEGTRARSDKLHE
FT                   LEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISR
FT                   TSELAEAPQKSLGHEVNELTSSKLLKLEMENQSLTKTVEELRSTADSAAGSTSKILKVE
FT                   KENQRLNKKVEILENEIIQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKIL
FT                   EQENEHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETCGKLSKIEFEKRQMKK
FT                   ELELYKEKGERAEELENELNHLGKENELLQKKITNLKITCEKLETLEQENSELERENRK
FT                   FKKTLDSFKNLTFQLESLEKENSQLDEENLELRRSVESLKCASMRMAQLQLENKELESE
FT                   KEQLRKGLELMRASFKKTERLEVSYQGLDTENQRLQKALENSNKKIQQLESELQDLEME
FT                   NQTLQKSLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKRLRQQAEIKDTT
FT                   LEENNVKIGNLEKENKTLFKEINVYKESCVRLKELEKENKELVKRATIDIKTLVTLRED
FT                   LVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESKLESTLKKSL
FT                   EIKEEKIAALEARLEESTNYNQQLRHELKTVKKNYEALKQRQDEERMVQSSIPVSGEDD
FT                   KWGRESQEATRELLKVKDRLIEVERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQ
FT                   RQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSLMNQNAQLLIQQSSLENENESIMKER
FT                   EDLKSLYDALIKDHEKLELLHERQASEYESLISKHGTLKSAHKNLEVEHKDLEDRYNQL
FT                   LKQKGQLEDLEKMIKTEQEKMLLESKNHEVVASEYKKLCGENDRLNYTYSQLLKETEIL
FT                   QMDHKNLKSVLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEE
FT                   NRHLLDQIQTLMLQNRTLLEQNMESKDLFHVEQRQYMRGNWITLKMRKLIKSKKDINRE
FT                   RQKSLTLTPTRSDSSEGFLQLPHQDSQDSSSVGSNSLEDGQTLGTKKSSTMNDLVQSMV
FT                   LAGGQWTGSTENLEVPDDISTGKRRKELGAMAFSTTAINFSTVNSSAAFRSKQLVNNKD
FT                   TTSFEDISPQGISDDSSTGSRVHESRAHHKMKAGSPGSEVVTLQQFLEESNKLTSIQLK
FT                   SSSQENLLDEVMKSLSVSSDFLGKDKPVSCTLARSVSGKTPGDFYDRRTTKPEFLRTGP
FT                   QKTEDAYTISSAGKPTPSTQGKIKLVKETSVSRQSKDSNPYATLPRASSVISTAEGTTR
FT                   RTSIHDFLSKDSRLPVSVDSSPPTAGSSSTTASSEYHLQQWSSDMPTHSEDTSESVYTQ
FT                   ARNSSSGRPCFLNQTFATVKMSNDTFGISGNDSHETFSVVHSSQPFLSLNTELVSNISG
FT                   LPPKSPLTRITGQTFASLDKTAQKDNKHFSDSQNPSHSKTQFSEDSDLIIPACLYPDDT
FT                   DVALSVSEDSQIVWRNMNRKLLKLENLLRFHTICRQEKRPPRSQLSPVKTKKEVEVWVG
FT                   MTVEDLASAMAKDIDCVYEALLNTAIDVDSLEANSHLDEVWIKEVIKKAGMKLKWSKLK
FT                   QERIRENKDAVRRPGTDPALLKPRSPVVTVMGHVDHGKTTLLDKLRETQVAAMEVGGIT
FT                   QHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESI
FT                   QHAKDAEVPIILAINKCDKTDADPEKVKKELLAYDVVCEEYGGDVQAVHVSALTGDNLM
FT                   ALAEATIALAEILELKADPTGPVEGTVIESFTDKGRGPVTTAIIQRGTLRKGSILVAGK
FT                   SWAKVRLIFDENGKILNEAYPSMPVGIIGWRDLPSAGDEILEVESEPRAREVIEWRKSE
FT                   QKEEKGKDDLKIMEEKRREHQEAHRKAREKYGSLHWKERSYIKFLERKQQRPLKPKEKV
FT                   ERQSNVLPIIIKGDVDGSVEAILNLLDTYDASHECELELVHFGLGDISENDVTFAETFD
FT                   GKDSVGCVIYGFNVEAGSAIQQSAAQKGVKIKLHKIIYHLIEDLQEELSSRLPHTLEEY
FT                   PIGEASILATFTVTEGKKKIPVAGCRVQKGQLERHKKFKLIRNGQVIWKGSLTSLKHHK
FT                   DDISVIKTGMDCGLSLDEEKVEFKPGDQVICYEENKVPTKTSWDPGF"
FT   gene            complement(2325277..2327429)
FT                   /gene="2010316F05Rik"
FT                   /locus_tag="mCG_13428"
FT                   /note="gene_id=mCG13428.1"
FT   mRNA            complement(join(2325277..2326072,2327310..2327429))
FT                   /gene="2010316F05Rik"
FT                   /locus_tag="mCG_13428"
FT                   /product="RIKEN cDNA 2010316F05, transcript variant
FT                   mCT11690"
FT                   /note="gene_id=mCG13428.1 transcript_id=mCT11690.1 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(2325277..2326072,2326828..2326918,
FT                   2327310..2327428))
FT                   /gene="2010316F05Rik"
FT                   /locus_tag="mCG_13428"
FT                   /product="RIKEN cDNA 2010316F05, transcript variant
FT                   mCT169934"
FT                   /note="gene_id=mCG13428.1 transcript_id=mCT169934.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(2325647..2326072,2327310..2327393))
FT                   /codon_start=1
FT                   /gene="2010316F05Rik"
FT                   /locus_tag="mCG_13428"
FT                   /product="RIKEN cDNA 2010316F05, isoform CRA_a"
FT                   /note="gene_id=mCG13428.1 transcript_id=mCT11690.1
FT                   protein_id=mCP2388.1 isoform=CRA_a"
FT                   /protein_id="EDL23803.1"
FT                   /translation="MAGSELRAELEQRLGALAIRTEVVEHPEVFTIEEMMPHIQHLKGA
FT                   HSKNLFLKDKKKKNYWLVTVLHDRQINLNDLGKQLGVGSGNLRFADETAMLEKLKVGQG
FT                   CATPLSLFCDDGDVKFVLDSAFLEGGHEKVYFHPMTNAATMGLSPEDFLIFVKATGHDP
FT                   IILNFD"
FT   CDS             complement(2325647..2326054)
FT                   /codon_start=1
FT                   /gene="2010316F05Rik"
FT                   /locus_tag="mCG_13428"
FT                   /product="RIKEN cDNA 2010316F05, isoform CRA_b"
FT                   /note="gene_id=mCG13428.1 transcript_id=mCT169934.0
FT                   protein_id=mCP92491.0 isoform=CRA_b"
FT                   /protein_id="EDL23804.1"
FT                   /translation="MMPHIQHLKGAHSKNLFLKDKKKKNYWLVTVLHDRQINLNDLGKQ
FT                   LGVGSGNLRFADETAMLEKLKVGQGCATPLSLFCDDGDVKFVLDSAFLEGGHEKVYFHP
FT                   MTNAATMGLSPEDFLIFVKATGHDPIILNFD"
FT   gene            complement(2358213..2360475)
FT                   /locus_tag="mCG_13441"
FT                   /note="gene_id=mCG13441.2"
FT   mRNA            complement(join(2358213..2358395,2358657..2358788,
FT                   2359069..2359154,2359572..2359626,2360047..2360111,
FT                   2360207..2360475))
FT                   /locus_tag="mCG_13441"
FT                   /product="mCG13441"
FT                   /note="gene_id=mCG13441.2 transcript_id=mCT11703.3 created
FT                   on 13-DEC-2002"
FT   CDS             complement(join(2358246..2358395,2358657..2358788,
FT                   2359069..2359154,2359572..2359626,2360047..2360094))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13441"
FT                   /product="mCG13441"
FT                   /note="gene_id=mCG13441.2 transcript_id=mCT11703.3
FT                   protein_id=mCP2375.2"
FT                   /db_xref="GOA:Q642L7"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1925544"
FT                   /db_xref="UniProtKB/TrEMBL:Q642L7"
FT                   /protein_id="EDL23801.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLK
FT                   YYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLTYCFNKPEDK"
FT   gene            2360314..2390441
FT                   /locus_tag="mCG_13432"
FT                   /note="gene_id=mCG13432.2"
FT   mRNA            join(2360314..2360506,2365881..2366139,2368414..2368634,
FT                   2370029..2370162,2372826..2373027,2373110..2373222,
FT                   2373748..2373832,2376227..2376333,2381453..2381627,
FT                   2383903..2384105,2387356..2387535,2390129..2390441)
FT                   /locus_tag="mCG_13432"
FT                   /product="mCG13432"
FT                   /note="gene_id=mCG13432.2 transcript_id=mCT11695.2 created
FT                   on 13-DEC-2002"
FT   CDS             join(2365963..2366139,2368414..2368634,2370029..2370162,
FT                   2372826..2373027,2373110..2373222,2373748..2373832,
FT                   2376227..2376333,2381453..2381627,2383903..2384105,
FT                   2387356..2387535,2390129..2390322)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13432"
FT                   /product="mCG13432"
FT                   /note="gene_id=mCG13432.2 transcript_id=mCT11695.2
FT                   protein_id=mCP2384.2"
FT                   /protein_id="EDL23800.1"
FT                   /translation="MSVQEVNTHAVLPPIVSRNDKEFLESIQRYITTETKRVGCKEEGP
FT                   ADEYYTIYRNVFDKFSATDRKIIFQVIDYVSAYKSILTAIKKEYDAFIETIKKGRRTAF
FT                   YLHGKLKVLAKEPAALVYHQRRAIQLEAKMRIIENNSTAIQLQIDQMKQLRMEYDKKEV
FT                   KLCAPSRQLWKPIPGMTLQDSVNLEALNKHKQYLEDKYIKLKQDMSTMYVPAQKKAELD
FT                   EEMVVLLNRRDIAENLKKDRQFRHQRLQVISHTLTPWMKQNMRISFQDVMERIRKTKAI
FT                   YGDDNIVDEIFEDDPNKKKEAIVMLHYIERFNDLISLGEYERAACFAANSPKRILQNTS
FT                   TMNKFKAIGKIRGKPLPLLLFFEAIFNTSQAFKRPINADLTMEGIKCGLSEERLDLVTH
FT                   WVTQEKLTFSEKAGDIIFAYGEQHTYHKPRCLALAQIIYNECGLHRKALLCLCKQGQIH
FT                   EAMEHIQQSKDINTDDLIQLITACPQIDLIRCLTQERNEKPPFLSFGLAVLHMFSVDMK
FT                   KVGMRLLQEVSKGEKDVIEHLVMSDLFCSLEKWQEIANICLQNGFKILFNDIMSILRSQ
FT                   AGVSEISEDDTTNIMEHVFW"
FT   gene            complement(2407501..2408300)
FT                   /pseudo
FT                   /locus_tag="mCG_49693"
FT                   /note="gene_id=mCG49693.2"
FT   mRNA            complement(2407501..2408300)
FT                   /pseudo
FT                   /locus_tag="mCG_49693"
FT                   /note="gene_id=mCG49693.2 transcript_id=mCT49876.2 created
FT                   on 28-MAY-2002"
FT   gene            complement(2418556..>2453241)
FT                   /locus_tag="mCG_145380"
FT                   /note="gene_id=mCG145380.0"
FT   mRNA            complement(join(2418556..2418829,2429389..2429537,
FT                   2453063..>2453241))
FT                   /locus_tag="mCG_145380"
FT                   /product="mCG145380"
FT                   /note="gene_id=mCG145380.0 transcript_id=mCT184804.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(2418806..2418829,2429389..2429537,
FT                   2453063..>2453120))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145380"
FT                   /product="mCG145380"
FT                   /note="gene_id=mCG145380.0 transcript_id=mCT184804.0
FT                   protein_id=mCP105849.0"
FT                   /protein_id="EDL23799.1"
FT                   /translation="HILPRPGITDESASEAPPVEPTLKEHIRRQCELEHSRGLRHRDKV
FT                   LDRQEEPSRKSPGLSRMEENSCTVDSYETAS"
FT   gene            2506497..2560130
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /note="gene_id=mCG13438.3"
FT   mRNA            join(2506497..2507248,2519070..2519126,2519946..2522306,
FT                   2550833..2551040,2553554..2553692,2558184..2558253,
FT                   2558695..2558741,2558890..2558948,2559182..2560130)
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, transcript variant mCT177217"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT177217.0 created
FT                   on 13-DEC-2002"
FT   mRNA            join(2506497..2507248,2519070..2519126,2550833..2551040,
FT                   2553554..2553692,2558184..2558253,2558695..2558741,
FT                   2558890..2558948,2559182..2560130)
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, transcript variant mCT169936"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT169936.1 created
FT                   on 12-DEC-2002"
FT   mRNA            join(2506497..2507248,2550833..2551040,2553554..2553692,
FT                   2558184..2558253,2558695..2558741,2558890..2558948,
FT                   2559182..2560130)
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, transcript variant mCT169935"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT169935.1 created
FT                   on 13-DEC-2002"
FT   mRNA            join(<2506503..2506579,2506702..2507248,2550833..2551040,
FT                   2553554..2553692,2558184..2558253,2558695..2558741,
FT                   2558890..2558948,2559182..2559306)
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, transcript variant mCT191880"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT191880.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2506547..2506579,2506702..2507248,2550833..2551040,
FT                   2553554..2553692,2558184..2558253,2558695..2558741,
FT                   2558890..2558948,2559182..2559224)
FT                   /codon_start=1
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, isoform CRA_e"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT191880.0
FT                   protein_id=mCP112840.0 isoform=CRA_e"
FT                   /protein_id="EDL23798.1"
FT                   /translation="GQGGWRISSAEKWPAAAVAAASSPTMEDVDQSSLVSSSADSPPRP
FT                   PPAFKYQFVTEPEDEEDEEDEEEEEDDEDLEELEVLERKPAAGLSAAPVPPAAAPLLDF
FT                   SSDSVPPAPRGPLPAAPPTAPERQPSWERSPAASAPSLPPAAAVLPSKLPEDDEPPARP
FT                   PAPAGASPLAEPAAPPSTPAAPKRRGSGSVVVDLLYWRDIKKTGVVFGASLFLLLSLTV
FT                   FSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYS
FT                   NSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSI
FT                   PVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAE"
FT   CDS             join(2506744..2507248,2519070..2519126,2519946..2522306,
FT                   2550833..2551040,2553554..2553692,2558184..2558253,
FT                   2558695..2558741,2558890..2558948,2559182..2559224)
FT                   /codon_start=1
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, isoform CRA_d"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT177217.0
FT                   protein_id=mCP100139.0 isoform=CRA_d"
FT                   /protein_id="EDL23797.1"
FT                   /translation="MEDVDQSSLVSSSADSPPRPPPAFKYQFVTEPEDEEDEEDEEEEE
FT                   DDEDLEELEVLERKPAAGLSAAPVPPAAAPLLDFSSDSVPPAPRGPLPAAPPTAPERQP
FT                   SWERSPAASAPSLPPAAAVLPSKLPEDDEPPARPPAPAGASPLAEPAAPPSTPAAPKRR
FT                   GSGSVDETLFALPAASEPVIPSSAEKIMDLKEQPGNTVSSGQEDFPSVLFETAASLPSL
FT                   SPLSTVSFKEHGYLGNLSAVASTEGTIEETLNEASRELPERATNPFVNRESAEFSVLEY
FT                   SEMGSSFNGSPKGESAMLVENTKEEVIVRSKDKEDLVCSAALHNPQESPATLTKVVKED
FT                   GVMSPEKTMDIFNEMKMSVVAPVREEYADFKPFEQAWEVKDTYEGSRDVLAARANMESK
FT                   VDKKCFEDSLEQKSHGKDSESRNENASFPSTPELVKDGSRAYITCDSFTSATESTAANI
FT                   FPVLEDHTSENKTDEKKIEERKAQIITEKTSPKTSNPFLVAIHDSEADYVTTDNLSKVT
FT                   EAVVATMPEGLTPDLVQEACESELNEATGTKIAYETKVDLVQTSEAIQESIYPTAQLCP
FT                   SFEEAEATPSPVLPDIVMEAPLNSLLPSTGASVAQPSASPLEVPSPVSYDGIKLEPENP
FT                   PPYEEAMSVALKTSDSKEEIKEPESFNAAVQEAEAPYISIACDLIKETKLSTEPSPEFS
FT                   NYSEIAKFEKSVPDHCELVDDSSPESEPVDLFSDDSIPEVPQTQEEAVMLMKESLTEVS
FT                   ETVTQHKHKERLSASPQEVGKPYLESFQPNLHITKDAASNEIPTLTKKETISLQMEEFN
FT                   TAIYSNDDLLSSKEDKMKESETFSDSSPIEIIDEFPTFVSAKDDSPKEYTDLEVSNKSE
FT                   IANVQSGANSLPCSELPCDLSFKNTYPKDEAHVSDEFSKSRSSVSKVPLLLPNVSALES
FT                   QIEMGNIVKPKVLTKEAEEKLPSDTEKEDRSLTAVLSAELNKTSVVDLLYWRDIKKTGV
FT                   VFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLE
FT                   SEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNG
FT                   LTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAE"
FT   CDS             join(2506744..2507248,2519070..2519126,2550833..2551040,
FT                   2553554..2553692,2558184..2558253,2558695..2558741,
FT                   2558890..2558948,2559182..2559224)
FT                   /codon_start=1
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, isoform CRA_c"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT169936.1
FT                   protein_id=mCP92492.1 isoform=CRA_c"
FT                   /protein_id="EDL23796.1"
FT                   /translation="MEDVDQSSLVSSSADSPPRPPPAFKYQFVTEPEDEEDEEDEEEEE
FT                   DDEDLEELEVLERKPAAGLSAAPVPPAAAPLLDFSSDSVPPAPRGPLPAAPPTAPERQP
FT                   SWERSPAASAPSLPPAAAVLPSKLPEDDEPPARPPAPAGASPLAEPAAPPSTPAAPKRR
FT                   GSGSVDETLFALPAASEPVIPSSAVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSV
FT                   TAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGH
FT                   VNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYER
FT                   HQAQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAE"
FT   CDS             join(2506744..2507248,2550833..2551040,2553554..2553692,
FT                   2558184..2558253,2558695..2558741,2558890..2558948,
FT                   2559182..2559224)
FT                   /codon_start=1
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, isoform CRA_b"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT169935.1
FT                   protein_id=mCP92490.1 isoform=CRA_b"
FT                   /protein_id="EDL23795.1"
FT                   /translation="MEDVDQSSLVSSSADSPPRPPPAFKYQFVTEPEDEEDEEDEEEEE
FT                   DDEDLEELEVLERKPAAGLSAAPVPPAAAPLLDFSSDSVPPAPRGPLPAAPPTAPERQP
FT                   SWERSPAASAPSLPPAAAVLPSKLPEDDEPPARPPAPAGASPLAEPAAPPSTPAAPKRR
FT                   GSGSVVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYK
FT                   GVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVD
FT                   SLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDA
FT                   MAKIQAKIPGLKRKAE"
FT   mRNA            join(2531988..2532300,2550833..2551040,2553554..2553692,
FT                   2558184..2558253,2558695..2558741,2558890..2558948,
FT                   2559182..2560130)
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, transcript variant mCT11700"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT11700.1 created
FT                   on 12-DEC-2002"
FT   CDS             join(2532267..2532300,2550833..2551040,2553554..2553692,
FT                   2558184..2558253,2558695..2558741,2558890..2558948,
FT                   2559182..2559224)
FT                   /codon_start=1
FT                   /gene="Rtn4"
FT                   /locus_tag="mCG_13438"
FT                   /product="reticulon 4, isoform CRA_a"
FT                   /note="gene_id=mCG13438.3 transcript_id=mCT11700.1
FT                   protein_id=mCP2395.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q78NS1"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="MGI:MGI:1915835"
FT                   /db_xref="UniProtKB/TrEMBL:Q78NS1"
FT                   /protein_id="EDL23794.1"
FT                   /translation="MDDQKKRWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVS
FT                   VTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALG
FT                   HVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYE
FT                   RHQAQIDHYLGLANKSVKDAMAKIQAKIPGLKRKAE"
FT   gene            complement(2560266..2848600)
FT                   /gene="C230094A16Rik"
FT                   /locus_tag="mCG_13435"
FT                   /note="gene_id=mCG13435.3"
FT   mRNA            complement(join(2560266..2561826,2563459..2563559,
FT                   2563969..2564122,2564641..2564744,2566148..2566310,
FT                   2566694..2566866,2568075..2568263,2569322..2569436,
FT                   2569950..2570107,2571734..2571942,2575938..2576111,
FT                   2579101..2579199,2580458..2580587,2582913..2582991,
FT                   2595647..2595773,2595886..2596087,2601979..2602155,
FT                   2603582..2603670,2610088..2610219,2610380..2610532,
FT                   2614384..2614525,2621591..2621718,2622217..2622328,
FT                   2624154..2624356,2624836..2624936,2628436..2628529,
FT                   2637464..2637569,2638028..2638214,2640761..2640879,
FT                   2650221..2650327,2652108..2652275,2657479..2657691,
FT                   2667870..2668126,2669876..2670013,2676593..2676794,
FT                   2703187..2703322,2704498..2704683,2715728..2715796,
FT                   2719684..2719782,2728712..2728871,2847039..2847759,
FT                   2848549..2848600))
FT                   /gene="C230094A16Rik"
FT                   /locus_tag="mCG_13435"
FT                   /product="RIKEN cDNA C230094A16, transcript variant
FT                   mCT11697"
FT                   /note="gene_id=mCG13435.3 transcript_id=mCT11697.3 created
FT                   on 25-JUN-2004"
FT   mRNA            complement(join(2560266..2561826,2563459..2563559,
FT                   2563969..2564122,2564641..2564744,2566148..2566310,
FT                   2566694..2566866,2568075..2568263,2569322..2569436,
FT                   2569950..2570107,2570296..2570449,2571734..2571942,
FT                   2575938..2576111,2579101..2579199,2580458..2580587,
FT                   2582913..2582991,2595647..2595773,2595886..2596087,
FT                   2601979..2602155,2603582..2603670,2610088..2610219,
FT                   2610380..2610532,2614384..2614525,2621591..2621718,
FT                   2622217..2622328,2624154..2624356,2624836..2624936,
FT                   2628436..2628529,2637464..2637569,2638028..2638214,
FT                   2640761..2640879,2650221..2650327,2652108..2652275,
FT                   2657479..2657691,2667870..2668126,2669876..2670013,
FT                   2676593..2676794,2703187..2703322,2704498..2704683,
FT                   2715728..2715796,2719684..2719782,2728712..2728871,
FT                   2847039..2847759,2848549..2848600))
FT                   /gene="C230094A16Rik"
FT                   /locus_tag="mCG_13435"
FT                   /product="RIKEN cDNA C230094A16, transcript variant
FT                   mCT191886"
FT                   /note="gene_id=mCG13435.3 transcript_id=mCT191886.1 created
FT                   on 25-JUN-2004"
FT   mRNA            complement(join(2560266..2561826,2563459..2563559,
FT                   2563969..2564122,2564641..2564744,2566148..2566310,
FT                   2566694..2566866,2568075..2568263,2569322..2569436,
FT                   2569950..2570107,2571734..2571942,2575938..2576111,
FT                   2577561..2577659,2579101..2579199,2580458..2580587,
FT                   2582913..2582991,2595647..2595773,2595886..2596087,
FT                   2601979..2602155,2603582..2603670,2610088..2610219,
FT                   2610380..2610532,2614384..2614525,2621591..2621718,
FT                   2622217..2622328,2624154..2624356,2624836..2624936,
FT                   2628436..2628529,2637464..2637569,2638028..2638214,
FT                   2640761..2640879,2650221..2650327,2652108..2652275,
FT                   2657479..2657691,2667870..2668126,2669876..2670013,
FT                   2676593..2676794,2703187..2703322,2704498..2704683,
FT                   2715728..2715796,2719684..2719782,2728712..2728871,
FT                   2847039..2847759,2848549..2848600))
FT                   /gene="C230094A16Rik"
FT                   /locus_tag="mCG_13435"
FT                   /product="RIKEN cDNA C230094A16, transcript variant
FT                   mCT11708"
FT                   /note="gene_id=mCG13435.3 transcript_id=mCT11708.3 created
FT                   on 25-JUN-2004"
FT   CDS             complement(join(2561802..2561826,2563459..2563559,
FT                   2563969..2564122,2564641..2564744,2566148..2566310,
FT                   2566694..2566866,2568075..2568263,2569322..2569436,
FT                   2569950..2570107,2571734..2571942,2575938..2576111,
FT                   2579101..2579199,2580458..2580587,2582913..2582991,
FT                   2595647..2595773,2595886..2596087,2601979..2602155,
FT                   2603582..2603670,2610088..2610219,2610380..2610532,
FT                   2614384..2614525,2621591..2621718,2622217..2622328,
FT                   2624154..2624356,2624836..2624936,2628436..2628529,
FT                   2637464..2637569,2638028..2638214,2640761..2640879,
FT                   2650221..2650327,2652108..2652275,2657479..2657691,
FT                   2667870..2668126,2669876..2670013,2676593..2676794,
FT                   2703187..2703322,2704498..2704683,2715728..2715796,
FT                   2719684..2719782,2728712..2728871,2847039..2847235))
FT                   /codon_start=1
FT                   /gene="C230094A16Rik"
FT                   /locus_tag="mCG_13435"
FT                   /product="RIKEN cDNA C230094A16, isoform CRA_a"
FT                   /note="gene_id=mCG13435.3 transcript_id=mCT11697.3
FT                   protein_id=mCP2394.3 isoform=CRA_a"
FT                   /protein_id="EDL23791.1"
FT                   /translation="MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGV
FT                   VYNTREHSQKFFLGHNDDIISLALHPDKTLIATGQVGKEPYICIWNSYNVHTVSILKDV
FT                   HTHGVACLAFDSDGQHLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQP
FT                   NRMVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTILCLACAKEDITYSGALNGDIYV
FT                   WKGLTLVRTIQGAHSAGIFSLYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGY
FT                   KGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLA
FT                   VTGSDDRSVRLWSLADHALIARCNMEEAVRSVSFSPDGSQLALGMKDGSFIVLRVRDMT
FT                   EVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECNKSLSFITHID
FT                   WSLDSKYLQTNDGAGERLFYKMPSGKPLTSKEEIKGIPWASWTCVRGPEVSGIWPKYTE
FT                   VIDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKKGAKFRKYVGHSAHVTNVRWSHDFQ
FT                   WVLSTGGADHSVFQWRFIPEAVSNGVLETTPQEGGADSYSEESDSDFSDVPELDSDIEQ
FT                   ETQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNL
FT                   FYTQAGEVVYHIAAVAVVYNRQQHAQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAV
FT                   HVWDTQTLKCLSLLKGHHQRGVCALDFSADGKCLVSVGLDDFHSVVFWDWKKGEKIATT
FT                   RGHKDKIFVVKCNPQHADKLVTVGIKHIKFWQQAGGGFTSKRGSFGSAGKLETMMCVSY
FT                   GRMEDLVFSGAATGDIFIWKDVLLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDD
FT                   MFERCLKTYAIKRTALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPM
FT                   TLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSSQHRMLAVRKLKKGGRCCAF
FT                   SPDGKALAVGLNDGSFLVVNADTVEDMLSFHHRKEMISDIKFSKDTGKYLAVASHDNFV
FT                   DIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAKEQLFFEAPRGRKHTIRPSE
FT                   AEKIKWDTWTCVLGPTCEGIWPAHSDVTDVNAANLTKDGSLLATGDDFGFVKLFSYPVK
FT                   GQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEES
FT                   DTDAEEDGGYDSDVAREKAIDYTTKIYAVSIREMEGTKPHQQLKEVSMEERPPVSRAAP
FT                   QPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLNDGADIIFHTAAAGIVQNL
FT                   STGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFH
FT                   TKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGTKVASRGGHLERIFVVEFRPDSDT
FT                   QFVSVGVKHMKFWTLAGSALLYKKGVIGSMEAAKMQTMLSVAFGANNLTFTGAINGDVY
FT                   VWKEHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAF
FT                   QLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKSAASNILIDGHMEGEIWGLATHP
FT                   SKDMFISASNDGTARIWDLADKKLLNKVNLGHAARCAAYSPDGEMVAIGMKNGEFVILL
FT                   VNTLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEQTVDFYDLTQGTSLNRIGYCKDIP
FT                   SFVIQMDFSADSKYIQVSTGAYKRQVHEVPLGKQVTEAMVVEKITWASWTSVLGDEVIG
FT                   IWPRNADKADVNCACVTHAGLNIVTGDDFGLLKLFDFPCTEKFAKHKRYFGHSAHVTNI
FT                   RFSSDDKYVVSTGGDDCSVFVWRCL"
FT   CDS             complement(join(2561802..2561826,2563459..2563559,
FT                   2563969..2564122,2564641..2564744,2566148..2566310,
FT                   2566694..2566866,2568075..2568263,2569322..2569436,
FT                   2569950..2570107,2571734..2571942,2575938..2576111,
FT                   2577561..2577659,2579101..2579199,2580458..2580587,
FT                   2582913..2582991,2595647..2595773,2595886..2596087,
FT                   2601979..2602155,2603582..2603670,2610088..2610219,
FT                   2610380..2610532,2614384..2614525,2621591..2621718,
FT                   2622217..2622328,2624154..2624356,2624836..2624936,
FT                   2628436..2628529,2637464..2637569,2638028..2638214,
FT                   2640761..2640879,2650221..2650327,2652108..2652275,
FT                   2657479..2657691,2667870..2668126,2669876..2670013,
FT                   2676593..2676794,2703187..2703322,2704498..2704683,
FT                   2715728..2715796,2719684..2719782,2728712..2728871,
FT                   2847039..2847235))
FT                   /codon_start=1
FT                   /gene="C230094A16Rik"
FT                   /locus_tag="mCG_13435"
FT                   /product="RIKEN cDNA C230094A16, isoform CRA_b"
FT                   /note="gene_id=mCG13435.3 transcript_id=mCT11708.3
FT                   protein_id=mCP2374.3 isoform=CRA_b"
FT                   /protein_id="EDL23792.1"
FT                   /translation="MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGV
FT                   VYNTREHSQKFFLGHNDDIISLALHPDKTLIATGQVGKEPYICIWNSYNVHTVSILKDV
FT                   HTHGVACLAFDSDGQHLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQP
FT                   NRMVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTILCLACAKEDITYSGALNGDIYV
FT                   WKGLTLVRTIQGAHSAGIFSLYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGY
FT                   KGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLA
FT                   VTGSDDRSVRLWSLADHALIARCNMEEAVRSVSFSPDGSQLALGMKDGSFIVLRVRDMT
FT                   EVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECNKSLSFITHID
FT                   WSLDSKYLQTNDGAGERLFYKMPSGKPLTSKEEIKGIPWASWTCVRGPEVSGIWPKYTE
FT                   VIDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKKGAKFRKYVGHSAHVTNVRWSHDFQ
FT                   WVLSTGGADHSVFQWRFIPEAVSNGVLETTPQEGGADSYSEESDSDFSDVPELDSDIEQ
FT                   ETQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNL
FT                   FYTQAGEVVYHIAAVAVVYNRQQHAQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAV
FT                   HVWDTQTLKCLSLLKGHHQRGVCALDFSADGKCLVSVGLDDFHSVVFWDWKKGEKIATT
FT                   RGHKDKIFVVKCNPQHADKLVTVGIKHIKFWQQAGGGFTSKRGSFGSAGKLETMMCVSY
FT                   GRMEDLVFSGAATGDIFIWKDVLLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDD
FT                   MFERCLKTYAIKRTALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPM
FT                   TLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSSQHRMLAVRKLKKGGRCCAF
FT                   SPDGKALAVGLNDGSFLVVNADTVEDMLSFHHRKEMISDIKFSKDTGKYLAVASHDNFV
FT                   DIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAKEQLFFEAPRGRKHTIRPSE
FT                   AEKIKWDTWTCVLGPTCEGIWPAHSDVTDVNAANLTKDGSLLATGDDFGFVKLFSYPVK
FT                   GQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEES
FT                   DTDAEEDGGYDSDVAREKAIDYTTKIYAVSIREMEGTKPHQQLKEVSMEERPPVSRAAP
FT                   QPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLNDGADIIFHTAAAGIVQNL
FT                   STGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGSQSFYLEHTDDILCLTVNQHPKY
FT                   RNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFHTKGVNYINFSATGKLLVSVGVDPEHT
FT                   ITVWRWQEGTKVASRGGHLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGV
FT                   IGSMEAAKMQTMLSVAFGANNLTFTGAINGDVYVWKEHFLIRLVAKAHTGPVFTMYTTL
FT                   RDGLIVTGGKERPTKEGGAVKLWDQEMKRCRAFQLETGQLVECVRSVCRGKGKILVGTK
FT                   DGEIIEVGEKSAASNILIDGHMEGEIWGLATHPSKDMFISASNDGTARIWDLADKKLLN
FT                   KVNLGHAARCAAYSPDGEMVAIGMKNGEFVILLVNTLKVWGKKRDRKSAIQDIRISPDN
FT                   RFLAVGSSEQTVDFYDLTQGTSLNRIGYCKDIPSFVIQMDFSADSKYIQVSTGAYKRQV
FT                   HEVPLGKQVTEAMVVEKITWASWTSVLGDEVIGIWPRNADKADVNCACVTHAGLNIVTG
FT                   DDFGLLKLFDFPCTEKFAKHKRYFGHSAHVTNIRFSSDDKYVVSTGGDDCSVFVWRCL"
FT   CDS             complement(join(2570378..2570449,2571734..2571942,
FT                   2575938..2576111,2579101..2579199,2580458..2580587,
FT                   2582913..2582991,2595647..2595773,2595886..2596087,
FT                   2601979..2602155,2603582..2603670,2610088..2610219,
FT                   2610380..2610532,2614384..2614525,2621591..2621718,
FT                   2622217..2622328,2624154..2624356,2624836..2624936,
FT                   2628436..2628529,2637464..2637569,2638028..2638214,
FT                   2640761..2640879,2650221..2650327,2652108..2652275,
FT                   2657479..2657691,2667870..2668126,2669876..2670013,
FT                   2676593..2676794,2703187..2703322,2704498..2704683,
FT                   2715728..2715796,2719684..2719782,2728712..2728871,
FT                   2847039..2847235))
FT                   /codon_start=1
FT                   /gene="C230094A16Rik"
FT                   /locus_tag="mCG_13435"
FT                   /product="RIKEN cDNA C230094A16, isoform CRA_c"
FT                   /note="gene_id=mCG13435.3 transcript_id=mCT191886.1
FT                   protein_id=mCP112839.1 isoform=CRA_c"
FT                   /protein_id="EDL23793.1"
FT                   /translation="MADRTAPRCQLRLEWVYGYRGHQCRNNLYYTAGKEVVYFVAGVGV
FT                   VYNTREHSQKFFLGHNDDIISLALHPDKTLIATGQVGKEPYICIWNSYNVHTVSILKDV
FT                   HTHGVACLAFDSDGQHLASVGLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQP
FT                   NRMVSCGVKHIKFWTLCGNALTAKRGIFGKTGDLQTILCLACAKEDITYSGALNGDIYV
FT                   WKGLTLVRTIQGAHSAGIFSLYACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGY
FT                   KGLSIRSVCWKADRLLAGTQDSEIFEVIVRERDKPMLILQGHCEGELWALALHPKKPLA
FT                   VTGSDDRSVRLWSLADHALIARCNMEEAVRSVSFSPDGSQLALGMKDGSFIVLRVRDMT
FT                   EVVHIKDRKEVIHEMKFSPDGSYLAVGSNDGPVDVYAVAQRYKKIGECNKSLSFITHID
FT                   WSLDSKYLQTNDGAGERLFYKMPSGKPLTSKEEIKGIPWASWTCVRGPEVSGIWPKYTE
FT                   VIDINSVDANYNSSVLVSGDDFGLVKLFKFPCLKKGAKFRKYVGHSAHVTNVRWSHDFQ
FT                   WVLSTGGADHSVFQWRFIPEAVSNGVLETTPQEGGADSYSEESDSDFSDVPELDSDIEQ
FT                   ETQINYDRQVYKEDLPQLKQQSKEKNHAVPFLKREKAPEDSLKLQFIHGYRGYDCRNNL
FT                   FYTQAGEVVYHIAAVAVVYNRQQHAQRLYLGHDDDILSLTIHPVKDYVATGQVGRDAAV
FT                   HVWDTQTLKCLSLLKGHHQRGVCALDFSADGKCLVSVGLDDFHSVVFWDWKKGEKIATT
FT                   RGHKDKIFVVKCNPQHADKLVTVGIKHIKFWQQAGGGFTSKRGSFGSAGKLETMMCVSY
FT                   GRMEDLVFSGAATGDIFIWKDVLLLKTVKAHDGPVFAMYALDKGFVTGGKDGIVELWDD
FT                   MFERCLKTYAIKRTALSTSSKGLLLEDNPSIRAITLGHGHILVGTKNGEILEIDKSGPM
FT                   TLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRIWELSSQHRMLAVRKLKKGGRCCAF
FT                   SPDGKALAVGLNDGSFLVVNADTVEDMLSFHHRKEMISDIKFSKDTGKYLAVASHDNFV
FT                   DIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNSGAKEQLFFEAPRGRKHTIRPSE
FT                   AEKIKWDTWTCVLGPTCEGIWPAHSDVTDVNAANLTKDGSLLATGDDFGFVKLFSYPVK
FT                   GQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALMIWTREFVGTQESKLVDSEES
FT                   DTDAEEDGGYDSDVAREKAIDYTTKIYAVSIREMEGTKPHQQLKEVSMEERPPVSRAAP
FT                   QPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLNDGADIIFHTAAAGIVQNL
FT                   STGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIHIWDAMTKHTLSMLRCFH
FT                   TKGVNYINFSATGKLLVSVGVDPEHTITVWRWQEGTKVASRGGHLERIFVVEFRPDSDT
FT                   QFVSVGVKHMKFWTLAGSALLYKKGVIGSMEAAKMQTMLSVAFGAQRSQCGWRDHSVAK
FT                   STYCSSRGP"
FT   gene            complement(2641517..2644790)
FT                   /pseudo
FT                   /locus_tag="mCG_118465"
FT                   /note="gene_id=mCG118465.2"
FT   mRNA            complement(2641517..2644790)
FT                   /pseudo
FT                   /locus_tag="mCG_118465"
FT                   /note="gene_id=mCG118465.2 transcript_id=mCT119622.2
FT                   created on 25-JUN-2004"
FT   gene            complement(2919446..3044482)
FT                   /gene="Spnb2"
FT                   /locus_tag="mCG_118463"
FT                   /note="gene_id=mCG118463.1"
FT   mRNA            complement(join(2919446..2920764,2921663..2921705,
FT                   2923298..2923471,2924486..2924724,2929139..2929202,
FT                   2929921..2930030,2930776..2930972,2932877..2932961,
FT                   2933906..2934044,2934726..2934970,2937686..2938060,
FT                   2938341..2938545,2939427..2939557,2940572..2940853,
FT                   2941018..2941107,2941518..2941742,2943841..2944104,
FT                   2944908..2945054,2949612..2949702,2955982..2956184,
FT                   2956916..2957672,2958406..2958543,2958634..2959504,
FT                   2960513..2960666,2962162..2962464,2963061..2963219,
FT                   2964149..2964266,2965872..2966059,2966783..2966895,
FT                   2969546..2969661,2969976..2970056,2971602..2971693,
FT                   2974275..2974448,2980985..2981136,3044287..3044482))
FT                   /gene="Spnb2"
FT                   /locus_tag="mCG_118463"
FT                   /product="spectrin beta 2, transcript variant mCT177216"
FT                   /note="gene_id=mCG118463.1 transcript_id=mCT177216.0
FT                   created on 12-DEC-2002"
FT   CDS             complement(join(2920546..2920764,2921663..2921705,
FT                   2923298..2923471,2924486..2924724,2929139..2929202,
FT                   2929921..2930030,2930776..2930972,2932877..2932961,
FT                   2933906..2934044,2934726..2934970,2937686..2938060,
FT                   2938341..2938545,2939427..2939557,2940572..2940853,
FT                   2941018..2941107,2941518..2941742,2943841..2944104,
FT                   2944908..2945054,2949612..2949702,2955982..2956184,
FT                   2956916..2957672,2958406..2958543,2958634..2959504,
FT                   2960513..2960666,2962162..2962464,2963061..2963219,
FT                   2964149..2964266,2965872..2966059,2966783..2966895,
FT                   2969546..2969661,2969976..2970056,2971602..2971693,
FT                   2974275..2974448,2980985..2981136,3044287..3044434))
FT                   /codon_start=1
FT                   /gene="Spnb2"
FT                   /locus_tag="mCG_118463"
FT                   /product="spectrin beta 2, isoform CRA_b"
FT                   /note="gene_id=mCG118463.1 transcript_id=mCT177216.0
FT                   protein_id=mCP100138.0 isoform=CRA_b"
FT                   /protein_id="EDL23790.1"
FT                   /translation="MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRI
FT                   KALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPT
FT                   KGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDIS
FT                   VETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDF
FT                   DKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMK
FT                   ALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQ
FT                   LQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERL
FT                   EKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVE
FT                   AATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELL
FT                   RARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEAD
FT                   IAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLE
FT                   ESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHF
FT                   EQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADA
FT                   DDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ
FT                   AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQW
FT                   LNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQ
FT                   DKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLA
FT                   GVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMK
FT                   TTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENI
FT                   KNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLS
FT                   QSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI
FT                   NAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDC
FT                   QELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISE
FT                   KPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQ
FT                   IQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRL
FT                   TVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTV
FT                   QLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIE
FT                   ETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILE
FT                   QAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDER
FT                   HRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVD
FT                   TVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAK
FT                   EIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAY
FT                   AGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQ
FT                   IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKL
FT                   LQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDE
FT                   VEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPDPNTKVS
FT                   EEAESQQWDTSKGDQVSQNGLPAEQGSPRMAGTMETSEMVNGAAEQRTSSKESSPVPSP
FT                   TLDRKAKSALPAQSAATLPARTLETPAAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVI
FT                   NNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQ
FT                   AKDDEEMNTWIQAISSAISSDKHDTSASTQSTPASSRAQTLPTSVVTITSESSPGKREK
FT                   DKEKDKEKRFSLFGKKK"
FT   mRNA            complement(join(2926893..2929202,2929921..2930030,
FT                   2930776..2930972,2932877..2932961,2933906..2934044,
FT                   2934726..2934970,2937686..2938060,2938341..2938545,
FT                   2939427..2939557,2940572..2940853,2941018..2941107,
FT                   2941518..2941742,2943841..2944104,2944908..2945054,
FT                   2949612..2949702,2955982..2956184,2956916..2957672,
FT                   2958406..2958543,2958634..2959504,2960513..2960666,
FT                   2962162..2962464,2963061..2963219,2964149..2964266,
FT                   2965872..2966059,2966783..2966895,2969546..2969661,
FT                   2969976..2970056,2971602..2971693,2974275..2974448,
FT                   2980985..2981136,3022533..3023053))
FT                   /gene="Spnb2"
FT                   /locus_tag="mCG_118463"
FT                   /product="spectrin beta 2, transcript variant mCT119620"
FT                   /note="gene_id=mCG118463.1 transcript_id=mCT119620.1
FT                   created on 12-DEC-2002"
FT   CDS             complement(join(2929052..2929202,2929921..2930030,
FT                   2930776..2930972,2932877..2932961,2933906..2934044,
FT                   2934726..2934970,2937686..2938060,2938341..2938545,
FT                   2939427..2939557,2940572..2940853,2941018..2941107,
FT                   2941518..2941742,2943841..2944104,2944908..2945054,
FT                   2949612..2949702,2955982..2956184,2956916..2957672,
FT                   2958406..2958543,2958634..2959504,2960513..2960666,
FT                   2962162..2962464,2963061..2963219,2964149..2964266,
FT                   2965872..2966059,2966783..2966895,2969546..2969661,
FT                   2969976..2970056,2971602..2971693,2974275..2974448,
FT                   2980985..2981136,3022533..3022641))
FT                   /codon_start=1
FT                   /gene="Spnb2"
FT                   /locus_tag="mCG_118463"
FT                   /product="spectrin beta 2, isoform CRA_a"
FT                   /note="gene_id=mCG118463.1 transcript_id=mCT119620.1
FT                   protein_id=mCP58602.2 isoform=CRA_a"
FT                   /protein_id="EDL23789.1"
FT                   /translation="MELQRTSSISGPLSPAYTGQVPYNYNQLEGRFKQLQDEREAVQKK
FT                   TFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVD
FT                   KALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAK
FT                   DALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQ
FT                   NAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVL
FT                   DNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKP
FT                   PKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRN
FT                   ELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDI
FT                   AAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGL
FT                   QKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNA
FT                   SAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMA
FT                   EEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAE
FT                   EHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKI
FT                   VSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLA
FT                   GIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDL
FT                   EVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFREL
FT                   VDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGME
FT                   RDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEA
FT                   SKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQK
FT                   MRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTK
FT                   QAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSD
FT                   GNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLT
FT                   AQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLT
FT                   GLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSV
FT                   NILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPL
FT                   SERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKE
FT                   IQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAH
FT                   KAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQL
FT                   SKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDL
FT                   EQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSG
FT                   HSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKL
FT                   PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKREN
FT                   EVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSV
FT                   ELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDK
FT                   WEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEK
FT                   SAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPDPNTKVSEEAESQQWDTSKG
FT                   DQVSQNGLPAEQGSPRVSYRSQTYQNYKNFNSRRTASDHSWSGM"
FT   gene            complement(3267973..3315691)
FT                   /locus_tag="mCG_7480"
FT                   /note="gene_id=mCG7480.1"
FT   mRNA            complement(join(3267973..3268332,3269022..3269137,
FT                   3288178..3288331,3296072..3296138,3296597..3296804,
FT                   3315602..3315691))
FT                   /locus_tag="mCG_7480"
FT                   /product="mCG7480"
FT                   /note="gene_id=mCG7480.1 transcript_id=mCT6264.2 created on
FT                   03-SEP-2002"
FT   CDS             complement(join(3268132..3268332,3269022..3269137,
FT                   3288178..3288202))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7480"
FT                   /product="mCG7480"
FT                   /note="gene_id=mCG7480.1 transcript_id=mCT6264.2
FT                   protein_id=mCP2387.1"
FT                   /protein_id="EDL23788.1"
FT                   /translation="MQKPSCGIVPLTSLDVSGEHENNFVEYISFIHQYDARRTPNEPIK
FT                   GKKHGTFVQREIKLGAMPIVPKAPEVLLNTLESGSSEQPQKTDKGNSSGDKVTSPGLCQ
FT                   QNSQELLET"
FT   gene            complement(3471209..3499486)
FT                   /locus_tag="mCG_7485"
FT                   /note="gene_id=mCG7485.3"
FT   mRNA            complement(join(3471209..3471324,3475752..3475768,
FT                   3499380..3499486))
FT                   /locus_tag="mCG_7485"
FT                   /product="mCG7485"
FT                   /note="gene_id=mCG7485.3 transcript_id=mCT169290.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(3471211..3471324,3475752..3475768,
FT                   3499380..3499458))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7485"
FT                   /product="mCG7485"
FT                   /note="gene_id=mCG7485.3 transcript_id=mCT169290.0
FT                   protein_id=mCP92076.0"
FT                   /protein_id="EDL23787.1"
FT                   /translation="MLLWRRLAAMTELLKSVDYEVFGTVQGVCFRMYTEGEAKKRGLVG
FT                   WVKNTSKGTVTGQVQGPEEKVDAM"
FT   gene            complement(3602082..3602477)
FT                   /pseudo
FT                   /locus_tag="mCG_48654"
FT                   /note="gene_id=mCG48654.2"
FT   mRNA            complement(3602082..3602477)
FT                   /pseudo
FT                   /locus_tag="mCG_48654"
FT                   /note="gene_id=mCG48654.2 transcript_id=mCT48837.2 created
FT                   on 10-DEC-2002"
FT   gene            <3619658..3734890
FT                   /gene="Psme4"
FT                   /locus_tag="mCG_7481"
FT                   /note="gene_id=mCG7481.1"
FT   mRNA            join(<3619658..3620106,3643846..3643986,3644678..3644794,
FT                   3655574..3655618,3657056..3657205,3657729..3657792,
FT                   3659022..3659096,3660468..3660590,3662595..3662687,
FT                   3663539..3663804,3666453..3666542,3668015..3668079,
FT                   3668348..3668498,3670514..3670612,3670872..3670941,
FT                   3671783..3671850,3672707..3672788,3673695..3673852,
FT                   3675839..3675934,3683126..3683181,3684911..3684967,
FT                   3685164..3685219,3685307..3685405,3687054..3687149,
FT                   3688116..3688247,3690062..3690271,3693514..3693650,
FT                   3695883..3695936,3696305..3696434,3697805..3697886,
FT                   3699516..3699669,3700164..3700233,3701734..3701859,
FT                   3702383..3702535,3704965..3705069,3705504..3705595,
FT                   3707045..3707176,3707549..3707757,3710421..3710506,
FT                   3715740..3715868,3719812..3719967,3728564..3728726,
FT                   3731211..3731344,3732873..3733004,3734563..3734890)
FT                   /gene="Psme4"
FT                   /locus_tag="mCG_7481"
FT                   /product="proteasome (prosome, macropain) activator subunit
FT                   4"
FT                   /note="gene_id=mCG7481.1 transcript_id=mCT6260.2 created on
FT                   23-MAY-2002"
FT   CDS             join(<3672786..3672788,3673695..3673852,3675839..3675934,
FT                   3683126..3683181,3684911..3684967,3685164..3685219,
FT                   3685307..3685405,3687054..3687149,3688116..3688247,
FT                   3690062..3690271,3693514..3693650,3695883..3695936,
FT                   3696305..3696434,3697805..3697886,3699516..3699669,
FT                   3700164..3700233,3701734..3701859,3702383..3702535,
FT                   3704965..3705069,3705504..3705595,3707045..3707176,
FT                   3707549..3707757,3710421..3710506,3715740..3715868,
FT                   3719812..3719967,3728564..3728726,3731211..3731344,
FT                   3732873..3733004,3734563..3734682)
FT                   /codon_start=1
FT                   /gene="Psme4"
FT                   /locus_tag="mCG_7481"
FT                   /product="proteasome (prosome, macropain) activator subunit
FT                   4"
FT                   /note="gene_id=mCG7481.1 transcript_id=mCT6260.2
FT                   protein_id=mCP2389.2"
FT                   /protein_id="EDL23786.1"
FT                   /translation="PDWGKPGDLWNLGIQWHVPSSEEVSFAFYLLDSFLQPELIKLQCC
FT                   GDGELEMSRDDILQSLTIVHSCLIGSGNLLPPLKGEAVTNLVPSMVSLEETKLYTGLEH
FT                   DLSRENYREVIASVIRKLLSHILDNSEDDTKSLFLIIKIIGDLLHFQGSHKHEFDSRWK
FT                   SFNLVKKSMENRLRTLTVEGCEYKKIHQDMIRDLLRLSTSSYSQVRNKAQQTFFAALGA
FT                   YNFCCRDIIPLVLEFLRPDRKDVTQQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPA
FT                   LVSSGLSQAMSLEKPSIVRLFDDLAEKIHRQYETIGLDFTIPKSCAAIAELLQQSKNPS
FT                   ISQTLLSPEKIKEGQKRQQDKNADALRNYECLVNTLLDGVEQRNLPWKFEHIGIGLLSL
FT                   LLRDDRVLPLRAIRFFVENLNHDAIVVRKMAISAVAGILKQLKRTHKKLTINPYEISGC
FT                   PKPTKILAGDRPDNHWLHYDSKNIPRTKKEWESSCFVEKTHWGYYNWPKNMVVYAGVEE
FT                   QPKLGRSREDMIEAEQIIYDRFSDPKFVEQLITFLSLEDRKGRDKFSPRRFCLFKGIFR
FT                   NFDDAFLPVLKPHLERLVADSHESTQRCVAEIIAGLIRGSKHWTFEKVEKLWEVLCPLL
FT                   RTALSNMTVETYNDWGTCIATSCESRDPRKLHWLFELLLESPLSGEGGSFVDACRLYVL
FT                   QGGLAQQEWRVPELLHRLLKYLEPKLTQVYKNVRERIGSVLTYIFMIDVSLPNTAPTTS
FT                   PCIPEFTARVLEKLKPLTDVDEEIQNHVMEENGIGEEDERTQGIKLLKTILKWLMASAG
FT                   RSFSTAVKEQLQLLPLFFKIAPVENDNSYDELKRDAKLCLSLMSQGLLYPQQVPLILQV
FT                   LSQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNEDAVKDIRWLIICLLEDEQLEVREM
FT                   AATTLSGLLQCNFLTMDSAMQIHFEQLCKTKLPKKRKRDPGSVGDTIPSAELVKRHAGV
FT                   LGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQ
FT                   QFTDDQLLVLTDLLVSPCYYAAVEFSISRAMGHESEVLTALCLESHEEKRIKGGKVSEL
FT                   T"
FT   gene            complement(3675023..3675451)
FT                   /pseudo
FT                   /locus_tag="mCG_1039744"
FT                   /note="gene_id=mCG1039744.0"
FT   mRNA            complement(3675023..3675451)
FT                   /pseudo
FT                   /locus_tag="mCG_1039744"
FT                   /note="gene_id=mCG1039744.0 transcript_id=mCT157448.0
FT                   created on 10-DEC-2002"
FT   gene            <3747593..>3749215
FT                   /gene="Gpr75"
FT                   /locus_tag="mCG_51372"
FT                   /note="gene_id=mCG51372.2"
FT   mRNA            <3747593..>3749215
FT                   /gene="Gpr75"
FT                   /locus_tag="mCG_51372"
FT                   /product="G protein-coupled receptor 75"
FT                   /note="gene_id=mCG51372.2 transcript_id=mCT51555.2 created
FT                   on 23-MAY-2002"
FT   CDS             3747593..3749215
FT                   /codon_start=1
FT                   /gene="Gpr75"
FT                   /locus_tag="mCG_51372"
FT                   /product="G protein-coupled receptor 75"
FT                   /note="gene_id=mCG51372.2 transcript_id=mCT51555.2
FT                   protein_id=mCP25439.1"
FT                   /db_xref="GOA:Q059L0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441843"
FT                   /db_xref="UniProtKB/TrEMBL:Q059L0"
FT                   /protein_id="EDL23785.1"
FT                   /translation="MNTSAPLQNVPNATLLNMPPLHGGNSTSLQEGLRDFIHTATLVTC
FT                   TFLLAIIFCLGSYGNFIVFLSFFDPSFRKFRTNFDFMILNLSFCDLFICGVTAPMFTFV
FT                   LFFSSASSIPDSFCFTFHLTSSGFVIMSLKMVAVIALHRLRMVMGKQPNCTASFSCILL
FT                   LTLLLWATSFTLATLATLRTNKSHLCLPMSSLMDGEGKAILSLYVVDFTFCVAVVSVSY
FT                   IMIAQTLRKNAQVKKCPPVITVDASRPQPFMGASVKGNGDPIQCTMPALYRNQNYNKLQ
FT                   HSQTHGYTKNINQMPIPSASRLQLVSAINFSTAKDSKAVVTCVVIVLSVLVCCLPLGIS
FT                   LVQMVLSDNGSFILYQFELFGFTLIFFKSGLNPFIYSRNSAGLRRKVLWCLRYTGLGFL
FT                   CCKQKTRLRAMGKGNLEINRNKSSHHETNSAYMLSPKPQRKFVDQACGPSHSKESAASP
FT                   KVSAGHQPCGQSSSTPINTRIEPYYSIYNSSPSQQESGPANLPPVNSFGFASSYIAMHY
FT                   YTTNDLMQEYDSTSAKQIPIPSV"
FT   gene            complement(3787879..3810538)
FT                   /gene="4933407N01Rik"
FT                   /locus_tag="mCG_7482"
FT                   /note="gene_id=mCG7482.2"
FT   mRNA            complement(join(3787879..3788311,3791074..3791149,
FT                   3791385..3791462,3795879..3796003,3799422..3799481,
FT                   3800082..3800243,3804454..3804583,3804675..3804898,
FT                   3806318..3806352,3806934..3806997,3807115..3807192,
FT                   3807681..3807761,3808969..3809073,3810311..3810538))
FT                   /gene="4933407N01Rik"
FT                   /locus_tag="mCG_7482"
FT                   /product="RIKEN cDNA 4933407N01"
FT                   /note="gene_id=mCG7482.2 transcript_id=mCT6265.3 created on
FT                   12-DEC-2002"
FT   CDS             complement(join(3788240..3788311,3791074..3791149,
FT                   3791385..3791462,3795879..3796003,3799422..3799481,
FT                   3800082..3800243,3804454..3804583,3804675..3804898,
FT                   3806318..3806352,3806934..3806997,3807115..3807192,
FT                   3807681..3807761,3808969..3809073,3810311..3810472))
FT                   /codon_start=1
FT                   /gene="4933407N01Rik"
FT                   /locus_tag="mCG_7482"
FT                   /product="RIKEN cDNA 4933407N01"
FT                   /note="gene_id=mCG7482.2 transcript_id=mCT6265.3
FT                   protein_id=mCP2382.3"
FT                   /protein_id="EDL23784.1"
FT                   /translation="MEEGDGGLRSLVPGGPLLLVLYGLLEASGGGRALPQLSDDIPFRV
FT                   NWPGTEFSLPTTGVLYKEDNYIIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELL
FT                   EPLFKQSSCSYRIESYWTYEVCHGKHIRQYHEEKETGQKVNIHEYYLGNMLAKNLLYEK
FT                   EREAKENEKSNEIPTKNIEGQMTPYYPVGMGNGTPCSLKQNRPRSSTVMYICHPESKHE
FT                   ILSVAEVTTCEYEVVILTPLLCSHPKYKFRASPVNDIFCQSLPGSPFKPLTLRQLEQQE
FT                   EILRVPFRRNKEEDLPSAKEERFPAIHKPIAVGSQPVLTVGTTHISKLTDDQLIKEFLS
FT                   GSYCFHGGVGWWKYEFCYGKHVHQYHEDKDNGKTSVVVGTWNQEEHVEWAKKNTARAYH
FT                   LQDDGTQTVRMVSHFYGNGDICDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYI
FT                   LGVESPVICKILDTADENGLLSLPN"
FT   gene            3810978..3951804
FT                   /gene="Asb3"
FT                   /locus_tag="mCG_7478"
FT                   /note="gene_id=mCG7478.2"
FT   mRNA            join(3810978..3811142,3857265..3857473,3887892..3888050,
FT                   3906036..3906148,3906680..3906815,3909388..3909565,
FT                   3911954..3912151,3931510..3931770,3935171..3935301,
FT                   3951371..3951804)
FT                   /gene="Asb3"
FT                   /locus_tag="mCG_7478"
FT                   /product="ankyrin repeat and SOCS box-containing protein 3,
FT                   transcript variant mCT6262"
FT                   /note="gene_id=mCG7478.2 transcript_id=mCT6262.2 created on
FT                   12-DEC-2002"
FT   mRNA            join(<3810991..3811142,3857265..3857473,3887892..3888050,
FT                   3906036..3906148,3906680..3906815,3909388..3909565,
FT                   3911954..3912151,3931510..3931770,3935171..3936270)
FT                   /gene="Asb3"
FT                   /locus_tag="mCG_7478"
FT                   /product="ankyrin repeat and SOCS box-containing protein 3,
FT                   transcript variant mCT191883"
FT                   /note="gene_id=mCG7478.2 transcript_id=mCT191883.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3811102..3811142,3857265..3857473,3887892..3888050,
FT                   3906036..3906148,3906680..3906815,3909388..3909565,
FT                   3911954..3912151,3931510..3931770,3935171..3935321)
FT                   /codon_start=1
FT                   /gene="Asb3"
FT                   /locus_tag="mCG_7478"
FT                   /product="ankyrin repeat and SOCS box-containing protein 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7478.2 transcript_id=mCT191883.0
FT                   protein_id=mCP112844.0 isoform=CRA_a"
FT                   /protein_id="EDL23780.1"
FT                   /translation="TGPETALGRSGPARLIKRMDFTEAYSDTCSTVGLAAREGNVKILR
FT                   KLLKKGRSVDVADNRGWMPIHEAAYHNAVECLQMLIHTDSSENYIKAKTFEGFCALHLA
FT                   VSQGHWKITQILLEAGADPNETTLEETTPLFLAVESGRIDVLKLLLQHGANVNGSHSMS
FT                   GWNSLHQASFQGNAETIKLLLKQGADRECQDDFGITPLFVAAQYGKLESMSILISSGAN
FT                   VNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDNWQLPIHAAAQMGHTETL
FT                   DLLIPRTNRACDTGPDKVSPVYSAVFGGREECLEMLLQNGYSPDAQMCLVFGFSSPLCM
FT                   AFQKDCDFSGIVNILLKYGAQLNELHLAYCLKYEKFSMFCSFLKKGSLMVPWNHTSEFI
FT                   SYAVKAQTKYKAWLPHLLLAGFDPLILLCSSSWVDSASDDILIFTLEFSNWKRLPSAVE
FT                   KMLSVRANSSWALQQHLGKKAQL"
FT   gene            complement(3836774..3846275)
FT                   /gene="2510006C20Rik"
FT                   /locus_tag="mCG_7483"
FT                   /note="gene_id=mCG7483.1"
FT   mRNA            complement(join(3836774..3837796,3846052..3846275))
FT                   /gene="2510006C20Rik"
FT                   /locus_tag="mCG_7483"
FT                   /product="RIKEN cDNA 2510006C20, transcript variant
FT                   mCT177226"
FT                   /note="gene_id=mCG7483.1 transcript_id=mCT177226.0 created
FT                   on 12-DEC-2002"
FT   mRNA            complement(join(3836774..3837796,3839607..3839642,
FT                   3846052..3846275))
FT                   /gene="2510006C20Rik"
FT                   /locus_tag="mCG_7483"
FT                   /product="RIKEN cDNA 2510006C20, transcript variant
FT                   mCT6257"
FT                   /note="gene_id=mCG7483.1 transcript_id=mCT6257.0 created on
FT                   12-DEC-2002"
FT   CDS             complement(join(3837431..3837796,3846052..3846186))
FT                   /codon_start=1
FT                   /gene="2510006C20Rik"
FT                   /locus_tag="mCG_7483"
FT                   /product="RIKEN cDNA 2510006C20, isoform CRA_a"
FT                   /note="gene_id=mCG7483.1 transcript_id=mCT177226.0
FT                   protein_id=mCP100148.0 isoform=CRA_a"
FT                   /protein_id="EDL23782.1"
FT                   /translation="MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGK
FT                   GSVWGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTYDNP
FT                   NYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELADSVRKLVPEDADEHLFSLEKLVKERL
FT                   EGK"
FT   CDS             complement(join(3837431..3837796,3839607..3839642,
FT                   3846052..3846186))
FT                   /codon_start=1
FT                   /gene="2510006C20Rik"
FT                   /locus_tag="mCG_7483"
FT                   /product="RIKEN cDNA 2510006C20, isoform CRA_b"
FT                   /note="gene_id=mCG7483.1 transcript_id=mCT6257.0
FT                   protein_id=mCP2379.1 isoform=CRA_b"
FT                   /protein_id="EDL23783.1"
FT                   /translation="MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGK
FT                   PGRVVTLVEDPGGSVWGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPF
FT                   SVLLYIGTYDNPNYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELADSVRKLVPEDADEH
FT                   LFSLEKLVKERLEGK"
FT   CDS             join(3857278..3857473,3887892..3888050,3906036..3906148,
FT                   3906680..3906815,3909388..3909565,3911954..3912151,
FT                   3931510..3931770,3935171..3935301,3951371..3951576)
FT                   /codon_start=1
FT                   /gene="Asb3"
FT                   /locus_tag="mCG_7478"
FT                   /product="ankyrin repeat and SOCS box-containing protein 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7478.2 transcript_id=mCT6262.2
FT                   protein_id=mCP2381.2 isoform=CRA_b"
FT                   /protein_id="EDL23781.1"
FT                   /translation="MDFTEAYSDTCSTVGLAAREGNVKILRKLLKKGRSVDVADNRGWM
FT                   PIHEAAYHNAVECLQMLIHTDSSENYIKAKTFEGFCALHLAVSQGHWKITQILLEAGAD
FT                   PNETTLEETTPLFLAVESGRIDVLKLLLQHGANVNGSHSMSGWNSLHQASFQGNAETIK
FT                   LLLKQGADRECQDDFGITPLFVAAQYGKLESMSILISSGANVNCQALDKATPLFIAAQE
FT                   GHTKCVELLLSSGADPDLYCNEDNWQLPIHAAAQMGHTETLDLLIPRTNRACDTGPDKV
FT                   SPVYSAVFGGREECLEMLLQNGYSPDAQMCLVFGFSSPLCMAFQKDCDFSGIVNILLKY
FT                   GAQLNELHLAYCLKYEKFSMFCSFLKKGSLMVPWNHTSEFISYAVKAQTKYKAWLPHLL
FT                   LAGFDPLILLCSSSWVDSASDDILIFTLEFSNWKRLPSAVEKMLSVRANSSWALQQHLA
FT                   SVPSLTHLCRLEIRASLKAEHLHSDIFIHQLPLPRSLQNYLLYEEVLRMNEILEPAANQ
FT                   DGETSKAT"
FT   gene            complement(4230055..4239915)
FT                   /gene="Stc2"
FT                   /locus_tag="mCG_12982"
FT                   /note="gene_id=mCG12982.1"
FT   mRNA            complement(join(4230055..4230506,4235328..4235539,
FT                   4237733..4237875,4239719..4239915))
FT                   /gene="Stc2"
FT                   /locus_tag="mCG_12982"
FT                   /product="stanniocalcin 2"
FT                   /note="gene_id=mCG12982.1 transcript_id=mCT13646.1 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(4230122..4230506,4235328..4235539,
FT                   4237733..4237875,4239719..4239869))
FT                   /codon_start=1
FT                   /gene="Stc2"
FT                   /locus_tag="mCG_12982"
FT                   /product="stanniocalcin 2"
FT                   /note="gene_id=mCG12982.1 transcript_id=mCT13646.1
FT                   protein_id=mCP2978.2"
FT                   /db_xref="GOA:Q5SS12"
FT                   /db_xref="InterPro:IPR004978"
FT                   /db_xref="MGI:MGI:1316731"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SS12"
FT                   /protein_id="EDL23779.1"
FT                   /translation="MCAERLGQFVTLALVFATLDPAQGTDSTNPPEGPQDRSSQQKGRL
FT                   SLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIK
FT                   DALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFK
FT                   DLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAA
FT                   PEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGS
FT                   SEWEDEQSEYSDIRR"
FT   gene            complement(4532009..4538847)
FT                   /gene="2310022M17Rik"
FT                   /locus_tag="mCG_68022"
FT                   /note="gene_id=mCG68022.2"
FT   mRNA            complement(join(4532009..4532711,4533581..4533777,
FT                   4536088..4536212,4538325..4538847))
FT                   /gene="2310022M17Rik"
FT                   /locus_tag="mCG_68022"
FT                   /product="RIKEN cDNA 2310022M17"
FT                   /note="gene_id=mCG68022.2 transcript_id=mCT68181.2 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(4533582..4533777,4536088..4536212,
FT                   4538325..4538723))
FT                   /codon_start=1
FT                   /gene="2310022M17Rik"
FT                   /locus_tag="mCG_68022"
FT                   /product="RIKEN cDNA 2310022M17"
FT                   /note="gene_id=mCG68022.2 transcript_id=mCT68181.2
FT                   protein_id=mCP26076.1"
FT                   /protein_id="EDL23778.1"
FT                   /translation="MQRPSVTPLDERRQRGERGAPWSPPPPTLPPPSPPPPWAPPCLRS
FT                   SARGSRRSSGARGPARARGAAMADGAGAGAAGQASGPSGGSSGAGGPVNPASLPPGDPQ
FT                   LIALIVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPAMNKN
FT                   QLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKEAVPAP
FT                   PPEPESQDPPAPSQDAS"
FT   gene            complement(4665338..>4689693)
FT                   /locus_tag="mCG_144732"
FT                   /note="gene_id=mCG144732.0"
FT   mRNA            complement(join(4665338..4665463,4665600..4665687,
FT                   4667532..4667648,4668030..4668181,4689461..>4689693))
FT                   /locus_tag="mCG_144732"
FT                   /product="mCG144732"
FT                   /note="gene_id=mCG144732.0 transcript_id=mCT184156.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4665638..4665687,4667532..4667648,
FT                   4668030..>4668081))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144732"
FT                   /product="mCG144732"
FT                   /note="gene_id=mCG144732.0 transcript_id=mCT184156.0
FT                   protein_id=mCP105848.0"
FT                   /protein_id="EDL23777.1"
FT                   /translation="SPLLMKRLKVMGHKLQLGRAPGSPASQTTVPCVAPGVMCTRPRRT
FT                   WRECAQPCPGAGKQKLTCKQLEDVFSS"
FT   gene            4737263..4797288
FT                   /gene="Cpeb4"
FT                   /locus_tag="mCG_68016"
FT                   /note="gene_id=mCG68016.3"
FT   mRNA            join(4737263..4738464,4754910..4754991,4773894..4773944,
FT                   4783870..4783893,4785478..4785651,4789688..4789777,
FT                   4790440..4790558,4792732..4792846,4795129..4795310,
FT                   4796396..4796668)
FT                   /gene="Cpeb4"
FT                   /locus_tag="mCG_68016"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 4, transcript variant mCT191884"
FT                   /note="gene_id=mCG68016.3 transcript_id=mCT191884.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<4737340..4738464,4754910..4754991,4773894..4773944,
FT                   4785478..4785651,4789688..4789777,4790440..4790558,
FT                   4792732..4792846,4795129..4795310,4796396..4797288)
FT                   /gene="Cpeb4"
FT                   /locus_tag="mCG_68016"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 4, transcript variant mCT68175"
FT                   /note="gene_id=mCG68016.3 transcript_id=mCT68175.2 created
FT                   on 21-MAY-2002"
FT   CDS             join(4737340..4738464,4754910..4754991,4773894..4773944,
FT                   4783870..4783893,4785478..4785651,4789688..4789777,
FT                   4790440..4790558,4792732..4792846,4795129..4795310,
FT                   4796396..4796623)
FT                   /codon_start=1
FT                   /gene="Cpeb4"
FT                   /locus_tag="mCG_68016"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG68016.3 transcript_id=mCT191884.0
FT                   protein_id=mCP112842.0 isoform=CRA_a"
FT                   /protein_id="EDL23775.1"
FT                   /translation="MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPNPAAFI
FT                   NNNTAANGSSAGSAWLFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEA
FT                   GILPETEKAKAEENPGDSSSENSNGKEKLRIESPVLTGFDYQEATGLGTSTQPLTSSAS
FT                   SLTGFSNWSAAIAPSSSTIINEDASFFHQGGVPGASANNGALLFQNFPHHVSPGFGGSF
FT                   SPQIGPLSQHHPHHPHFQHHHSQHQQQRRSPASPHPPPFTHRSAAFNQLPHLANNLNKP
FT                   PSPWSSYQSPSPTPSSSWSPGGGGYGGWGASQGRDHRRGLNGGITPLNSISPLKKNFAS
FT                   NHIQLQKYARPSSAFAPKSWMEDSLNRADNIFPFPERPRTFDMHSLESSLIDIMRAEND
FT                   SIKGRLNYSYPGSDSSLLINARTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHC
FT                   FTHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGY
FT                   AFLLVQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPL
FT                   DPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSY
FT                   IAAISARFVQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYC
FT                   EYCWAAIHSRAGREFHKPLVKEGGDRPRHISFRWN"
FT   CDS             join(4737340..4738464,4754910..4754991,4773894..4773944,
FT                   4785478..4785651,4789688..4789777,4790440..4790558,
FT                   4792732..4792846,4795129..4795310,4796396..4796623)
FT                   /codon_start=1
FT                   /gene="Cpeb4"
FT                   /locus_tag="mCG_68016"
FT                   /product="cytoplasmic polyadenylation element binding
FT                   protein 4, isoform CRA_b"
FT                   /note="gene_id=mCG68016.3 transcript_id=mCT68175.2
FT                   protein_id=mCP26078.2 isoform=CRA_b"
FT                   /protein_id="EDL23776.1"
FT                   /translation="MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPNPAAFI
FT                   NNNTAANGSSAGSAWLFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEA
FT                   GILPETEKAKAEENPGDSSSENSNGKEKLRIESPVLTGFDYQEATGLGTSTQPLTSSAS
FT                   SLTGFSNWSAAIAPSSSTIINEDASFFHQGGVPGASANNGALLFQNFPHHVSPGFGGSF
FT                   SPQIGPLSQHHPHHPHFQHHHSQHQQQRRSPASPHPPPFTHRSAAFNQLPHLANNLNKP
FT                   PSPWSSYQSPSPTPSSSWSPGGGGYGGWGASQGRDHRRGLNGGITPLNSISPLKKNFAS
FT                   NHIQLQKYARPSSAFAPKSWMEDSLNRADNIFPFPERPRTFDMHSLESSLIDIMRAEND
FT                   SIKGRLNYSYPGSDSSLLINGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFTHQNGER
FT                   VERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLVQDE
FT                   SSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFV
FT                   GGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARF
FT                   VQLQHGEIDKRVEVKPYVLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIH
FT                   SRAGREFHKPLVKEGGDRPRHISFRWN"
FT   gene            complement(4777042..4778659)
FT                   /pseudo
FT                   /locus_tag="mCG_1039742"
FT                   /note="gene_id=mCG1039742.1"
FT   mRNA            complement(4777042..4778659)
FT                   /pseudo
FT                   /locus_tag="mCG_1039742"
FT                   /note="gene_id=mCG1039742.1 transcript_id=mCT157446.1
FT                   created on 10-DEC-2002"
FT   gene            4830799..4844819
FT                   /gene="4930524B15Rik"
FT                   /locus_tag="mCG_68018"
FT                   /note="gene_id=mCG68018.1"
FT   mRNA            join(4830799..4831117,4838724..4838809,4840205..4840303,
FT                   4841954..4841998,4843410..4844819)
FT                   /gene="4930524B15Rik"
FT                   /locus_tag="mCG_68018"
FT                   /product="RIKEN cDNA 4930524B15"
FT                   /note="gene_id=mCG68018.1 transcript_id=mCT68177.1 created
FT                   on 21-MAY-2002"
FT   CDS             join(4830826..4831117,4838724..4838809,4840205..4840303,
FT                   4841954..4841974)
FT                   /codon_start=1
FT                   /gene="4930524B15Rik"
FT                   /locus_tag="mCG_68018"
FT                   /product="RIKEN cDNA 4930524B15"
FT                   /note="gene_id=mCG68018.1 transcript_id=mCT68177.1
FT                   protein_id=mCP26087.2"
FT                   /protein_id="EDL23774.1"
FT                   /translation="MVPSRSGQRPDGPRLIYVTRFASHRHGVWQLRGLRGFGHRGPGLG
FT                   ARCASKQAAVEPGARGGERPTGSQAGVTDTPDSAPFQRRSRAPRAREQAAQAGLNQKNA
FT                   AKEFDFPIPLNEASKLMKERKKASVWSKVQQVISRMIAENESYRRRLQCQRVSSEIRVA
FT                   AR"
FT   gene            4865758..4924882
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /note="gene_id=mCG68015.2"
FT   mRNA            join(4865758..4865928,4867047..4867196,4882993..4883076,
FT                   4920362..4920472,4922792..4923059,4923390..4924882)
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /product="neuron specific gene family member 2, transcript
FT                   variant mCT68174"
FT                   /note="gene_id=mCG68015.2 transcript_id=mCT68174.2 created
FT                   on 12-DEC-2002"
FT   mRNA            join(4866032..4866073,4867047..4867196,4882993..4883076,
FT                   4920362..4920472,4922792..4923059,4923390..4924882)
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /product="neuron specific gene family member 2, transcript
FT                   variant mCT177223"
FT                   /note="gene_id=mCG68015.2 transcript_id=mCT177223.0 created
FT                   on 12-DEC-2002"
FT   mRNA            join(4866593..4866630,4867047..4867196,4882993..4883076,
FT                   4920362..4920472,4922792..4923059,4923390..4924882)
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /product="neuron specific gene family member 2, transcript
FT                   variant mCT177224"
FT                   /note="gene_id=mCG68015.2 transcript_id=mCT177224.0 created
FT                   on 12-DEC-2002"
FT   mRNA            join(4866692..4866748,4867047..4867196,4882993..4883076,
FT                   4920362..4920472,4922792..4923059,4923390..4924882)
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /product="neuron specific gene family member 2, transcript
FT                   variant mCT177225"
FT                   /note="gene_id=mCG68015.2 transcript_id=mCT177225.0 created
FT                   on 12-DEC-2002"
FT   CDS             join(4867068..4867196,4882993..4883076,4920362..4920472,
FT                   4922792..4922983)
FT                   /codon_start=1
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /product="neuron specific gene family member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG68015.2 transcript_id=mCT177223.0
FT                   protein_id=mCP100147.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SS02"
FT                   /db_xref="InterPro:IPR009431"
FT                   /db_xref="MGI:MGI:1202070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SS02"
FT                   /protein_id="EDL23770.1"
FT                   /translation="MVKLNSNPGEKGAKPPSVEDGFQTVPLITPLEVNHLQLAAPEKVI
FT                   VKTRTEYQPEQRNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEG
FT                   FVYKHKRCIPASLDAYYSSQDPSSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEP
FT                   KPPKTQGH"
FT   CDS             join(4867068..4867196,4882993..4883076,4920362..4920472,
FT                   4922792..4922983)
FT                   /codon_start=1
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /product="neuron specific gene family member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG68015.2 transcript_id=mCT177224.0
FT                   protein_id=mCP100145.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SS02"
FT                   /db_xref="InterPro:IPR009431"
FT                   /db_xref="MGI:MGI:1202070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SS02"
FT                   /protein_id="EDL23771.1"
FT                   /translation="MVKLNSNPGEKGAKPPSVEDGFQTVPLITPLEVNHLQLAAPEKVI
FT                   VKTRTEYQPEQRNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEG
FT                   FVYKHKRCIPASLDAYYSSQDPSSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEP
FT                   KPPKTQGH"
FT   CDS             join(4867068..4867196,4882993..4883076,4920362..4920472,
FT                   4922792..4922983)
FT                   /codon_start=1
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /product="neuron specific gene family member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG68015.2 transcript_id=mCT177225.0
FT                   protein_id=mCP100146.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SS02"
FT                   /db_xref="InterPro:IPR009431"
FT                   /db_xref="MGI:MGI:1202070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SS02"
FT                   /protein_id="EDL23772.1"
FT                   /translation="MVKLNSNPGEKGAKPPSVEDGFQTVPLITPLEVNHLQLAAPEKVI
FT                   VKTRTEYQPEQRNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEG
FT                   FVYKHKRCIPASLDAYYSSQDPSSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEP
FT                   KPPKTQGH"
FT   CDS             join(4867068..4867196,4882993..4883076,4920362..4920472,
FT                   4922792..4922983)
FT                   /codon_start=1
FT                   /gene="Nsg2"
FT                   /locus_tag="mCG_68015"
FT                   /product="neuron specific gene family member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG68015.2 transcript_id=mCT68174.2
FT                   protein_id=mCP26072.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SS02"
FT                   /db_xref="InterPro:IPR009431"
FT                   /db_xref="MGI:MGI:1202070"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SS02"
FT                   /protein_id="EDL23773.1"
FT                   /translation="MVKLNSNPGEKGAKPPSVEDGFQTVPLITPLEVNHLQLAAPEKVI
FT                   VKTRTEYQPEQRNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEG
FT                   FVYKHKRCIPASLDAYYSSQDPSSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEP
FT                   KPPKTQGH"
FT   gene            complement(4961043..4967012)
FT                   /locus_tag="mCG_147811"
FT                   /note="gene_id=mCG147811.0"
FT   mRNA            complement(join(4961043..4963539,4966919..4967012))
FT                   /locus_tag="mCG_147811"
FT                   /product="mCG147811"
FT                   /note="gene_id=mCG147811.0 transcript_id=mCT188074.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(4961644..4961958)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147811"
FT                   /product="mCG147811"
FT                   /note="gene_id=mCG147811.0 transcript_id=mCT188074.0
FT                   protein_id=mCP108534.0"
FT                   /protein_id="EDL23769.1"
FT                   /translation="MGWQLSSQPWLQQHPSGVIPPLRIMLSLSITQWEWFEAVQEHTWV
FT                   DSASRDLVPVMMFLLWHGGTEVGVTPLVKPQISPSRYPTASFHPTATKTILSSLLCNRA
FT                   "
FT   gene            5051881..5052599
FT                   /pseudo
FT                   /locus_tag="mCG_68024"
FT                   /note="gene_id=mCG68024.2"
FT   mRNA            5051881..5052599
FT                   /pseudo
FT                   /locus_tag="mCG_68024"
FT                   /note="gene_id=mCG68024.2 transcript_id=mCT68183.2 created
FT                   on 21-MAY-2002"
FT   gene            complement(5055654..5068199)
FT                   /gene="Il9r"
FT                   /locus_tag="mCG_68014"
FT                   /note="gene_id=mCG68014.1"
FT   mRNA            complement(join(5055654..5057707,5058426..5058510,
FT                   5059304..5059409,5061279..5061483,5061840..5061985,
FT                   5062465..5062643,5062731..5062842,5063178..5063288,
FT                   5068168..5068199))
FT                   /gene="Il9r"
FT                   /locus_tag="mCG_68014"
FT                   /product="interleukin 9 receptor"
FT                   /note="gene_id=mCG68014.1 transcript_id=mCT68173.1 created
FT                   on 21-MAY-2002"
FT   CDS             complement(join(5057273..5057707,5058426..5058510,
FT                   5059304..5059409,5061279..5061483,5061840..5061985,
FT                   5062465..5062643,5062731..5062842,5063178..5063288,
FT                   5068168..5068195))
FT                   /codon_start=1
FT                   /gene="Il9r"
FT                   /locus_tag="mCG_68014"
FT                   /product="interleukin 9 receptor"
FT                   /note="gene_id=mCG68014.1 transcript_id=mCT68173.1
FT                   protein_id=mCP26095.2"
FT                   /protein_id="EDL23768.1"
FT                   /translation="MALGRCIAEGWTLERVAVKQVSWFLIYSWVCSGVCRGVSVPEQGG
FT                   GGQKAGAFTCLSNSIYRIDCHWLAPELGQESRAWLLFTSNQVTEIKHKCTFWDSMCTLV
FT                   LPKEEVFLPFDNFTITLHRCIMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVL
FT                   TWGINLALEPLITSLNYELAFKRQEEAWEARHKDRIVGVTWLILEAVELNPGSIYEARL
FT                   RVQMTLESYEDKTEGEYYKSHWSEWSQPVSFPSPQRTQGLLVPRWQWSASILVVVPIFL
FT                   LLTGFVHLLFKLSPRLKRIFYQNIPSPEAFFHPLYSVYHGDFQSWTGARRAGPQARQNG
FT                   VSTSSAGSESSIWEAVATLTYSPACPVQFACLKWEATAPGFPGLPGSEHVLPAGCLELE
FT                   GQPSAYLPQEDWAPLGSARPPPPDSDSGSSDYCMLDCCEECHLSAFPGHTESPELTLAQ
FT                   PVALPVSSRA"
FT   gene            5073578..5077180
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /note="gene_id=mCG68019.1"
FT   mRNA            join(5073578..5073826,5075127..5075217,5075724..5075829,
FT                   5076506..5076580,5076867..5077180)
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /product="RIKEN cDNA 3300001G02, transcript variant
FT                   mCT68178"
FT                   /note="gene_id=mCG68019.1 transcript_id=mCT68178.1 created
FT                   on 20-MAY-2002"
FT   mRNA            join(5073630..5073826,5075127..5075210,5075717..5075829,
FT                   5076506..5076580,5076867..5077175)
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /product="RIKEN cDNA 3300001G02, transcript variant
FT                   mCT169289"
FT                   /note="gene_id=mCG68019.1 transcript_id=mCT169289.0 created
FT                   on 20-MAY-2002"
FT   mRNA            join(5073671..5073826,5075127..5075217,5075724..5075829,
FT                   5076484..5076580,5076867..5077175)
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /product="RIKEN cDNA 3300001G02, transcript variant
FT                   mCT169288"
FT                   /note="gene_id=mCG68019.1 transcript_id=mCT169288.0 created
FT                   on 20-MAY-2002"
FT   CDS             join(5073785..5073826,5075127..5075217,5075724..5075829,
FT                   5076506..5076580,5076867..5076924)
FT                   /codon_start=1
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /product="RIKEN cDNA 3300001G02, isoform CRA_d"
FT                   /note="gene_id=mCG68019.1 transcript_id=mCT68178.1
FT                   protein_id=mCP26088.1 isoform=CRA_d"
FT                   /protein_id="EDL23767.1"
FT                   /translation="MVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMP
FT                   VVVVQNATVLDLKKAIQRYVQLKQEREGGVQHISWSYVWRTYHLTSAGEKLTEDRKKLR
FT                   DYGIRNRDEVSFIKKLRQK"
FT   CDS             join(5073785..5073826,5075127..5075210,5075717..5075829,
FT                   5076506..5076580,5076867..5076924)
FT                   /codon_start=1
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /product="RIKEN cDNA 3300001G02, isoform CRA_c"
FT                   /note="gene_id=mCG68019.1 transcript_id=mCT169289.0
FT                   protein_id=mCP92079.0 isoform=CRA_c"
FT                   /protein_id="EDL23766.1"
FT                   /translation="MVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVTA
FT                   VVVVQNATVLDLKKAIQRYVQLKQEREGGVQHISWSYVWRTYHLTSAGEKLTEDRKKLR
FT                   DYGIRNRDEVSFIKKLRQK"
FT   CDS             join(5073785..5073826,5075127..5075217,5075724..5075829,
FT                   5076484..5076580,5076867..5076890)
FT                   /codon_start=1
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /product="RIKEN cDNA 3300001G02, isoform CRA_b"
FT                   /note="gene_id=mCG68019.1 transcript_id=mCT169288.0
FT                   protein_id=mCP92077.0 isoform=CRA_b"
FT                   /db_xref="GOA:A7M7T4"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1925622"
FT                   /db_xref="UniProtKB/TrEMBL:A7M7T4"
FT                   /protein_id="EDL23765.1"
FT                   /translation="MVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMP
FT                   VVVVQNATVLDLKKAIQRYVQLKQEREGGVQHISCTSVPSLQVLCMADIPSDLSWGEAH
FT                   RGQEEAQRLWHPEPR"
FT   mRNA            join(5074929..5075217,5075724..5075829,5076506..5076580,
FT                   5076867..5077171)
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /product="RIKEN cDNA 3300001G02, transcript variant
FT                   mCT169287"
FT                   /note="gene_id=mCG68019.1 transcript_id=mCT169287.0 created
FT                   on 20-MAY-2002"
FT   CDS             join(5075108..5075217,5075724..5075829,5076506..5076580,
FT                   5076867..5076890)
FT                   /codon_start=1
FT                   /gene="3300001G02Rik"
FT                   /locus_tag="mCG_68019"
FT                   /product="RIKEN cDNA 3300001G02, isoform CRA_a"
FT                   /note="gene_id=mCG68019.1 transcript_id=mCT169287.0
FT                   protein_id=mCP92075.0 isoform=CRA_a"
FT                   /protein_id="EDL23764.1"
FT                   /translation="MISISLGYSRRGQLPDCTGIWPGDDCPCVQDGWRGNACGRRTECH
FT                   GPGPEEGYPEIRAAQAGAGRRRSAHQLVLCMADIPSDLSWGEAHRGQEEAQRLWHPEPR
FT                   "
FT   gene            complement(5077769..5090492)
FT                   /gene="Rhbdf1"
FT                   /locus_tag="mCG_68021"
FT                   /note="gene_id=mCG68021.2"
FT   mRNA            complement(join(5077769..5078405,5078580..5078733,
FT                   5078839..5078939,5079008..5079083,5079293..5079387,
FT                   5079788..5079851,5080126..5080226,5080849..5081010,
FT                   5081094..5081168,5081278..5081389,5081486..5081743,
FT                   5082178..5082335,5082408..5082530,5082619..5082828,
FT                   5083136..5083349,5084160..5084290,5084368..5084508,
FT                   5090463..5090492))
FT                   /gene="Rhbdf1"
FT                   /locus_tag="mCG_68021"
FT                   /product="rhomboid family 1 (Drosophila)"
FT                   /note="gene_id=mCG68021.2 transcript_id=mCT68180.2 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(5077986..5078405,5078580..5078733,
FT                   5078839..5078939,5079008..5079083,5079293..5079387,
FT                   5079788..5079851,5080126..5080226,5080849..5081010,
FT                   5081094..5081168,5081278..5081389,5081486..5081743,
FT                   5082178..5082335,5082408..5082530,5082619..5082828,
FT                   5083136..5083349,5084160..5084290,5084368..5084484))
FT                   /codon_start=1
FT                   /gene="Rhbdf1"
FT                   /locus_tag="mCG_68021"
FT                   /product="rhomboid family 1 (Drosophila)"
FT                   /note="gene_id=mCG68021.2 transcript_id=mCT68180.2
FT                   protein_id=mCP26083.2"
FT                   /protein_id="EDL23763.1"
FT                   /translation="MSEARRDSTSSLQRKKPPWLKLDIPAVVPPAAEEPSFLQPLRRQA
FT                   FLRSVSMPAETARVPSPHHEPRRLVLQRQTSITQTIRRGTADWFGVSKDSDSTQKWQRK
FT                   SIRHCSQRYGKLKPQVIRELDLPSQDNVSLTSTETPPPLYVGPCQLGMQKIIDPLARGR
FT                   AFRMADDTADGLSAPHTPVTPGAASLCSFSSSRSGFNRLPRRRKRESVAKMSFRAAAAL
FT                   VKGRSIRDGTLRRGQRRSFTPASFLEEDMVDFPDELDTSFFAREGVLHEEMSTYPDEVF
FT                   ESPSEAALKDWEKAPDQADLTGGALDRSELERSHLMLPLERGWRKQKEGGPLAPQPKVR
FT                   LRQEVVSAAGPRRGQRITVPVRKLFAREKRPYGLGMVGRLTNRTYRKRIDSYVKRQIED
FT                   MDDHRPFFTYWLTFVHSLVTILAVCIYGIAPVGFSQHETVDSVLRKRGVYENVKYVQQE
FT                   NFWIGPSSEALIHLGAKFSPCMRQDPQVHSFILAAREREKHSACCVRNDRSGCVQTSKE
FT                   ECSSTLAVWVKWPVHPSAPDLAGNKRQFGSVCHQDPRVCDEPSSEDPHEWPEDITKWPI
FT                   CTKSSAGNHTNHPHMDCVITGRPCCIGTKGRCEITSREYCDFMRGYFHEEATLCSQVHC
FT                   MDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSICFQMTVLRDLEKLAGWHRIA
FT                   IIYLLSGITGNLASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLL
FT                   AVVLFLFAFGLLPWIDNFAHISGFVSGLFLSFAFLPYISFGKFDLYRKRCQIIIFQVVF
FT                   LGLLAGLVVLFYFYPVRCEWCEFLTCIPFTDKFCEKYELDAQLH"
FT   gene            5094824..5100389
FT                   /gene="Mpg"
FT                   /locus_tag="mCG_68013"
FT                   /note="gene_id=mCG68013.1"
FT   mRNA            join(5094824..5095082,5096117..5096314,5098214..5098418,
FT                   5099939..5100389)
FT                   /gene="Mpg"
FT                   /locus_tag="mCG_68013"
FT                   /product="N-methylpurine-DNA glycosylase"
FT                   /note="gene_id=mCG68013.1 transcript_id=mCT68172.1 created
FT                   on 17-MAY-2002"
FT   CDS             join(5094906..5095082,5096117..5096314,5098214..5098418,
FT                   5099939..5100360)
FT                   /codon_start=1
FT                   /gene="Mpg"
FT                   /locus_tag="mCG_68013"
FT                   /product="N-methylpurine-DNA glycosylase"
FT                   /note="gene_id=mCG68013.1 transcript_id=mCT68172.1
FT                   protein_id=mCP26092.1"
FT                   /protein_id="EDL23762.1"
FT                   /translation="MPARGGSARPGRGALKPVSVTLLPDTEQPPFLGRARRPGNARAGS
FT                   LLTGYHEVGQMPAPLSRKIGQKKQRLADSEQQQTPKERLLSTPGLRRSIYFSSPEDHSG
FT                   RLGPEFFDQPAVTLARAFLGQVLVRRLADGTELRGRIVETEAYLGPEDEAAHSRGGRQT
FT                   PRNRGMFMKPGTLYVYLIYGMYFCLNVSSQGAGACVLLRALEPLEGLETMRQLRNSLRK
FT                   STVGRSLKDRELCSGPSKLCQALAIDKSFDQRDLAQDDAVWLEHGPLESSSPAVVVAAA
FT                   RIGIGHAGEWTQKPLRFYVQGSPWVSVVDRVAEQMDQPQQTACSEGLLIVQK"
FT   gene            complement(5100641..5135876)
FT                   /gene="Mare"
FT                   /locus_tag="mCG_68020"
FT                   /note="gene_id=mCG68020.1"
FT   mRNA            complement(join(5100641..5101481,5102250..5102442,
FT                   5103078..5103267,5105131..5105260,5105643..5105749,
FT                   5108119..5108275,5110121..5110258,5116429..5116510,
FT                   5118432..5118585,5122190..5122264,5123755..5123884,
FT                   5131337..5131406,5135668..5135876))
FT                   /gene="Mare"
FT                   /locus_tag="mCG_68020"
FT                   /product="alpha globin regulatory element containing gene,
FT                   transcript variant mCT68179"
FT                   /note="gene_id=mCG68020.1 transcript_id=mCT68179.1 created
FT                   on 17-MAY-2002"
FT   mRNA            complement(join(5101070..5101481,5102250..5102442,
FT                   5103078..5103267,5105131..5105260,5105643..5105749,
FT                   5108119..5108275,5110121..5110258,5116429..5116510,
FT                   5118432..5118585,5122190..5122264,5123755..5123884,
FT                   5127495..5127533,5131337..5131406,5135668..>5135862))
FT                   /gene="Mare"
FT                   /locus_tag="mCG_68020"
FT                   /product="alpha globin regulatory element containing gene,
FT                   transcript variant mCT191878"
FT                   /note="gene_id=mCG68020.1 transcript_id=mCT191878.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(5101316..5101481,5102250..5102442,
FT                   5103078..5103267,5105131..5105260,5105643..5105749,
FT                   5108119..5108275,5110121..5110258,5116429..5116510,
FT                   5118432..5118585,5122190..5122264,5123755..5123884,
FT                   5127495..5127533,5131337..5131406,5135668..>5135860))
FT                   /codon_start=1
FT                   /gene="Mare"
FT                   /locus_tag="mCG_68020"
FT                   /product="alpha globin regulatory element containing gene,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG68020.1 transcript_id=mCT191878.0
FT                   protein_id=mCP112843.0 isoform=CRA_a"
FT                   /protein_id="EDL23760.1"
FT                   /translation="GPGACLRLLRSLREFLSGARPGSRRMGDNTSPISVILVSSGSRGN
FT                   KLLFRYPFQRSQEHPASQTNKPRSRYAVNNTGEHADDQDGDSSKPCPPTDEQLVAGFSD
FT                   VILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQVSKTDPSPKREAPTMILFN
FT                   VVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADAN
FT                   EGPQSPFQHILPKCKLARDLKEAYDSLCTSGVVRLHINSWLEVSFCLPHKIHYAASSLI
FT                   LPEAIERSLKAIRPYHALLLLSDEKSLLSELPIDCSPALVRVIKTTSAVKNLQQLAQDA
FT                   DLALLQVFQLAAHLVYWGKAVIIYPLCENNVYVLSPNASVCLYSPLAEQFSRQFPSHDL
FT                   PSVLAKFSLPVSLSEFRSPLAPPAQETQLIQMVVWMLQRRLLIQLHTYVCLMASPSEEE
FT                   PRLREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELLPSGDSPLN
FT                   KRMTENLLASLSEHERAAILNVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNENTRRS
FT                   QLLMLFDKFRSVLVVTTHEDPVIAVFQALLT"
FT   CDS             complement(join(5101316..5101481,5102250..5102442,
FT                   5103078..5103267,5105131..5105260,5105643..5105749,
FT                   5108119..5108275,5110121..5110258,5116429..5116510,
FT                   5118432..5118585,5122190..5122264,5123755..5123884,
FT                   5131337..5131406,5135668..5135785))
FT                   /codon_start=1
FT                   /gene="Mare"
FT                   /locus_tag="mCG_68020"
FT                   /product="alpha globin regulatory element containing gene,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG68020.1 transcript_id=mCT68179.1
FT                   protein_id=mCP26074.2 isoform=CRA_b"
FT                   /protein_id="EDL23761.1"
FT                   /translation="MGDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTNKPRSR
FT                   YAVNNTGEHADDQDGDSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHAL
FT                   GQVSKTDPSPKREAPTMILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYL
FT                   TREAKLILALQDEVSAMADANEGPQSPFQHILPKCKLARDLKEAYDSLCTSGVVRLHIN
FT                   SWLEVSFCLPHKIHYAASSLILPEAIERSLKAIRPYHALLLLSDEKSLLSELPIDCSPA
FT                   LVRVIKTTSAVKNLQQLAQDADLALLQVFQLAAHLVYWGKAVIIYPLCENNVYVLSPNA
FT                   SVCLYSPLAEQFSRQFPSHDLPSVLAKFSLPVSLSEFRSPLAPPAQETQLIQMVVWMLQ
FT                   RRLLIQLHTYVCLMASPSEEEPRLREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTL
FT                   TSPSMDNSSAELLPSGDSPLNKRMTENLLASLSEHERAAILNVPAAQNPEDLRMFARLL
FT                   HYFRGRHHLEEIMYNENTRRSQLLMLFDKFRSVLVVTTHEDPVIAVFQALLT"
FT   gene            5144968..5146479
FT                   /gene="Hba-x"
FT                   /locus_tag="mCG_68012"
FT                   /note="gene_id=mCG68012.2"
FT   mRNA            join(5144968..5145123,5145935..5146139,5146246..5146479)
FT                   /gene="Hba-x"
FT                   /locus_tag="mCG_68012"
FT                   /product="hemoglobin X, alpha-like embryonic chain in Hba
FT                   complex"
FT                   /note="gene_id=mCG68012.2 transcript_id=mCT68171.1 created
FT                   on 05-DEC-2002"
FT   CDS             join(5145029..5145123,5145935..5146139,5146246..5146374)
FT                   /codon_start=1
FT                   /gene="Hba-x"
FT                   /locus_tag="mCG_68012"
FT                   /product="hemoglobin X, alpha-like embryonic chain in Hba
FT                   complex"
FT                   /note="gene_id=mCG68012.2 transcript_id=mCT68171.1
FT                   protein_id=mCP26085.0"
FT                   /db_xref="GOA:Q78PA4"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR002338"
FT                   /db_xref="InterPro:IPR002340"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="MGI:MGI:96019"
FT                   /db_xref="UniProtKB/TrEMBL:Q78PA4"
FT                   /protein_id="EDL23759.1"
FT                   /translation="MSLMKNERAIIMSMWEKMAAQAEPIGTETLERLFCSYPQTKTYFP
FT                   HFDLHHGSQQLRAHGFKIMTAVGDAVKSIDNLSSALTKLSELHAYILRVDPVNFKLLSH
FT                   CLLVTMAARFPADFTPEVHEAWDKFMSILSSILTEKYR"
FT   gene            5152062..5152910
FT                   /locus_tag="mCG_141811"
FT                   /note="gene_id=mCG141811.0"
FT   mRNA            join(5152062..5152189,5152767..5152910)
FT                   /locus_tag="mCG_141811"
FT                   /product="mCG141811"
FT                   /note="gene_id=mCG141811.0 transcript_id=mCT176781.0
FT                   created on 05-DEC-2002"
FT   CDS             join(5152156..5152189,5152767..5152882)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141811"
FT                   /product="mCG141811"
FT                   /note="gene_id=mCG141811.0 transcript_id=mCT176781.0
FT                   protein_id=mCP99703.0"
FT                   /protein_id="EDL23758.1"
FT                   /translation="MVLNMELKPWKACLCEHRADLQVPLSCLLRGLPSGHALLLSLAPV
FT                   PLGL"
FT   gene            5155382..>5156072
FT                   /locus_tag="mCG_1039741"
FT                   /note="gene_id=mCG1039741.1"
FT   mRNA            join(5155382..5155537,5155633..5155837,5155944..>5156072)
FT                   /locus_tag="mCG_1039741"
FT                   /product="mCG1039741"
FT                   /note="gene_id=mCG1039741.1 transcript_id=mCT157445.1
FT                   created on 05-DEC-2002"
FT   CDS             join(5155443..5155537,5155633..5155837,5155944..5156072)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1039741"
FT                   /product="mCG1039741"
FT                   /note="gene_id=mCG1039741.1 transcript_id=mCT157445.1
FT                   protein_id=mCP58641.1"
FT                   /db_xref="GOA:B9EIX8"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR002338"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="MGI:MGI:3613460"
FT                   /db_xref="UniProtKB/TrEMBL:B9EIX8"
FT                   /protein_id="EDL23757.1"
FT                   /translation="MARSQDDHWLVLALWKKMGSNVGIYATEALERTFVAFPSTKTYFP
FT                   HLDLRPGSSQVKAHAQKVADALTLATQHLDDLPASLSALSDLHAHKLCVDPANFQFFSH
FT                   CLLVTLARHYPGDFSPEMHASLDKFLGHVTSALVSKYR"
FT   gene            5168534..5169342
FT                   /locus_tag="mCG_68017"
FT                   /note="gene_id=mCG68017.1"
FT   mRNA            join(5168534..5168680,5168776..5168980,5169087..5169342)
FT                   /locus_tag="mCG_68017"
FT                   /product="mCG68017"
FT                   /note="gene_id=mCG68017.1 transcript_id=mCT68176.1 created
FT                   on 17-MAY-2002"
FT   CDS             join(5168586..5168680,5168776..5168980,5169087..5169224)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68017"
FT                   /product="mCG68017"
FT                   /note="gene_id=mCG68017.1 transcript_id=mCT68176.1
FT                   protein_id=mCP26081.2"
FT                   /db_xref="GOA:Q8BYM1"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR002338"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="MGI:MGI:2685722"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BYM1"
FT                   /protein_id="EDL23756.1"
FT                   /translation="MARSQDDQWLVLALWKKMGSNVGIYTTEALERTFVAFPSTKTYFP
FT                   HLDLRPGSSQVKAHAQKVADALTLATQHLDDLPASLSALSDLHAHKLCVDPANFQFFSC
FT                   CLLVTLARHYPGDFSGEKDACLLGHVSGSCDFCTGLQVMLN"
FT   gene            <5239879..5292400
FT                   /gene="G431001E03Rik"
FT                   /locus_tag="mCG_118592"
FT                   /note="gene_id=mCG118592.1"
FT   mRNA            join(<5239879..5239963,5250043..5250118,5256544..5256620,
FT                   5265092..5265183,5265716..5265741,5272527..5272661,
FT                   5276249..5276353,5280278..5280395,5283021..5283247,
FT                   5284743..5284792,5285900..5286025,5290845..>5291071)
FT                   /gene="G431001E03Rik"
FT                   /locus_tag="mCG_118592"
FT                   /product="RIKEN cDNA G431001E03, transcript variant
FT                   mCT191885"
FT                   /note="gene_id=mCG118592.1 transcript_id=mCT191885.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<5239880..5239963,5250043..5250118,5256544..5256620,
FT                   5265092..5265183,5265716..5265741,5272527..5272661,
FT                   5276249..5276353,5280278..5280395,5283021..5283247,
FT                   5284743..5284792,5285900..5286025,5290845..>5291071)
FT                   /codon_start=1
FT                   /gene="G431001E03Rik"
FT                   /locus_tag="mCG_118592"
FT                   /product="RIKEN cDNA G431001E03, isoform CRA_b"
FT                   /note="gene_id=mCG118592.1 transcript_id=mCT191885.0
FT                   protein_id=mCP112836.0 isoform=CRA_b"
FT                   /protein_id="EDL23755.1"
FT                   /translation="QVYIIRVTWSSGATEAIYRRYSKFFDLQMQMLDKFPMEGGQKDPK
FT                   QRIIPFLPGKILFRRSHIRDVAVKRLIPIDEYCKALIQLPPYISQCDEVLQFFETRPED
FT                   LNPPKEEHIGKKKSGNDPTSVDPMVLEQYVVVADYQKQESSEISLSVGQVVDIIEKNES
FT                   GWWFVSTAEEQGWVPATCLEGQDGVQDEFSLQPEEEEKYTVIYPYTARDQDEMNLERGA
FT                   VVEVVQKNLEGWWKIRYQGKEGWAPASYLKKNSGEPLPPKLGPSSPAHSGALDLDGVSR
FT                   HQNAMGREKELLNNQRDGRFEGRLVPDGDVKQRSPKMRQRPPPRRDMTIPRGLNLPKPP
FT                   IPPQVEEEYYTIAEFQTTIPDGISFQAGLKVEVIEKSLSGWWYIQMEDKEGWAPATFID
FT                   KYKKTSSASRPNFLAPLPHEMTQLRLGDAAATENNTGPEAVGPSRPLP"
FT   mRNA            join(5239883..5239963,5250043..5250118,5256544..5256620,
FT                   5265092..5265183,5265716..5265741,5272527..5272661,
FT                   5276249..5276353,5280278..5280395,5283021..5283139,
FT                   5284743..5284792,5285900..5286025,5290845..5292400)
FT                   /gene="G431001E03Rik"
FT                   /locus_tag="mCG_118592"
FT                   /product="RIKEN cDNA G431001E03, transcript variant
FT                   mCT119749"
FT                   /note="gene_id=mCG118592.1 transcript_id=mCT119749.0
FT                   created on 17-MAY-2002"
FT   CDS             join(5250043..5250118,5256544..5256620,5265092..5265183,
FT                   5265716..5265741,5272527..5272661,5276249..5276353,
FT                   5280278..5280395,5283021..5283139,5284743..5284792,
FT                   5285900..5286025,5290845..5292383)
FT                   /codon_start=1
FT                   /gene="G431001E03Rik"
FT                   /locus_tag="mCG_118592"
FT                   /product="RIKEN cDNA G431001E03, isoform CRA_a"
FT                   /note="gene_id=mCG118592.1 transcript_id=mCT119749.0
FT                   protein_id=mCP58627.1 isoform=CRA_a"
FT                   /protein_id="EDL23754.1"
FT                   /translation="MQMLDKFPMEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLIP
FT                   IDEYCKALIQLPPYISQCDEVLQFFETRPEDLNPPKEEHIGKKKSGNDPTSVDPMVLEQ
FT                   YVVVADYQKQESSEISLSVGQVVDIIEKNESGWWFVSTAEEQGWVPATCLEGQDGVQDE
FT                   FSLQPEEEEKYTVIYPYTARDQDEMNLERGAVVEVVQKNLEGWWKIRYQGKEGWAPASY
FT                   LKKNSGEPLPPKLGPSSPAHSGALDLDGSPKMRQRPPPRRDMTIPRGLNLPKPPIPPQV
FT                   EEEYYTIAEFQTTIPDGISFQAGLKVEVIEKSLSGWWYIQMEDKEGWAPATFIDKYKKT
FT                   SSASRPNFLAPLPHEMTQLRLGDAAATENNTGPEAVGPSRPLPEAPHGAVDSGMLWSKD
FT                   WKGGKEAPRKASSDLSASTGYEEISDPTQEEKPSLPPRKESIIKSEEELLERERQKMEP
FT                   LRGSSPKPPGMILPMIPAKHAPLARDSRKPEPKLDKSKFPLRNDMGLECGHKVLAKEVK
FT                   KPNLRPISRSKAELSEEKVDPTSQNLFMKSRPQVRPKPTPSPKTEPAQSEDHVDIYNLR
FT                   SKLRPAKSQEKALLDGESHHAAGSHDTALSRSFLPGEGPGHGQDRSGRQDGLSPKETPC
FT                   RAPPRPAKTTDPGPKNVPVPVQEATLQQRPVVPPRRPPPPKKTSSSPLSCRPLPEVRGA
FT                   QREESRVAPAAGRALLVPPKAKPFLSNSSVGQDDMRGKGGLGPRVTGKVGETREKAASF
FT                   LNADGPKDSLYVAVANFEGDEDTSSFQEGTVFEVREKNSSGWWFCQVLSGAPSWEGWIP
FT                   SNYLRKKP"
FT   gene            5324337..5389182
FT                   /gene="9630054F20Rik"
FT                   /locus_tag="mCG_68025"
FT                   /note="gene_id=mCG68025.1"
FT   mRNA            join(5324337..5324406,5369713..5369949,5386562..5389182)
FT                   /gene="9630054F20Rik"
FT                   /locus_tag="mCG_68025"
FT                   /product="RIKEN cDNA 9630054F20"
FT                   /note="gene_id=mCG68025.1 transcript_id=mCT68184.1 created
FT                   on 17-MAY-2002"
FT   CDS             join(5369775..5369949,5386562..5386959)
FT                   /codon_start=1
FT                   /gene="9630054F20Rik"
FT                   /locus_tag="mCG_68025"
FT                   /product="RIKEN cDNA 9630054F20"
FT                   /note="gene_id=mCG68025.1 transcript_id=mCT68184.1
FT                   protein_id=mCP26099.2"
FT                   /protein_id="EDL23753.1"
FT                   /translation="MTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELA
FT                   QAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPEPPPNS
FT                   GHESQLRLRLSTGKDLRLVVRSTDTVFHMKRRLHATEGVEPGSQRWFFSGRPLTDKMKL
FT                   EELKIPKDYVVQVIVSQPVQTPTPVEN"
FT   gene            complement(5393215..5398053)
FT                   /gene="1700007I06Rik"
FT                   /locus_tag="mCG_68026"
FT                   /note="gene_id=mCG68026.1"
FT   mRNA            complement(join(5393215..5393455,5393998..5394174,
FT                   5394864..5395012,5397857..5398053))
FT                   /gene="1700007I06Rik"
FT                   /locus_tag="mCG_68026"
FT                   /product="RIKEN cDNA 1700007I06"
FT                   /note="gene_id=mCG68026.1 transcript_id=mCT68185.1 created
FT                   on 17-MAY-2002"
FT   CDS             complement(join(5393267..5393455,5393998..5394174,
FT                   5394864..5395012,5397857..5397992))
FT                   /codon_start=1
FT                   /gene="1700007I06Rik"
FT                   /locus_tag="mCG_68026"
FT                   /product="RIKEN cDNA 1700007I06"
FT                   /note="gene_id=mCG68026.1 transcript_id=mCT68185.1
FT                   protein_id=mCP26073.2"
FT                   /protein_id="EDL23752.1"
FT                   /translation="MKLTPGCFLWYLYMDKIYCLLSLRNVKALMVYFHLLDVHHRNTLN
FT                   DVLFFHFLQHVTNLNKSQIGMIFDLLDWTAVGEIGFDQFYVLICILLAHQDHLEDHFMY
FT                   RHSRPVFELLDLDGEMNIGAANFQNYRFLFNIKKQELRDLFHDFDITGDRLLNYKEFKL
FT                   YTIFCTDKSIDRKKRRKDREAAREREKEKGKDKEKYLHLKKIYSSMLSHRSIL"
FT   gene            5403750..5494881
FT                   /gene="Stk10"
FT                   /locus_tag="mCG_140967"
FT                   /note="gene_id=mCG140967.0"
FT   mRNA            join(5403750..5403985,5425610..5425774,5445121..5445169,
FT                   5448238..5448387,5457456..5457528,5458899..5459093,
FT                   5459553..5459634,5466720..5466854,5468544..5469089,
FT                   5470854..5470921,5474060..5474186,5474517..5474696,
FT                   5480763..5480855,5482801..5482930,5483592..5483716,
FT                   5484655..5484843,5485980..5486105,5488168..5488281,
FT                   5492722..5494881)
FT                   /gene="Stk10"
FT                   /locus_tag="mCG_140967"
FT                   /product="serine/threonine kinase 10"
FT                   /note="gene_id=mCG140967.0 transcript_id=mCT172462.0
FT                   created on 13-AUG-2002"
FT   CDS             join(5403830..5403985,5425610..5425774,5445121..5445169,
FT                   5448238..5448387,5457456..5457528,5458899..5459093,
FT                   5459553..5459634,5466720..5466854,5468544..5469089,
FT                   5470854..5470921,5474060..5474186,5474517..5474696,
FT                   5480763..5480855,5482801..5482930,5483592..5483716,
FT                   5484655..5484843,5485980..5486105,5488168..5488281,
FT                   5492722..5492859)
FT                   /codon_start=1
FT                   /gene="Stk10"
FT                   /locus_tag="mCG_140967"
FT                   /product="serine/threonine kinase 10"
FT                   /note="gene_id=mCG140967.0 transcript_id=mCT172462.0
FT                   protein_id=mCP95381.0"
FT                   /protein_id="EDL23751.1"
FT                   /translation="MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNDVWEIVGELGDG
FT                   AFGKVYKAKNKETGALAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYYDG
FT                   KLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHGKRIIHRDLKAGNV
FT                   LMTLEGDIRLADFGVSAKNLKTLQKRDSFIGTPYWMAPEVVLCETMKDAPYDYKADIWS
FT                   LGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPET
FT                   RPSAAQLLQHPFVSRVTSNKALRELVAEAKAEVMEEIEDGREDGEEEDAVDAVPPLVNH
FT                   TQDSANVTQPSLDSNKLLQDSSTPLPPSQPQEPVNGPCSQPSGDGPLQTTSPADGLSKN
FT                   DNDLKVPVPLRKSRPLSMDARIQMDEEKQIPDQDENPSPAASKSQKANQSRPNSSALET
FT                   LGGEALTNGGLELPSSVTPSHSKRASDCSNLSTSESMDYGTSLSADLSLNKETGSLSLK
FT                   GSKLHNKTLKRTRRFVVDGVEVSRRQELRELRLLQKEEHRNQTQLSSKHELQLEQMHKR
FT                   FEQEINAKKKFYDVELENLERQQKQQVEKMEQDHSVRRKEEAKRIRLEQDRDYAKFQEQ
FT                   LKQMKKEVKSEVEKLPRQQRKESMKQKMEEHSQKKQRLDRDFVAKQKEDLELAMRKLTT
FT                   ENRREICDKERDCLSKKQELLRDREAALWEMEEHQLQERHQLVKQQLKDQYFLQRHDLL
FT                   RKHEKEREQMQRYNQRMMEQLKVRQQQEKARLPKIQRSDGKTRMAMYKKSLHINGAGSA
FT                   SEQREKIKQFSQQEEKRQKAERLQQQQKHENQMRDMVAQCESNMSELQQLQNEKCHLLV
FT                   EHETQKLKALDESHNQSLKEWRDKLRPRKKALEEDLNQKKREQEMFFKLSEEAEPRPTT
FT                   PSKASNFFPYSSGDAS"
FT   gene            <5512716..5615317
FT                   /gene="Fbxw11"
FT                   /locus_tag="mCG_68073"
FT                   /note="gene_id=mCG68073.1"
FT   mRNA            join(<5512716..5512859,5549042..5549143,5577218..5577280,
FT                   5580797..5581054,5590265..5590338,5591709..5591799,
FT                   5602041..5602159,5603679..5603928,5606903..5607021,
FT                   5607697..5607807,5608720..5608798,5613059..5615317)
FT                   /gene="Fbxw11"
FT                   /locus_tag="mCG_68073"
FT                   /product="F-box and WD-40 domain protein 11"
FT                   /note="gene_id=mCG68073.1 transcript_id=mCT68233.2 created
FT                   on 16-MAY-2002"
FT   CDS             join(<5590286..5590338,5591709..5591799,5602041..5602159,
FT                   5603679..5603928,5606903..5607021,5607697..5607807,
FT                   5608720..5608798,5613059..5613190)
FT                   /codon_start=1
FT                   /gene="Fbxw11"
FT                   /locus_tag="mCG_68073"
FT                   /product="F-box and WD-40 domain protein 11"
FT                   /note="gene_id=mCG68073.1 transcript_id=mCT68233.2
FT                   protein_id=mCP26089.2"
FT                   /protein_id="EDL23750.1"
FT                   /translation="QKTFSPTWMPGLCVQQSWDQYLFKNRPTDGPPNSFYRSLYPKIIQ
FT                   DIEIWDKSSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHH
FT                   NEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVS
FT                   ASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLR
FT                   VLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVGFLVLNY
FT                   WLYGYHMPKGVRSQLSLGLDWFQMLGRYRAAPPLKP"
FT   gene            complement(5659922..5660887)
FT                   /locus_tag="mCG_147813"
FT                   /note="gene_id=mCG147813.0"
FT   mRNA            complement(join(5659922..5660334,5660631..5660887))
FT                   /locus_tag="mCG_147813"
FT                   /product="mCG147813"
FT                   /note="gene_id=mCG147813.0 transcript_id=mCT188076.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(5660299..5660334,5660631..5660774))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147813"
FT                   /product="mCG147813"
FT                   /note="gene_id=mCG147813.0 transcript_id=mCT188076.0
FT                   protein_id=mCP108535.0"
FT                   /protein_id="EDL23749.1"
FT                   /translation="MFGYVVSSFDSCSFFPASLLFRQMCSPEISPVNPVCLIDSLLSIC
FT                   SEMQNQTLMENILS"
FT   gene            complement(5688690..5694753)
FT                   /locus_tag="mCG_68074"
FT                   /note="gene_id=mCG68074.2"
FT   mRNA            complement(join(5688690..5688762,5692030..5692097,
FT                   5692276..5692327,5694603..5694747))
FT                   /locus_tag="mCG_68074"
FT                   /product="mCG68074, transcript variant mCT168922"
FT                   /note="gene_id=mCG68074.2 transcript_id=mCT168922.0 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(5688745..5688762,5692030..5692097,
FT                   5692276..5692327,5694603..5694695))
FT                   /codon_start=1
FT                   /locus_tag="mCG_68074"
FT                   /product="mCG68074, isoform CRA_a"
FT                   /note="gene_id=mCG68074.2 transcript_id=mCT168922.0
FT                   protein_id=mCP91756.0 isoform=CRA_a"
FT                   /db_xref="GOA:A6PWJ8"
FT                   /db_xref="InterPro:IPR027880"
FT                   /db_xref="MGI:MGI:1916601"
FT                   /db_xref="UniProtKB/TrEMBL:A6PWJ8"
FT                   /protein_id="EDL23747.1"
FT                   /translation="MTIQKTGCRGREAAEVVEQRRRSHHCDDRKQTLLALLILVLYLGM
FT                   GISGSSWEVSGQTKDCNHFQNPVTPQAGAPA"
FT   mRNA            complement(join(5690539..5690853,5692030..5692097,
FT                   5692276..5692327,5694603..5694753))
FT                   /locus_tag="mCG_68074"
FT                   /product="mCG68074, transcript variant mCT68234"
FT                   /note="gene_id=mCG68074.2 transcript_id=mCT68234.1 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(5690656..5690853,5692030..5692097,
FT                   5692276..5692327,5694603..5694695))
FT                   /codon_start=1
FT                   /locus_tag="mCG_68074"
FT                   /product="mCG68074, isoform CRA_b"
FT                   /note="gene_id=mCG68074.2 transcript_id=mCT68234.1
FT                   protein_id=mCP26090.2 isoform=CRA_b"
FT                   /protein_id="EDL23748.1"
FT                   /translation="MTIQKTGCRGREAAEVVEQRRRSHHCDDRKQTLLALLILVLYLGM
FT                   GISGSSWEVSGQTKDCNHFQNPVTPQGFEYQTKEPAEEPLRTLRKWLKINLHGFLEKLE
FT                   KEVRELEQLVRDLEFWLDALLGDLRPEDPCFT"
FT   gene            complement(5752327..5753081)
FT                   /pseudo
FT                   /locus_tag="mCG_118645"
FT                   /note="gene_id=mCG118645.1"
FT   mRNA            complement(5752327..5753081)
FT                   /pseudo
FT                   /locus_tag="mCG_118645"
FT                   /note="gene_id=mCG118645.1 transcript_id=mCT119803.1
FT                   created on 16-MAY-2002"
FT   gene            complement(5909170..5910200)
FT                   /locus_tag="mCG_68071"
FT                   /note="gene_id=mCG68071.0"
FT   mRNA            complement(5909170..5910200)
FT                   /locus_tag="mCG_68071"
FT                   /product="mCG68071"
FT                   /note="gene_id=mCG68071.0 transcript_id=mCT68231.0 created
FT                   on 16-MAY-2002"
FT   CDS             complement(5909236..5910123)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68071"
FT                   /product="mCG68071"
FT                   /note="gene_id=mCG68071.0 transcript_id=mCT68231.0
FT                   protein_id=mCP26080.1"
FT                   /protein_id="EDL23746.1"
FT                   /translation="MSGALDALQMKEEGVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDG
FT                   IYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFT
FT                   PGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLCYVDIAIPC
FT                   NNKGAHSVGLMWWMLAREVLCMRGTISREHPWEVMPDLYFYRDPEETEKEEQAAAEKAV
FT                   TEEEFQGEWTAPAPEFTAAQPEVADWSEGVQLPSVPIQQFPTEDWCAQPATEDWSAAPP
FT                   AQATEWVGATTEWS"
FT   gene            complement(5980729..6010782)
FT                   /gene="Fgf18"
FT                   /locus_tag="mCG_68070"
FT                   /note="gene_id=mCG68070.1"
FT   mRNA            complement(join(5980729..5981330,5987914..5988020,
FT                   5997477..5997657,6010421..6010457,6010618..6010782))
FT                   /gene="Fgf18"
FT                   /locus_tag="mCG_68070"
FT                   /product="fibroblast growth factor 18"
FT                   /note="gene_id=mCG68070.1 transcript_id=mCT68230.1 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(5981064..5981330,5987914..5988020,
FT                   5997477..5997657,6010421..6010457,6010618..6010649))
FT                   /codon_start=1
FT                   /gene="Fgf18"
FT                   /locus_tag="mCG_68070"
FT                   /product="fibroblast growth factor 18"
FT                   /note="gene_id=mCG68070.1 transcript_id=mCT68230.1
FT                   protein_id=mCP26077.2"
FT                   /protein_id="EDL23745.1"
FT                   /translation="MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARD
FT                   DVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKET
FT                   EFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGP
FT                   KTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG"
FT   gene            complement(6015918..6026412)
FT                   /locus_tag="mCG_68069"
FT                   /note="gene_id=mCG68069.1"
FT   mRNA            complement(join(6015918..6016259,6017394..6017468,
FT                   6019411..6019512,6020072..6020155,6020399..6020456,
FT                   6023342..6023403,6023688..6023794,6024182..6024275,
FT                   6024460..6024579,6024902..6024981,6026277..6026412))
FT                   /locus_tag="mCG_68069"
FT                   /product="mCG68069"
FT                   /note="gene_id=mCG68069.1 transcript_id=mCT68229.0 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(6016221..6016259,6017394..6017468,
FT                   6019411..6019512,6020072..6020155,6020399..6020456,
FT                   6023342..6023403,6023688..6023794,6024182..6024275,
FT                   6024460..6024579,6024902..6024981,6026277..6026334))
FT                   /codon_start=1
FT                   /locus_tag="mCG_68069"
FT                   /product="mCG68069"
FT                   /note="gene_id=mCG68069.1 transcript_id=mCT68229.0
FT                   protein_id=mCP26071.1"
FT                   /db_xref="GOA:Q5SQB7"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQB7"
FT                   /protein_id="EDL23744.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEA
FT                   IQDLWQWRKSL"
FT   gene            complement(6063960..6066799)
FT                   /gene="Tlx3"
FT                   /locus_tag="mCG_68068"
FT                   /note="gene_id=mCG68068.2"
FT   mRNA            complement(join(6063960..6064695,6065641..6065884,
FT                   6066251..6066799))
FT                   /gene="Tlx3"
FT                   /locus_tag="mCG_68068"
FT                   /product="T-cell leukemia, homeobox 3"
FT                   /note="gene_id=mCG68068.2 transcript_id=mCT68228.1 created
FT                   on 05-DEC-2002"
FT   CDS             complement(join(6064485..6064695,6065641..6065884,
FT                   6066251..6066671))
FT                   /codon_start=1
FT                   /gene="Tlx3"
FT                   /locus_tag="mCG_68068"
FT                   /product="T-cell leukemia, homeobox 3"
FT                   /note="gene_id=mCG68068.2 transcript_id=mCT68228.1
FT                   protein_id=mCP26094.0"
FT                   /db_xref="GOA:O55144"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:1351209"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55144"
FT                   /protein_id="EDL23743.1"
FT                   /translation="MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLG
FT                   GPPGGRPGAAYPSLPASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPL
FT                   PSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTP
FT                   PKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWR
FT                   RQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDS
FT                   SKVPAVTSLV"
FT   gene            <6067266..6084666
FT                   /locus_tag="mCG_146239"
FT                   /note="gene_id=mCG146239.0"
FT   mRNA            join(<6067266..6067508,6079000..6079150,6081681..6081765,
FT                   6082375..6084666)
FT                   /locus_tag="mCG_146239"
FT                   /product="mCG146239"
FT                   /note="gene_id=mCG146239.0 transcript_id=mCT186342.0
FT                   created on 14-JUL-2003"
FT   gene            complement(6075632..6377630)
FT                   /gene="Ranbp17"
FT                   /locus_tag="mCG_118644"
FT                   /note="gene_id=mCG118644.2"
FT   mRNA            complement(join(6075632..6076710,6080481..6080608,
FT                   6082360..6082458,6106302..6106468,6127828..6127966,
FT                   6129302..6129516,6147071..6147153,6152719..6152826,
FT                   6160497..6160585,6165920..6166023,6181487..6181595,
FT                   6181676..6181739,6191658..6191738,6192686..6192759,
FT                   6305006..6305141,6315719..6315824,6337986..6338179,
FT                   6341263..6341435,6342244..6342390,6344123..6344242,
FT                   6346107..6346180,6349028..6349193,6350709..6350813,
FT                   6354396..6354461,6356325..6356491,6363815..6363905,
FT                   6367822..6367968,6377587..6377630))
FT                   /gene="Ranbp17"
FT                   /locus_tag="mCG_118644"
FT                   /product="RAN binding protein 17, transcript variant
FT                   mCT168915"
FT                   /note="gene_id=mCG118644.2 transcript_id=mCT168915.1
FT                   created on 19-DEC-2002"
FT   mRNA            complement(join(6076437..6076710,6080481..6080608,
FT                   6082360..6082458,6106302..6106468,6127828..6127966,
FT                   6129302..6129516,6147071..6147153,6152719..6152826,
FT                   6160497..6160585,6165920..6166023,6181487..6181595,
FT                   6181676..6181739,6191658..6191738,6192686..6192759,
FT                   6267298..6267415,6305006..6305141,6315719..6315824,
FT                   6337986..6338179,6341263..6341435,6342244..6342390,
FT                   6344123..6344242,6346107..6346180,6349028..6349193,
FT                   6350709..6350813,6354396..6354461,6356325..6356491,
FT                   6363815..6363905,6367822..6367968,6377587..>6377625))
FT                   /gene="Ranbp17"
FT                   /locus_tag="mCG_118644"
FT                   /product="RAN binding protein 17, transcript variant
FT                   mCT191879"
FT                   /note="gene_id=mCG118644.2 transcript_id=mCT191879.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(6076614..6076710,6080481..6080608,
FT                   6082360..6082458,6106302..6106468,6127828..6127966,
FT                   6129302..6129516,6147071..6147153,6152719..6152826,
FT                   6160497..6160585,6165920..6166023,6181487..6181595,
FT                   6181676..6181739,6191658..6191738,6192686..6192759,
FT                   6305006..6305141,6315719..6315824,6337986..6338179,
FT                   6341263..6341435,6342244..6342390,6344123..6344242,
FT                   6346107..6346180,6349028..6349193,6350709..6350813,
FT                   6354396..6354461,6356325..6356491,6363815..6363905,
FT                   6367822..6367968,6377587..6377604))
FT                   /codon_start=1
FT                   /gene="Ranbp17"
FT                   /locus_tag="mCG_118644"
FT                   /product="RAN binding protein 17, isoform CRA_a"
FT                   /note="gene_id=mCG118644.2 transcript_id=mCT168915.1
FT                   protein_id=mCP91757.1 isoform=CRA_a"
FT                   /protein_id="EDL23740.1"
FT                   /translation="MALHFQSLAELEVLCTHLYVGTDLTERIEAEKALLELIDSPECLS
FT                   KCQLLLEQGTTSYAQLLAATCLSKLVTRINPLPIEQRIDIRNYILNYVASQPKLAPFVI
FT                   QALIQVIAKLTKLGWFEVQKDEFVFREIIADVKKFLQGTVEHCIIGVIILCELTQEMNL
FT                   VDYSRPSAKHRKIATSFRDTSLKDILVLACSLLKQVLAKPLNLQDQDQQSLVMQVLKLV
FT                   LSCLNFDFLGSSADESADDLCTVQIPTTWRTIFLEPETLDLFFNLYHSLPPLLSQLALS
FT                   CLVQFASTRRSLFSSPERAKYLGNLIKGVKRILENPQGLSDPGNYHEFCRFLARLKTNY
FT                   QLGELVLVKEYAEVIGLIANFTITSLQHWEFAPNSVHYLLTLWQRMVASVPFVKSAEPH
FT                   LLDTYAPEITKAFITSRLESVAIVVRDNLEDPLDDTATVFQQLEQLCTVSRCEYEKTCT
FT                   LLVQLFDQNAQNYQKLLHAAPGLAVDMAIQEGRLAWLIYLVGTVVGGRLTYTSTDEHDA
FT                   MDGELSCRVFQLISLMDTRLPHCTNEKIELAVLWFLDQFRKTYVGDQLQRTSKVYARMS
FT                   EVLGITDDNHVLETFMTKIVTNLKYWGRCEPVISRTLQFLSDLSVGYILLKKLVKIDAV
FT                   KFMLKNHTSEHFPFLGISETYNVGDFRCRTTFYTALTRLLMVDLGEDEDEFENFMLPLT
FT                   VSFETVLQIFNNNFKQEEVKRMLIGLARDLRGIAFALNTKTSYTMLFDWIYPAYLPVLQ
FT                   RAIERWYGEPACTTPILKLLAELMQNRSQRLNFDVSSPNGILLFREASKMICTYGNQIL
FT                   SLGSLSKDKIYPMKLKGISICYSALKSALCGNYVSFGVFKLYGDNHFDNVLQAFVKMLL
FT                   SVSHSDLLQYRKLSQSYYPLLECLTQDHMSFITNLEPPVLLYVLTSLSEGLTTLDTVVS
FT                   SSCCTSLDYMVTYLFKHIAKEGKKPLRSREAMQAGQRLLHFMQQNPDVLQQMMSVLMNT
FT                   IVFEDCRNQWSVSRPLLGLILLNEKYFSELRASLINSQPLPKQEVLGQCFRNLMEGVEQ
FT                   NLSVKNRDRFTQNLSVFRRDVAEALRSDGHTDLSSLDMMS"
FT   CDS             <6083367..6083765
FT                   /codon_start=1
FT                   /locus_tag="mCG_146239"
FT                   /product="mCG146239"
FT                   /note="gene_id=mCG146239.0 transcript_id=mCT186342.0
FT                   protein_id=mCP107601.0"
FT                   /protein_id="EDL23742.1"
FT                   /translation="KTTESRLYPQCKVASDGLVGMVKDGECALGMRHDRRESRQMAVKW
FT                   ADFSCCSLSAPIALEKTQMQGKPKGGGRVRPHRCHPCWASMTCFTLNAFSILPFLHKYE
FT                   CVPCMCLLYVRVRLGVSLKCSQMYLLRY"
FT   gene            complement(6258116..6258615)
FT                   /pseudo
FT                   /locus_tag="mCG_1039733"
FT                   /note="gene_id=mCG1039733.1"
FT   mRNA            complement(6258116..6258615)
FT                   /pseudo
FT                   /locus_tag="mCG_1039733"
FT                   /note="gene_id=mCG1039733.1 transcript_id=mCT157437.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(6267395..6267415,6305006..6305141,
FT                   6315719..6315824,6337986..6338179,6341263..6341435,
FT                   6342244..6342390,6344123..6344242,6346107..6346180,
FT                   6349028..6349193,6350709..6350813,6354396..6354461,
FT                   6356325..6356491,6363815..6363905,6367822..6367968,
FT                   6377587..>6377625))
FT                   /codon_start=1
FT                   /gene="Ranbp17"
FT                   /locus_tag="mCG_118644"
FT                   /product="RAN binding protein 17, isoform CRA_b"
FT                   /note="gene_id=mCG118644.2 transcript_id=mCT191879.0
FT                   protein_id=mCP112837.0 isoform=CRA_b"
FT                   /protein_id="EDL23741.1"
FT                   /translation="GLRRSGKMALHFQSLAELEVLCTHLYVGTDLTERIEAEKALLELI
FT                   DSPECLSKCQLLLEQGTTSYAQLLAATCLSKLVTRINPLPIEQRIDIRNYILNYVASQP
FT                   KLAPFVIQALIQVIAKLTKLGWFEVQKDEFVFREIIADVKKFLQGTVEHCIIGVIILCE
FT                   LTQEMNLVDYSRPSAKHRKIATSFRDTSLKDILVLACSLLKQVLAKPLNLQDQDQQSLV
FT                   MQVLKLVLSCLNFDFLGSSADESADDLCTVQIPTTWRTIFLEPETLDLFFNLYHSLPPL
FT                   LSQLALSCLVQFASTRRSLFSSPERAKYLGNLIKGVKRILENPQGLSDPGNYHEFCRFL
FT                   ARLKTNYQLGELVLVKEYAEVIGLIANFTITSLQHWEFAPNSVHYLLTLWQRMVASVPF
FT                   VKSAEPHLLDTYAPEITKAFITSRLESVAIVVRDNLEDPLDDTATVFQQLEQLCTVSRC
FT                   EYEKTCTLLVQLFDQNAQNYQKLLHAAPGLAVDMAIQEGRLAWLIYLVGTVVGGRLTYT
FT                   STDEHDAMDGELSCRVFQLISLMDTRLPHCTNEKIELAVLWFLDQFRKTYVGDQLQRTS
FT                   KKTGIFL"
FT   gene            complement(6291035..6291699)
FT                   /pseudo
FT                   /locus_tag="mCG_68067"
FT                   /note="gene_id=mCG68067.0"
FT   mRNA            complement(6291035..6291699)
FT                   /pseudo
FT                   /locus_tag="mCG_68067"
FT                   /note="gene_id=mCG68067.0 transcript_id=mCT68227.1 created
FT                   on 15-MAY-2002"
FT   gene            6301651..6302279
FT                   /pseudo
FT                   /locus_tag="mCG_1039740"
FT                   /note="gene_id=mCG1039740.1"
FT   mRNA            6301651..6302279
FT                   /pseudo
FT                   /locus_tag="mCG_1039740"
FT                   /note="gene_id=mCG1039740.1 transcript_id=mCT157444.1
FT                   created on 10-DEC-2002"
FT   gene            6377505..6378444
FT                   /locus_tag="mCG_147810"
FT                   /note="gene_id=mCG147810.0"
FT   mRNA            6377505..6378444
FT                   /locus_tag="mCG_147810"
FT                   /product="mCG147810"
FT                   /note="gene_id=mCG147810.0 transcript_id=mCT188073.0
FT                   created on 13-JAN-2004"
FT   CDS             6378010..6378138
FT                   /codon_start=1
FT                   /locus_tag="mCG_147810"
FT                   /product="mCG147810"
FT                   /note="gene_id=mCG147810.0 transcript_id=mCT188073.0
FT                   protein_id=mCP108533.0"
FT                   /protein_id="EDL23739.1"
FT                   /translation="MRPECRHRWCVLLPTLAPKSVVDRRRDCSAVESTLPHVHNCM"
FT   gene            complement(6415862..6443172)
FT                   /gene="Gabrp"
FT                   /locus_tag="mCG_6676"
FT                   /note="gene_id=mCG6676.1"
FT   mRNA            complement(join(6415862..6417149,6418601..6418788,
FT                   6419275..6419427,6421245..6421382,6428097..6428179,
FT                   6431442..6431659,6432296..6432363,6436637..6436755,
FT                   6437582..6437680,6443077..6443172))
FT                   /gene="Gabrp"
FT                   /locus_tag="mCG_6676"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor, pi"
FT                   /note="gene_id=mCG6676.1 transcript_id=mCT6156.2 created on
FT                   15-MAY-2002"
FT   CDS             complement(join(6416847..6417149,6418601..6418788,
FT                   6419275..6419427,6421245..6421382,6428097..6428179,
FT                   6431442..6431659,6432296..6432363,6436637..6436755,
FT                   6437582..6437634))
FT                   /codon_start=1
FT                   /gene="Gabrp"
FT                   /locus_tag="mCG_6676"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor, pi"
FT                   /note="gene_id=mCG6676.1 transcript_id=mCT6156.2
FT                   protein_id=mCP2974.2"
FT                   /protein_id="EDL23738.1"
FT                   /translation="MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLT
FT                   AGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKS
FT                   FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMD
FT                   LSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVS
FT                   QQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTT
FT                   VLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR
FT                   GPAKDSEEVNITNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKI
FT                   SRIIDYFTIQNPSNVDRYSKLLFPLIFMLANVFYWAYYMYF"
FT   gene            <6468864..6486084
FT                   /locus_tag="mCG_145381"
FT                   /note="gene_id=mCG145381.0"
FT   mRNA            join(<6468864..6469055,6476694..6476769,6477079..6477149,
FT                   6483892..6486084)
FT                   /locus_tag="mCG_145381"
FT                   /product="mCG145381"
FT                   /note="gene_id=mCG145381.0 transcript_id=mCT184805.0
FT                   created on 05-JUN-2003"
FT   CDS             <6484131..6484880
FT                   /codon_start=1
FT                   /locus_tag="mCG_145381"
FT                   /product="mCG145381"
FT                   /note="gene_id=mCG145381.0 transcript_id=mCT184805.0
FT                   protein_id=mCP105850.0"
FT                   /protein_id="EDL23737.1"
FT                   /translation="AEEPEPSQGAQLCGHWPVQVTRLHRPVLVICLHCPAQVTHLPRPI
FT                   LATHLHCPVLVTHLHCHVLVTHLRCPVLVTCLHRPVLVTCLHHPVLLTRLHRPVLVTHL
FT                   HRPVLVICLHCPAQVTHLPRPILATHLHCPVLVTRLHCPVLVTRLHRPVLVICLHCPAQ
FT                   VTHLHCPALVTHLHCPVLVTRLHCPALVTHLHCPVLVTHLHCPALVTHLHCPAQVTRLH
FT                   CIVAGSIIMLNYSLFIPSGSRQLLIFI"
FT   gene            complement(6490661..6705536)
FT                   /gene="Kcnip1"
FT                   /locus_tag="mCG_141873"
FT                   /note="gene_id=mCG141873.0"
FT   mRNA            complement(join(6490661..6491469,6494019..6494081,
FT                   6495450..6495554,6503302..6503409,6504167..6504237,
FT                   6506338..6506462,6705088..6705536))
FT                   /gene="Kcnip1"
FT                   /locus_tag="mCG_141873"
FT                   /product="Kv channel-interacting protein 1, transcript
FT                   variant mCT177220"
FT                   /note="gene_id=mCG141873.0 transcript_id=mCT177220.0
FT                   created on 10-DEC-2002"
FT   mRNA            complement(join(6490661..6491469,6494019..6494081,
FT                   6495450..6495554,6503302..6503409,6504167..6504237,
FT                   6506338..6506650,6705088..6705536))
FT                   /gene="Kcnip1"
FT                   /locus_tag="mCG_141873"
FT                   /product="Kv channel-interacting protein 1, transcript
FT                   variant mCT177218"
FT                   /note="gene_id=mCG141873.0 transcript_id=mCT177218.0
FT                   created on 10-DEC-2002"
FT   mRNA            complement(join(6490661..6491469,6494019..6494081,
FT                   6495450..6495554,6503302..6503409,6504167..6504237,
FT                   6506338..6506462,6512375..6512407,6705088..6705536))
FT                   /gene="Kcnip1"
FT                   /locus_tag="mCG_141873"
FT                   /product="Kv channel-interacting protein 1, transcript
FT                   variant mCT177219"
FT                   /note="gene_id=mCG141873.0 transcript_id=mCT177219.0
FT                   created on 10-DEC-2002"
FT   CDS             complement(join(6504175..6504237,6506338..6506462,
FT                   6705088..6705148))
FT                   /codon_start=1
FT                   /gene="Kcnip1"
FT                   /locus_tag="mCG_141873"
FT                   /product="Kv channel-interacting protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG141873.0 transcript_id=mCT177220.0
FT                   protein_id=mCP100141.0 isoform=CRA_b"
FT                   /protein_id="EDL23735.1"
FT                   /translation="MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQ
FT                   TNFTKRELQVLYRGFKNMPAHMHITSSMPSTPPRQAL"
FT   CDS             complement(join(6504175..6504237,6506338..6506462,
FT                   6512375..6512407,6705088..6705148))
FT                   /codon_start=1
FT                   /gene="Kcnip1"
FT                   /locus_tag="mCG_141873"
FT                   /product="Kv channel-interacting protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG141873.0 transcript_id=mCT177219.0
FT                   protein_id=mCP100140.0 isoform=CRA_c"
FT                   /protein_id="EDL23736.1"
FT                   /translation="MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCH
FT                   RPEGLEQLEAQTNFTKRELQVLYRGFKNMPAHMHITSSMPSTPPRQAL"
FT   CDS             complement(join(6506529..6506650,6705088..6705148))
FT                   /codon_start=1
FT                   /gene="Kcnip1"
FT                   /locus_tag="mCG_141873"
FT                   /product="Kv channel-interacting protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG141873.0 transcript_id=mCT177218.0
FT                   protein_id=mCP100142.0 isoform=CRA_a"
FT                   /protein_id="EDL23734.1"
FT                   /translation="MGAVMGTFSSLQTKQRRPSKEQHSGQIVKQAEWAGEWGSRPRTTC
FT                   SATQPKPKALVPHTL"
FT   gene            6825096..6832828
FT                   /gene="Kcnmb1"
FT                   /locus_tag="mCG_6672"
FT                   /note="gene_id=mCG6672.1"
FT   mRNA            join(6825096..6825409,6826760..6826917,6828269..6828440,
FT                   6832174..6832828)
FT                   /gene="Kcnmb1"
FT                   /locus_tag="mCG_6672"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 1"
FT                   /note="gene_id=mCG6672.1 transcript_id=mCT6165.1 created on
FT                   14-MAY-2002"
FT   CDS             join(6826784..6826917,6828269..6828440,6832174..6832443)
FT                   /codon_start=1
FT                   /gene="Kcnmb1"
FT                   /locus_tag="mCG_6672"
FT                   /product="potassium large conductance calcium-activated
FT                   channel, subfamily M, beta member 1"
FT                   /note="gene_id=mCG6672.1 transcript_id=mCT6165.1
FT                   protein_id=mCP2979.1"
FT                   /db_xref="GOA:Q5SQK1"
FT                   /db_xref="InterPro:IPR003930"
FT                   /db_xref="MGI:MGI:1334203"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQK1"
FT                   /protein_id="EDL23733.1"
FT                   /translation="MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKS
FT                   VWTQESICHLIETNIKDQEELEGKKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCS
FT                   YIPRNLDNYQTALADVKKVRANFYKHHEFYCLSAPQVNETSVVYQRLYGPQVLLFSFFW
FT                   PTFLLTGGLILIAMVKLNRSLSILAAQK"
FT   gene            complement(6836040..>6960872)
FT                   /locus_tag="mCG_146238"
FT                   /note="gene_id=mCG146238.0"
FT   mRNA            complement(join(6836040..6836357,6930397..6930555,
FT                   6953871..6953958,6959069..6959162,6960832..>6960872))
FT                   /locus_tag="mCG_146238"
FT                   /product="mCG146238"
FT                   /note="gene_id=mCG146238.0 transcript_id=mCT186341.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(6836153..>6836341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146238"
FT                   /product="mCG146238"
FT                   /note="gene_id=mCG146238.0 transcript_id=mCT186341.0
FT                   protein_id=mCP107600.0"
FT                   /protein_id="EDL23728.1"
FT                   /translation="WCTLYQYRGKELGTQEDPLVMHLSDMKMIREMILVGKEIIYALTL
FT                   LRHRGNAEKQNLLSMLQ"
FT   gene            6909481..6953445
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /note="gene_id=mCG6674.2"
FT   mRNA            join(6909481..6909757,6913223..6913285,6916632..6916678,
FT                   6930740..6930805,6931264..6931295,6932194..6932231,
FT                   6933296..6933494,6935808..6935937,6937404..6937429,
FT                   6937527..6937647,6940819..6940926,6944637..6944834,
FT                   6945752..6945780,6949519..6949613,6950341..6950418,
FT                   6951836..6951991,6952876..6953430)
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /product="lymphocyte cytosolic protein 2, transcript
FT                   variant mCT168920"
FT                   /note="gene_id=mCG6674.2 transcript_id=mCT168920.0 created
FT                   on 14-MAY-2002"
FT   mRNA            join(6909486..6909757,6913223..6913285,6916632..6916678,
FT                   6930740..6930805,6931264..6931295,6932194..6932231,
FT                   6933296..6933494,6935808..6935905,6937363..6937429,
FT                   6937527..6937610,6940555..6940580,6940696..6940715,
FT                   6940819..6940926,6942501..6942544,6944705..6944834,
FT                   6945731..6945780,6949519..6949613,6950341..6950418,
FT                   6951836..6951991,6952876..6953445)
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /product="lymphocyte cytosolic protein 2, transcript
FT                   variant mCT6158"
FT                   /note="gene_id=mCG6674.2 transcript_id=mCT6158.1 created on
FT                   14-MAY-2002"
FT   mRNA            join(6909486..6909757,6913223..6913285,6916632..6916678,
FT                   6930740..6930805,6931264..6931295,6932194..6932231,
FT                   6933296..6933494,6935808..6935905,6937363..6937429,
FT                   6937527..6937610,6940555..6940580,6940696..6940715,
FT                   6940819..6940926,6942501..6942531,6944031..6944043,
FT                   6944705..6944834,6945731..6945780,6949519..6949613,
FT                   6950341..6950418,6951836..6951991,6952876..6953430)
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /product="lymphocyte cytosolic protein 2, transcript
FT                   variant mCT168921"
FT                   /note="gene_id=mCG6674.2 transcript_id=mCT168921.0 created
FT                   on 14-MAY-2002"
FT   mRNA            join(<6909492..6909757,6913223..6913285,6916632..6916678,
FT                   6930740..6930805,6931264..6931295,6932194..6932231,
FT                   6933296..6933494,6935808..6935905,6937363..6937429,
FT                   6937527..6937610,6940555..6940580,6940696..6940715,
FT                   6940819..6940926,6942501..6942544,6944705..6944834,
FT                   6945731..6945780,6949519..6949613,6950341..6950418,
FT                   6951836..6952535)
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /product="lymphocyte cytosolic protein 2, transcript
FT                   variant mCT191882"
FT                   /note="gene_id=mCG6674.2 transcript_id=mCT191882.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<6909659..6909757,6913223..6913285,6916632..6916678,
FT                   6930740..6930805,6931264..6931295,6932194..6932231,
FT                   6933296..6933494,6935808..6935905,6937363..6937429,
FT                   6937527..6937610,6940555..6940580,6940696..6940715,
FT                   6940819..6940926,6942501..6942544,6944705..6944834,
FT                   6945731..6945780,6949519..6949613,6950341..6950418,
FT                   6951836..6952084)
FT                   /codon_start=1
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /product="lymphocyte cytosolic protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG6674.2 transcript_id=mCT191882.0
FT                   protein_id=mCP112841.0 isoform=CRA_c"
FT                   /protein_id="EDL23731.1"
FT                   /translation="ASPCRAAMALKNVPFRSEVLAWNSDNLADYFRKLNYRDCEKAVKK
FT                   YHIDGARFLNLTENDIQKFPKLRMPLLSKLSQDINKNEERRSIFTRKPQIPRFLEETES
FT                   HEEDDGGWSSFEDDYESPNDDDPDGEDDGDYESPNEEEQALVDDAADYEPPPSNNEEAL
FT                   QSSILPPNSFHNTNSMYIDRPPTGKVSQQPPVPPLRPKPALPPLPTGRNHSPLSPPHPN
FT                   HEEPSRSGNNKTAKLPAPSIDRSTKPPLDRSLAPLDREPFILGKKPPFSDKPSAPLGRE
FT                   HLPKIQKPPLPPAMDRHERNERLGPVTTRKPPVPRHGRGPDRRENVSVKLHQRPLPQPS
FT                   LPSMSSNTFPSRSVQPSSKNTFPLAHMPGAFSESNIGFQQSASLPPYFSQGPGNRPPLR
FT                   SEGRNLPLPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALRKINQDGTFLVRDSS
FT                   KKTANNPYVLMVLYKDKVYNIQIRYQEESQVYLLGTGLRGKEVRTLVFTLCPDPILYSN
FT                   YAVESHAVWQLCC"
FT   CDS             join(6909680..6909757,6913223..6913285,6916632..6916678,
FT                   6930740..6930805,6931264..6931295,6932194..6932231,
FT                   6933296..6933494,6935808..6935937,6937404..6937429,
FT                   6937527..6937647,6940819..6940926,6944637..6944834,
FT                   6945752..6945780,6949519..6949613,6950341..6950418,
FT                   6951836..6951991,6952876..6952998)
FT                   /codon_start=1
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /product="lymphocyte cytosolic protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG6674.2 transcript_id=mCT168920.0
FT                   protein_id=mCP91754.0 isoform=CRA_a"
FT                   /protein_id="EDL23729.1"
FT                   /translation="MALKNVPFRSEVLAWNSDNLADYFRKLNYRDCEKAVKKYHIDGAR
FT                   FLNLTENDIQKFPKLRMPLLSKLSQDINKNEERRSIFTRKPQIPRFLEETESHEEDDGG
FT                   WSSFEDDYESPNDDDPDGEDDGDYESPNEEEQALVDDAADYEPPPSNNEEALQSSILPP
FT                   NSFHNTNSMYIDRPPTGKVSQQPPVPPLRPKPALPPLPTGRNHSVSLLPFFQAALSGNN
FT                   KTAKLPAPSIDRSTKPPLDRSLAPLDREPFILGWYYSYFMHNNNGEHLPKIQKPPLPPA
FT                   MDRHERNERLGPVTTRKPPVPSWGGTLNVPGFEVRLLVFFFSSTVHQRPLPQPSLPSMS
FT                   SNTFPSRSVQPSSKNTFPLAHMPGAFSESASLPPYFSQGPGNRPPLRSEGRNLPLPVPN
FT                   RPQPPSPGEEETPLDEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTANNPYVLMV
FT                   LYKDKVYNIQIRYQEESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRY
FT                   QCTLTHAAGCL"
FT   CDS             join(6909680..6909757,6913223..6913285,6916632..6916678,
FT                   6930740..6930805,6931264..6931295,6932194..6932231,
FT                   6933296..6933494,6935808..6935905,6937363..6937429,
FT                   6937527..6937610,6940555..6940580,6940696..6940715,
FT                   6940819..6940926,6942501..6942544,6944705..6944834,
FT                   6945731..6945780,6949519..6949613,6950341..6950418,
FT                   6951836..6951991,6952876..6952998)
FT                   /codon_start=1
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /product="lymphocyte cytosolic protein 2, isoform CRA_d"
FT                   /note="gene_id=mCG6674.2 transcript_id=mCT6158.1
FT                   protein_id=mCP2977.2 isoform=CRA_d"
FT                   /protein_id="EDL23732.1"
FT                   /translation="MALKNVPFRSEVLAWNSDNLADYFRKLNYRDCEKAVKKYHIDGAR
FT                   FLNLTENDIQKFPKLRMPLLSKLSQDINKNEERRSIFTRKPQIPRFLEETESHEEDDGG
FT                   WSSFEDDYESPNDDDPDGEDDGDYESPNEEEQALVDDAADYEPPPSNNEEALQSSILPP
FT                   NSFHNTNSMYIDRPPTGKVSQQPPVPPLRPKPALPPLPTGRNHSPLSPPHPNHEEPSRS
FT                   GNNKTAKLPAPSIDRSTKPPLDRSLAPLDREPFILGKKPPFSDKPSAPLGREHLPKIQK
FT                   PPLPPAMDRHERNERLGPVTTRKPPVPRHGRGPDRRENVSVKLHQRPLPQPSLPSMSSN
FT                   TFPSRSVQPSSKNTFPLAHMPGAFSESNIGFQQSASLPPYFSQGPGNRPPLRSEGRNLP
FT                   LPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTANNP
FT                   YVLMVLYKDKVYNIQIRYQEESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKN
FT                   RGSRYQCTLTHAAGCL"
FT   CDS             join(6909680..6909757,6913223..6913285,6916632..6916678,
FT                   6930740..6930805,6931264..6931295,6932194..6932231,
FT                   6933296..6933494,6935808..6935905,6937363..6937429,
FT                   6937527..6937610,6940555..6940580,6940696..6940715,
FT                   6940819..6940926,6942501..6942531,6944031..6944043,
FT                   6944705..6944834,6945731..6945780,6949519..6949613,
FT                   6950341..6950418,6951836..6951991,6952876..6952998)
FT                   /codon_start=1
FT                   /gene="Lcp2"
FT                   /locus_tag="mCG_6674"
FT                   /product="lymphocyte cytosolic protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG6674.2 transcript_id=mCT168921.0
FT                   protein_id=mCP91750.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q60787"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="MGI:MGI:1321402"
FT                   /db_xref="PDB:1OEB"
FT                   /db_xref="PDB:2ETZ"
FT                   /db_xref="PDB:2EU0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60787"
FT                   /protein_id="EDL23730.1"
FT                   /translation="MALKNVPFRSEVLAWNSDNLADYFRKLNYRDCEKAVKKYHIDGAR
FT                   FLNLTENDIQKFPKLRMPLLSKLSQDINKNEERRSIFTRKPQIPRFLEETESHEEDDGG
FT                   WSSFEDDYESPNDDDPDGEDDGDYESPNEEEQALVDDAADYEPPPSNNEEALQSSILPP
FT                   NSFHNTNSMYIDRPPTGKVSQQPPVPPLRPKPALPPLPTGRNHSPLSPPHPNHEEPSRS
FT                   GNNKTAKLPAPSIDRSTKPPLDRSLAPLDREPFILGKKPPFSDKPSAPLGREHLPKIQK
FT                   PPLPPAMDRHERNERLGPVTTRKPPVPRHGRGPDRRENDEDDVHQRPLPQPSLPSMSSN
FT                   TFPSRSVQPSSKNTFPLAHMPGAFSESNIGFQQSASLPPYFSQGPGNRPPLRSEGRNLP
FT                   LPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTANNP
FT                   YVLMVLYKDKVYNIQIRYQEESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKN
FT                   RGSRYQCTLTHAAGCL"
FT   gene            complement(7066775..7070537)
FT                   /gene="Foxi1"
FT                   /locus_tag="mCG_6673"
FT                   /note="gene_id=mCG6673.3"
FT   mRNA            complement(join(7066775..7068439,7069913..7070537))
FT                   /gene="Foxi1"
FT                   /locus_tag="mCG_6673"
FT                   /product="forkhead box I1, transcript variant mCT168919"
FT                   /note="gene_id=mCG6673.3 transcript_id=mCT168919.1 created
FT                   on 18-JUN-2003"
FT   mRNA            complement(join(7066775..7068506,7069913..7070537))
FT                   /gene="Foxi1"
FT                   /locus_tag="mCG_6673"
FT                   /product="forkhead box I1, transcript variant mCT6157"
FT                   /note="gene_id=mCG6673.3 transcript_id=mCT6157.2 created on
FT                   18-JUN-2003"
FT   CDS             complement(join(7067944..7068506,7069913..7070387))
FT                   /codon_start=1
FT                   /gene="Foxi1"
FT                   /locus_tag="mCG_6673"
FT                   /product="forkhead box I1, isoform CRA_b"
FT                   /note="gene_id=mCG6673.3 transcript_id=mCT6157.2
FT                   protein_id=mCP2976.1 isoform=CRA_b"
FT                   /protein_id="EDL23727.1"
FT                   /translation="MNLYYENFFHPQGMPSPQRPTSFEGGGEYGTTPNPYLWLNGPAMT
FT                   PPPYLPGTNASPFLPQAYGMQRQLLPSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIH
FT                   GAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNY
FT                   WTLDPNCEKMFDNGNFRRKRKRKSDSSSSTSSLASEKTENGLLASSPKPTEPQEVLDTA
FT                   SPDTTTSSPEKRSSPAPSGTPCLNNFLSTMTAYVSGTNPISRSVATPGLSSEPIDKMGQ
FT                   NSLNFNSYTPLTNLSSHGNGGEWANPVATNALGYGGSVFNQFSPHFYNSINTNGILFPR
FT                   EGTEV"
FT   CDS             complement(join(7068324..7068439,7069913..7070387))
FT                   /codon_start=1
FT                   /gene="Foxi1"
FT                   /locus_tag="mCG_6673"
FT                   /product="forkhead box I1, isoform CRA_a"
FT                   /note="gene_id=mCG6673.3 transcript_id=mCT168919.1
FT                   protein_id=mCP91751.1 isoform=CRA_a"
FT                   /protein_id="EDL23726.1"
FT                   /translation="MNLYYENFFHPQGMPSPQRPTSFEGGGEYGTTPNPYLWLNGPAMT
FT                   PPPYLPGTNASPFLPQAYGMQRQLLPSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIH
FT                   GAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGRERE
FT                   NQIHPPAPAHWLQRKRRTVSWPAAPSPQSLRRS"
FT   gene            complement(7089733..>7377676)
FT                   /locus_tag="mCG_6670"
FT                   /note="gene_id=mCG6670.2"
FT   mRNA            complement(join(7089733..7090262,7091134..7091276,
FT                   7092006..7092126,7093188..7093356,7094103..7094230,
FT                   7095301..7095438,7100683..7100766,7102062..7102238,
FT                   7110306..7110392,7111105..7111189,7112288..7112369,
FT                   7116862..7117003,7119058..7119162,7120615..7120704,
FT                   7123968..7124087,7124922..7125012,7128773..7128813,
FT                   7130480..7130636,7136138..7136223,7145090..7145238,
FT                   7156584..7156642,7156733..7156833,7162961..7163039,
FT                   7172826..7172920,7174935..7175033,7301110..7301205,
FT                   7327909..7328054,7364219..7364325,7366393..7366463,
FT                   7377568..>7377676))
FT                   /locus_tag="mCG_6670"
FT                   /product="mCG6670, transcript variant mCT6163"
FT                   /note="gene_id=mCG6670.2 transcript_id=mCT6163.1 created on
FT                   09-DEC-2002"
FT   CDS             complement(join(7090200..7090262,7091134..7091276,
FT                   7092006..7092126,7093188..7093356,7094103..7094230,
FT                   7095301..7095438,7100683..7100766,7102062..7102238,
FT                   7110306..7110392,7111105..7111189,7112288..7112369,
FT                   7116862..7117003,7119058..7119162,7120615..7120704,
FT                   7123968..7124087,7124922..7125012,7128773..7128813,
FT                   7130480..7130636,7136138..7136223,7145090..7145238,
FT                   7156584..7156642,7156733..7156833,7162961..7163039,
FT                   7172826..7172920,7174935..7175033,7301110..7301205,
FT                   7327909..7328054,7364219..7364325,7366393..7366463,
FT                   7377568..>7377675))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6670"
FT                   /product="mCG6670, isoform CRA_b"
FT                   /note="gene_id=mCG6670.2 transcript_id=mCT6163.1
FT                   protein_id=mCP2972.1 isoform=CRA_b"
FT                   /protein_id="EDL23723.1"
FT                   /translation="LYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQVAALKYIPS
FT                   VLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQECRDILLPV
FT                   ITKELKELLEQRDDGQHQAEKKHCVELLNSILEVLSCQDAAFTYDHIQEIMVQLLRTVN
FT                   RTVITMGRDHALISHFVACMTAILDQMGDQHYSFYIETFQTSSDLVDFLMETFIMFKDL
FT                   IGKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTSFEFQLWNNYFHLAVAFIT
FT                   QDSLQLEQFTHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTL
FT                   IPEAELRKATIPIFFDMMLCEYQRTGAFKKFENEIILKLDHEVEGGRGDEQYMQLLESI
FT                   LMECTVEHPTIAKSVENFVSLVKGLLEKLLDYRGVMTDESKDNRMSCTVNLLNFYKDNN
FT                   REEMYIRYLYKLRDLHLDCENYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHR
FT                   QLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLTQQAKFYENIM
FT                   KILRTKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLLSQFPNAEKMNTTS
FT                   APGDDVRNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQKFHYSRPVRRG
FT                   KVDPENEFASMWIERTSFLTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTVNEKIL
FT                   MMINQYQSDESLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYSREHPEDQDKLSHL
FT                   KDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREMPDFEDR
FT                   RVGRPRSMLRSYRQMSVISLASMHSDCSTPSKVPAESFDLESAPPKTPKVEEEPISPGS
FT                   TLPEVKLRRSKKRTKRSSVVFADEKAATESDLKRLSRKQEFMSDTNLSEHAAIPARVSI
FT                   LSQMSFASQSMPTIPALTLSVAGVPGLDEANTSPRLSQTFFQVSDGDKKTLKKKKVNQF
FT                   FKTMLASKSSEESKQIPDFLSTNM"
FT   mRNA            complement(join(7135514..7135765,7136138..7136223,
FT                   7145090..7145238,7156584..7156642,7156733..7156833,
FT                   7162961..7163039,7172826..7172920,7174935..7175033,
FT                   7301110..7301205,7327909..7328054,7364219..7364325,
FT                   7366393..7366463,7377568..>7377676))
FT                   /locus_tag="mCG_6670"
FT                   /product="mCG6670, transcript variant mCT6160"
FT                   /note="gene_id=mCG6670.2 transcript_id=mCT6160.2 created on
FT                   09-DEC-2002"
FT   CDS             complement(join(7135702..7135765,7136138..7136223,
FT                   7145090..7145238,7156584..7156642,7156733..7156833,
FT                   7162961..7163039,7172826..7172920,7174935..7175033,
FT                   7301110..7301205,7327909..7328054,7364219..7364325,
FT                   7366393..7366463,7377568..>7377675))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6670"
FT                   /product="mCG6670, isoform CRA_a"
FT                   /note="gene_id=mCG6670.2 transcript_id=mCT6160.2
FT                   protein_id=mCP2975.2 isoform=CRA_a"
FT                   /protein_id="EDL23722.1"
FT                   /translation="LYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQVAALKYIPS
FT                   VLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQECRDILLPV
FT                   ITKELKELLEQRDDGQHQAEKKHCVELLNSILEVLSCQDAAFTYDHIQEIMVQLLRTVN
FT                   RTVITMGRDHALISHFVACMTAILDQMGDQHYSFYIETFQTSSDLVDFLMETFIMFKDL
FT                   IGKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTSFEFQLWNNYFHLAVAFIT
FT                   QDSLQLEQFTHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTL
FT                   IPEAELRKATIPIFFDMMLCEYQRTGAFKKFENEIILKLDHEVEGGRGDEQYMQLLESM
FT                   FTVLGHVSLGGLLSSGRQAH"
FT   gene            7162223..7170590
FT                   /locus_tag="mCG_147812"
FT                   /note="gene_id=mCG147812.0"
FT   mRNA            join(7162223..7162355,7170130..7170590)
FT                   /locus_tag="mCG_147812"
FT                   /product="mCG147812"
FT                   /note="gene_id=mCG147812.0 transcript_id=mCT188075.0
FT                   created on 13-JAN-2004"
FT   CDS             join(7162294..7162355,7170130..7170208)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147812"
FT                   /product="mCG147812"
FT                   /note="gene_id=mCG147812.0 transcript_id=mCT188075.0
FT                   protein_id=mCP108531.0"
FT                   /protein_id="EDL23725.1"
FT                   /translation="METQRLRWAGRNGMTLGYCTWVFYHSNSNGTRTSNISRAIPPRPD
FT                   Q"
FT   gene            7177294..7285461
FT                   /locus_tag="mCG_1051034"
FT                   /note="gene_id=mCG1051034.0"
FT   mRNA            join(7177294..7177417,7263757..7263839,7264181..7266006,
FT                   7266979..7267053,7282543..7285461)
FT                   /locus_tag="mCG_1051034"
FT                   /product="mCG1051034"
FT                   /note="gene_id=mCG1051034.0 transcript_id=mCT194823.0
FT                   created on 27-JAN-2005"
FT   CDS             join(7264661..7266006,7266979..7267053,7282543..7282729)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051034"
FT                   /product="mCG1051034"
FT                   /note="gene_id=mCG1051034.0 transcript_id=mCT194823.0
FT                   protein_id=mCP115852.0"
FT                   /protein_id="EDL23724.1"
FT                   /translation="MAQQSMKVRPVLLKRSSLESVELVKQPHHRRSKSQQVRFKEDGNI
FT                   KNPTGVTEVNTQTPEDPGVMGKAQASRHHHPTTYSLSFPRSHKAGGFRSISIQTSPSLR
FT                   KHFPVFKRKKLTTSKSLVEMPTASPSAIQVNGNLSEQDIVSSDLAFLRLAQHLEDGPRR
FT                   LKIPHPFLPRMPKVQSNGPVSFCLESGTWMSSEKATAAIQVPDDICHSPTWEARESALS
FT                   PESSAEESNSIPALISMCPGDGQRVMTSELERMPPCSNTNSSASNMPGTEKLTPELLLP
FT                   KDNPDDKDLGLPSSQSKKMCVPSPPRTHSSPEPGSRSQPVHLGRSSDCPASGDNHQDLE
FT                   SLRSSSASKSVPVCWEHVTKLPSQSDTPELQTGVGSEQLPASIPRQENRAQSSREIGGS
FT                   NHSHLAQGELCDLQGRLQSVEESLHSNQEKIKVLLNVIQDLEKAHALTEGRNFYRTGQD
FT                   LNNCSTCQNTACIIYSVEYDFRQQEGRFHEVLQSLEEAEPTEEAPSPPKSPAEAPVPEK
FT                   QDLRRKSKKVKKKCFWWI"
FT   assembly_gap    1155..1174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5909..6086
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    7341..7556
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    16047..17308
FT                   /estimated_length=1262
FT                   /gap_type="unknown"
FT   assembly_gap    21655..21674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24151..24755
FT                   /estimated_length=605
FT                   /gap_type="unknown"
FT   assembly_gap    25735..25754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    26682..30545
FT                   /estimated_length=3864
FT                   /gap_type="unknown"
FT   assembly_gap    37375..38676
FT                   /estimated_length=1302
FT                   /gap_type="unknown"
FT   assembly_gap    40514..40533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    66294..66313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    72226..72473
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    74015..76451
FT                   /estimated_length=2437
FT                   /gap_type="unknown"
FT   assembly_gap    77933..80049
FT                   /estimated_length=2117
FT                   /gap_type="unknown"
FT   assembly_gap    82029..83736
FT                   /estimated_length=1708
FT                   /gap_type="unknown"
FT   assembly_gap    97295..99363
FT                   /estimated_length=2069
FT                   /gap_type="unknown"
FT   assembly_gap    106595..108558
FT                   /estimated_length=1964
FT                   /gap_type="unknown"
FT   assembly_gap    111382..111401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    118412..118680
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    137208..137227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    139167..139186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    157158..157483
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    161048..161474
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    163726..163745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    166429..166448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    175930..175949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    178034..178053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    180351..180370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    181474..181719
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    183505..183524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    184564..186667
FT                   /estimated_length=2104
FT                   /gap_type="unknown"
FT   assembly_gap    197892..198095
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    207156..207175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    219129..219177
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    245849..245868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    247934..247953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    249864..249883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    256641..256660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    258664..258683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    270019..270038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    272986..273005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    274279..274298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    275335..275757
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    277341..277360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    278508..286169
FT                   /estimated_length=7662
FT                   /gap_type="unknown"
FT   assembly_gap    290495..290685
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    303330..303349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    305133..305152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    316801..316820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    323062..324847
FT                   /estimated_length=1786
FT                   /gap_type="unknown"
FT   assembly_gap    326614..331689
FT                   /estimated_length=5076
FT                   /gap_type="unknown"
FT   assembly_gap    352176..355061
FT                   /estimated_length=2886
FT                   /gap_type="unknown"
FT   assembly_gap    365967..365986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    374771..377144
FT                   /estimated_length=2374
FT                   /gap_type="unknown"
FT   assembly_gap    381396..381415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    383772..383791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    385125..385144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    390322..390341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    391353..391372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    392387..392406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    393694..393713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    400323..403042
FT                   /estimated_length=2720
FT                   /gap_type="unknown"
FT   assembly_gap    409754..414175
FT                   /estimated_length=4422
FT                   /gap_type="unknown"
FT   assembly_gap    430571..430590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    432509..432528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    447661..447680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    448787..456708
FT                   /estimated_length=7922
FT                   /gap_type="unknown"
FT   assembly_gap    470589..471209
FT                   /estimated_length=621
FT                   /gap_type="unknown"
FT   assembly_gap    477726..479400
FT                   /estimated_length=1675
FT                   /gap_type="unknown"
FT   assembly_gap    480603..480622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    489698..489717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    495341..495360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    513445..513978
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   assembly_gap    514345..515002
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    519078..519106
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    525111..525169
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    591751..592220
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    594145..594164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    612209..612228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    613268..613287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    614581..614600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    629919..629938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    632133..632171
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    636352..636371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    641473..641492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    668843..668862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    672848..673666
FT                   /estimated_length=819
FT                   /gap_type="unknown"
FT   assembly_gap    676088..676107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    680776..680795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    689116..689135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    690888..690907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    692100..692119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    704997..705016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    706821..706840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    711039..711058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    712397..712416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    713976..714389
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    716291..716310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    731332..731351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    767126..767540
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    770945..773696
FT                   /estimated_length=2752
FT                   /gap_type="unknown"
FT   assembly_gap    776741..784371
FT                   /estimated_length=7631
FT                   /gap_type="unknown"
FT   assembly_gap    787445..787464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    791720..792212
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    793456..793604
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    813576..813595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    821401..821449
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    824537..824556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    841494..842168
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   assembly_gap    851170..851320
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    852470..852969
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    861383..861402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    863341..863360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    866396..867103
FT                   /estimated_length=708
FT                   /gap_type="unknown"
FT   assembly_gap    868585..868604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    869969..869988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    874643..874662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    875882..875901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    885419..886934
FT                   /estimated_length=1516
FT                   /gap_type="unknown"
FT   assembly_gap    888718..888737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    889763..889782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    891033..892638
FT                   /estimated_length=1606
FT                   /gap_type="unknown"
FT   assembly_gap    894242..895355
FT                   /estimated_length=1114
FT                   /gap_type="unknown"
FT   assembly_gap    896604..897101
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   assembly_gap    899898..899917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    903112..903131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    904650..904699
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    907113..907132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    908825..910867
FT                   /estimated_length=2043
FT                   /gap_type="unknown"
FT   assembly_gap    912815..912834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    913841..914139
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    915605..915804
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    925563..926391
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   assembly_gap    933385..933404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    937122..937141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    938751..938770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    944305..944324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    945956..945975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    947038..947057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    959537..959802
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    960806..960825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    961904..962033
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    963209..963228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    964304..964323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    967914..968241
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    972710..972729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    976054..976073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    980076..980095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    986664..986886
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    1013797..1020710
FT                   /estimated_length=6914
FT                   /gap_type="unknown"
FT   assembly_gap    1034903..1034922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1036046..1036065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1037523..1042831
FT                   /estimated_length=5309
FT                   /gap_type="unknown"
FT   assembly_gap    1047380..1047990
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    1052694..1052713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1055873..1055919
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    1064124..1064143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1065176..1065195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1066726..1067140
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    1074345..1074364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1081218..1081390
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    1083518..1083653
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    1085165..1085184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1086285..1086619
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    1088195..1089235
FT                   /estimated_length=1041
FT                   /gap_type="unknown"
FT   assembly_gap    1089867..1090046
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    1091808..1092452
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    1094494..1094760
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    1107878..1107897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1113085..1113311
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    1125234..1125253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1128329..1128422
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    1132279..1132517
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    1133836..1134143
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    1138845..1139415
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    1141298..1141456
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    1148732..1149713
FT                   /estimated_length=982
FT                   /gap_type="unknown"
FT   assembly_gap    1159906..1159943
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    1165866..1166353
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    1184976..1184995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1221880..1221899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1226373..1226392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1228528..1228547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1229941..1229960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1240597..1241985
FT                   /estimated_length=1389
FT                   /gap_type="unknown"
FT   assembly_gap    1243597..1243616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1246445..1246464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1247625..1248955
FT                   /estimated_length=1331
FT                   /gap_type="unknown"
FT   assembly_gap    1257489..1257508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1275273..1275682
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    1284574..1285131
FT                   /estimated_length=558
FT                   /gap_type="unknown"
FT   assembly_gap    1287856..1288573
FT                   /estimated_length=718
FT                   /gap_type="unknown"
FT   assembly_gap    1295017..1295036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1296289..1298050
FT                   /estimated_length=1762
FT                   /gap_type="unknown"
FT   assembly_gap    1300273..1300292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1302076..1302095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1303964..1303983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1314847..1315196
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    1317833..1317852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1323898..1323917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1342747..1342991
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    1414142..1414161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1415167..1417457
FT                   /estimated_length=2291
FT                   /gap_type="unknown"
FT   assembly_gap    1419124..1423246
FT                   /estimated_length=4123
FT                   /gap_type="unknown"
FT   assembly_gap    1424470..1424489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1425717..1425736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1427424..1427443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1429811..1429830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1432069..1437453
FT                   /estimated_length=5385
FT                   /gap_type="unknown"
FT   assembly_gap    1444334..1444353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1455857..1455876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1487591..1487839
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    1492298..1492453
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    1498806..1498825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1500210..1504634
FT                   /estimated_length=4425
FT                   /gap_type="unknown"
FT   assembly_gap    1511137..1511156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1585341..1585360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1620558..1620577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1643842..1643861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662415..1662434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1672432..1672451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1674287..1674306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1675333..1675352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1681476..1681495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1688770..1688789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1689800..1689819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1691556..1698601
FT                   /estimated_length=7046
FT                   /gap_type="unknown"
FT   assembly_gap    1699908..1700017
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    1749856..1749875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1751678..1751697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1752805..1752824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1755769..1755788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1756874..1756893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1766230..1766249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1799863..1799882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1802130..1815102
FT                   /estimated_length=12973
FT                   /gap_type="unknown"
FT   assembly_gap    1817646..1817665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1823549..1823982
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    1828117..1828136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1832531..1834848
FT                   /estimated_length=2318
FT                   /gap_type="unknown"
FT   assembly_gap    1847719..1847738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1850397..1850416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1851615..1851634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1854095..1854114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1864015..1864034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1886919..1886938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1897475..1897494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1902889..1904572
FT                   /estimated_length=1684
FT                   /gap_type="unknown"
FT   assembly_gap    1922765..1923012
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    1924578..1924715
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    1926145..1926164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1929443..1929563
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    1930697..1930716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1939610..1939629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1941909..1941928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1943637..1943656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1944904..1944923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1951527..1951546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1963187..1963206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1974303..1974322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1978088..1978107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1980119..1981143
FT                   /estimated_length=1025
FT                   /gap_type="unknown"
FT   assembly_gap    1994236..1994255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1996107..1996126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2002539..2002558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2016966..2016985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2053514..2053533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2056283..2056340
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    2059161..2059276
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    2066671..2066690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2082394..2082413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2106464..2106483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2108628..2108647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2119441..2119460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2127169..2127188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2141238..2144253
FT                   /estimated_length=3016
FT                   /gap_type="unknown"
FT   assembly_gap    2145625..2145644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2181206..2182589
FT                   /estimated_length=1384
FT                   /gap_type="unknown"
FT   assembly_gap    2183706..2183725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2187850..2188072
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    2225969..2226108
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    2249613..2249632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2253072..2253091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2264018..2264076
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    2380836..2381081
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    2409635..2409654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2416141..2416984
FT                   /estimated_length=844
FT                   /gap_type="unknown"
FT   assembly_gap    2430456..2430475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2440818..2440837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2449823..2450661
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    2465620..2466362
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    2467619..2467638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2468674..2468693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2469869..2469944
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    2471177..2471196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2480164..2480939
FT                   /estimated_length=776
FT                   /gap_type="unknown"
FT   assembly_gap    2484889..2484908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2486095..2486114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2488010..2488029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2530157..2530810
FT                   /estimated_length=654
FT                   /gap_type="unknown"
FT   assembly_gap    2535117..2538275
FT                   /estimated_length=3159
FT                   /gap_type="unknown"
FT   assembly_gap    2539376..2539395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2540445..2540464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2565169..2565188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2575779..2575798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2577073..2577092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2578532..2578551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2584279..2584298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2593188..2593247
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    2603885..2604070
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    2605618..2605637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2606887..2606906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2611864..2611883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2613324..2613343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2652039..2652058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2671354..2675924
FT                   /estimated_length=4571
FT                   /gap_type="unknown"
FT   assembly_gap    2681941..2682103
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    2683242..2683261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2762107..2762126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2787499..2790532
FT                   /estimated_length=3034
FT                   /gap_type="unknown"
FT   assembly_gap    2815049..2816680
FT                   /estimated_length=1632
FT                   /gap_type="unknown"
FT   assembly_gap    2821505..2821554
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    2869821..2869840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2886744..2890553
FT                   /estimated_length=3810
FT                   /gap_type="unknown"
FT   assembly_gap    2898472..2899009
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    2901741..2902035
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    2976682..2976701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2977952..2977971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2982544..2982563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2986593..2986612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3045569..3045588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3052784..3052803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3055098..3055117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3056186..3056205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3057270..3057289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3061968..3061987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3063197..3063216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3091799..3091847
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3095949..3095968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3097873..3099203
FT                   /estimated_length=1331
FT                   /gap_type="unknown"
FT   assembly_gap    3112119..3112293
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    3125456..3125475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3128674..3129310
FT                   /estimated_length=637
FT                   /gap_type="unknown"
FT   assembly_gap    3131041..3131060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3135696..3135715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3138055..3138074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3141602..3141621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3161390..3161409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3176873..3176892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3179852..3179871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3182066..3183132
FT                   /estimated_length=1067
FT                   /gap_type="unknown"
FT   assembly_gap    3184269..3184288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3186883..3186902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3187936..3188649
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    3204007..3204026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3214263..3225065
FT                   /estimated_length=10803
FT                   /gap_type="unknown"
FT   assembly_gap    3242735..3242754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3249974..3250932
FT                   /estimated_length=959
FT                   /gap_type="unknown"
FT   assembly_gap    3254557..3254576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3304790..3304809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3306852..3306871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3309692..3309711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3319356..3319725
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    3321216..3324208
FT                   /estimated_length=2993
FT                   /gap_type="unknown"
FT   assembly_gap    3337048..3339226
FT                   /estimated_length=2179
FT                   /gap_type="unknown"
FT   assembly_gap    3345133..3352826
FT                   /estimated_length=7694
FT                   /gap_type="unknown"
FT   assembly_gap    3354254..3354650
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    3358163..3358501
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    3366592..3366794
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    3368094..3368535
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    3389963..3389982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3391130..3391149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3399832..3399851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3403312..3403331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3405293..3405312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3406573..3406592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3408623..3408642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3417642..3417661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3419607..3421686
FT                   /estimated_length=2080
FT                   /gap_type="unknown"
FT   assembly_gap    3474090..3474528
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   assembly_gap    3475562..3475581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3476966..3476985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3479538..3479972
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    3489710..3489729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3491077..3491096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3494836..3494855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3497008..3497027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3498404..3498423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3500307..3500326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3501516..3502325
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   assembly_gap    3511315..3511334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3512344..3513457
FT                   /estimated_length=1114
FT                   /gap_type="unknown"
FT   assembly_gap    3515881..3515900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3516966..3516985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3518080..3519751
FT                   /estimated_length=1672
FT                   /gap_type="unknown"
FT   assembly_gap    3521543..3521562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3523960..3526251
FT                   /estimated_length=2292
FT                   /gap_type="unknown"
FT   assembly_gap    3574573..3574603
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    3575787..3576885
FT                   /estimated_length=1099
FT                   /gap_type="unknown"
FT   assembly_gap    3578638..3579358
FT                   /estimated_length=721
FT                   /gap_type="unknown"
FT   assembly_gap    3586080..3586099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3587659..3595423
FT                   /estimated_length=7765
FT                   /gap_type="unknown"
FT   assembly_gap    3596888..3596907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3617803..3617822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3626233..3626593
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    3628530..3628549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3629645..3629664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3638890..3638909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3640042..3640061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3642341..3642360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3643540..3643738
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    3664032..3665900
FT                   /estimated_length=1869
FT                   /gap_type="unknown"
FT   assembly_gap    3691486..3691505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3692810..3692829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3695065..3695084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3702987..3703006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3721136..3721155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3724692..3725212
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    3736584..3736603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3785651..3785670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3810858..3810877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3825581..3825600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3827078..3827097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3828379..3828398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3847013..3847104
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    3886277..3886541
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    3889071..3889090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3949654..3949864
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    3972103..3974684
FT                   /estimated_length=2582
FT                   /gap_type="unknown"
FT   assembly_gap    3975697..3975716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3977276..3977295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3978894..3978913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3980083..3980102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3984963..4006652
FT                   /estimated_length=21690
FT                   /gap_type="unknown"
FT   assembly_gap    4014343..4014362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4017231..4017250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4018523..4019196
FT                   /estimated_length=674
FT                   /gap_type="unknown"
FT   assembly_gap    4020281..4025317
FT                   /estimated_length=5037
FT                   /gap_type="unknown"
FT   assembly_gap    4026406..4026425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4029135..4029154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4048926..4053000
FT                   /estimated_length=4075
FT                   /gap_type="unknown"
FT   assembly_gap    4058906..4058925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4060462..4060481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4061498..4061517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4066776..4069013
FT                   /estimated_length=2238
FT                   /gap_type="unknown"
FT   assembly_gap    4071766..4071797
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4074887..4074906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4077082..4077101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4078648..4081853
FT                   /estimated_length=3206
FT                   /gap_type="unknown"
FT   assembly_gap    4083711..4083730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4111533..4111552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4113055..4113074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4131300..4131319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4149717..4149736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4156686..4156705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4171743..4171762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4172836..4172855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4178721..4178740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4180220..4180239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4181601..4181620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4182849..4182868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4185392..4189733
FT                   /estimated_length=4342
FT                   /gap_type="unknown"
FT   assembly_gap    4203723..4203742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4215317..4216044
FT                   /estimated_length=728
FT                   /gap_type="unknown"
FT   assembly_gap    4243217..4243431
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    4245113..4245132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4278331..4279066
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   assembly_gap    4280580..4280599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4302902..4302921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4304205..4304224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4309149..4309168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4310170..4310189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4311319..4311338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4312406..4312425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4313698..4313717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4315163..4315805
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    4316971..4316990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4318116..4318715
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    4349975..4349994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4355255..4355274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4356498..4359446
FT                   /estimated_length=2949
FT                   /gap_type="unknown"
FT   assembly_gap    4367458..4367477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4375445..4375820
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    4402322..4402341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4404525..4404544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4407328..4407347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4418042..4418061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4420276..4420295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4449456..4449672
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    4452375..4452561
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    4470158..4470177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4471848..4471867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4575090..4576067
FT                   /estimated_length=978
FT                   /gap_type="unknown"
FT   assembly_gap    4642788..4642945
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    4652463..4652482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4666777..4666796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4701771..4701790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4708219..4708339
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    4760852..4760871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4790337..4790437
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    4816944..4817155
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    4818332..4818679
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    4830651..4830729
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    4854683..4854777
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4855358..4855727
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    4861049..4861351
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    4876174..4876361
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    4895360..4895435
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    4923064..4923378
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    4929855..4929874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4935877..4936020
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    4943859..4943895
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    4956485..4956514
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    4959488..4959653
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4975236..4975364
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    4978885..4978904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4986825..4986978
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    4988948..4989074
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    4994896..4994915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5004812..5004831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5006507..5006666
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    5007970..5007989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5024433..5024694
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    5031917..5031936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5033504..5033523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5034643..5034725
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    5048267..5048468
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    5052703..5052722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5059741..5059760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5067149..5067291
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    5072123..5072385
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    5090493..5090619
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    5152306..5152766
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    5161531..5161868
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    5164364..5165319
FT                   /estimated_length=956
FT                   /gap_type="unknown"
FT   assembly_gap    5165815..5166352
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    5209329..5209417
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    5216451..5216622
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    5253682..5253701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5277848..5278768
FT                   /estimated_length=921
FT                   /gap_type="unknown"
FT   assembly_gap    5300255..5300274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5303855..5304019
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    5313290..5313309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5354496..5355174
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   assembly_gap    5363426..5363608
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    5365253..5366468
FT                   /estimated_length=1216
FT                   /gap_type="unknown"
FT   assembly_gap    5367707..5367770
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    5403183..5403468
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    5421678..5421800
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    5430068..5430528
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    5446498..5446706
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    5470922..5471195
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    5473644..5474052
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    5477597..5477867
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    5487917..5488046
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    5505808..5506073
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    5512868..5513282
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    5526868..5527158
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    5531392..5531818
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    5536920..5536939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5555526..5555783
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    5557453..5557472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5576057..5576410
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    5590376..5590395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5621657..5621829
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    5629867..5630008
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    5631151..5631170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5633979..5634038
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    5636007..5636026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5651622..5652530
FT                   /estimated_length=909
FT                   /gap_type="unknown"
FT   assembly_gap    5691177..5691575
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    5695947..5697310
FT                   /estimated_length=1364
FT                   /gap_type="unknown"
FT   assembly_gap    5698379..5698514
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    5714137..5714156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5715446..5715465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5735864..5736777
FT                   /estimated_length=914
FT                   /gap_type="unknown"
FT   assembly_gap    5755407..5755559
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    5775472..5775491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5806911..5806959
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    5809061..5809255
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    5819963..5820337
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    5824642..5824995
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    5825979..5828072
FT                   /estimated_length=2094
FT                   /gap_type="unknown"
FT   assembly_gap    5829187..5829206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5830299..5830436
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    5854689..5854770
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    5887533..5887616
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    5932674..5935056
FT                   /estimated_length=2383
FT                   /gap_type="unknown"
FT   assembly_gap    5937428..5937508
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    5942703..5942722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5944801..5944899
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    5951546..5952017
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    5960556..5961360
FT                   /estimated_length=805
FT                   /gap_type="unknown"
FT   assembly_gap    5970824..5970877
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    5993784..5993803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6009484..6009755
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    6010845..6010864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6023620..6023639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6039515..6039534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6047919..6047938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6057568..6057949
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    6078621..6078640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6135985..6136004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6151054..6151073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6166452..6166471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6187031..6187050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6193822..6193841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6203497..6203516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6211503..6211522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6217158..6217260
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    6282983..6283002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6301162..6301181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6310843..6310862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6330247..6330326
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    6334549..6334668
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    6371712..6371731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6377464..6377504
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    6389421..6389511
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    6396443..6396760
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    6408438..6408499
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    6409124..6410213
FT                   /estimated_length=1090
FT                   /gap_type="unknown"
FT   assembly_gap    6423974..6424209
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    6434045..6434175
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    6445000..6445197
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    6466976..6466995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6505351..6505413
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    6516473..6516492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6551051..6551125
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    6561178..6561197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6568757..6568776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6571368..6572016
FT                   /estimated_length=649
FT                   /gap_type="unknown"
FT   assembly_gap    6589273..6589663
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    6598972..6599159
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    6601232..6601255
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    6644875..6645568
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    6650768..6650929
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    6655060..6655769
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    6676348..6676367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6697422..6697441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6705806..6705976
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    6741953..6742040
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    6742491..6742510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6744677..6744929
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    6746263..6746632
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    6777156..6777175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6786324..6786343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6806373..6806492
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    6846091..6846110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6863376..6863559
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    6869919..6869938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6871589..6871650
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    6876450..6880411
FT                   /estimated_length=3962
FT                   /gap_type="unknown"
FT   assembly_gap    6973270..6973519
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    6989770..6989794
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    7059115..7059354
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    7076546..7076672
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    7132126..7132154
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    7192304..7192351
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    7228349..7228368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7231694..7231713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7277729..7277839
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    7279847..7280078
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    7291068..7291087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7305444..7305509
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    7308826..7308992
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    7315849..7315918
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    7322127..7322326
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    7328222..7328241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7339059..7339078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7375647..7375967
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    7390251..7390270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7393968..7400439
FT                   /estimated_length=6472
FT                   /gap_type="unknown"
XX
CO   join(AAHY01091544.1:1..1154,gap(20),complement(AAHY01091545.1:1..4734),
CO   gap(178),complement(AAHY01091546.1:1..1254),gap(216),
CO   complement(AAHY01091547.1:1..8490),gap(1262),
CO   complement(AAHY01091548.1:1..4346),gap(20),
CO   complement(AAHY01091549.1:1..2476),gap(605),AAHY01091550.1:1..979,gap(20),
CO   AAHY01091551.1:1..927,gap(3864),complement(AAHY01091552.1:1..6829),
CO   gap(1302),AAHY01091553.1:1..1837,gap(20),
CO   complement(AAHY01091554.1:1..25760),gap(20),
CO   complement(AAHY01091555.1:1..5912),gap(248),AAHY01091556.1:1..1541,
CO   gap(2437),complement(AAHY01091557.1:1..1481),gap(2117),
CO   AAHY01091558.1:1..1979,gap(1708),complement(AAHY01091559.1:1..13558),
CO   gap(2069),AAHY01091560.1:1..7231,gap(1964),
CO   complement(AAHY01091561.1:1..2823),gap(20),
CO   complement(AAHY01091562.1:1..7010),gap(269),
CO   complement(AAHY01091563.1:1..18527),gap(20),
CO   complement(AAHY01091564.1:1..1939),gap(20),
CO   complement(AAHY01091565.1:1..17971),gap(326),AAHY01091566.1:1..3564,
CO   gap(427),AAHY01091567.1:1..2251,gap(20),AAHY01091568.1:1..2683,gap(20),
CO   complement(AAHY01091569.1:1..9481),gap(20),
CO   complement(AAHY01091570.1:1..2084),gap(20),AAHY01091571.1:1..2297,gap(20),
CO   AAHY01091572.1:1..1103,gap(246),complement(AAHY01091573.1:1..1785),gap(20),
CO   complement(AAHY01091574.1:1..1039),gap(2104),
CO   complement(AAHY01091575.1:1..11224),gap(204),
CO   complement(AAHY01091576.1:1..9060),gap(20),
CO   complement(AAHY01091577.1:1..11953),gap(49),
CO   complement(AAHY01091578.1:1..26671),gap(20),
CO   complement(AAHY01091579.1:1..2065),gap(20),AAHY01091580.1:1..1910,gap(20),
CO   complement(AAHY01091581.1:1..6757),gap(20),
CO   complement(AAHY01091582.1:1..2003),gap(20),
CO   complement(AAHY01091583.1:1..11335),gap(20),
CO   complement(AAHY01091584.1:1..2947),gap(20),AAHY01091585.1:1..1273,gap(20),
CO   AAHY01091586.1:1..1036,gap(423),AAHY01091587.1:1..1583,gap(20),
CO   AAHY01091588.1:1..1147,gap(7662),complement(AAHY01091589.1:1..4325),
CO   gap(191),complement(AAHY01091590.1:1..12644),gap(20),
CO   complement(AAHY01091591.1:1..1783),gap(20),
CO   complement(AAHY01091592.1:1..11648),gap(20),
CO   complement(AAHY01091593.1:1..6241),gap(1786),
CO   complement(AAHY01091594.1:1..1766),gap(5076),
CO   complement(AAHY01091595.1:1..20486),gap(2886),
CO   complement(AAHY01091596.1:1..10905),gap(20),
CO   complement(AAHY01091597.1:1..8784),gap(2374),
CO   complement(AAHY01091598.1:1..4251),gap(20),AAHY01091599.1:1..2356,gap(20),
CO   complement(AAHY01091600.1:1..1333),gap(20),AAHY01091601.1:1..5177,gap(20),
CO   AAHY01091602.1:1..1011,gap(20),AAHY01091603.1:1..1014,gap(20),
CO   complement(AAHY01091604.1:1..1287),gap(20),AAHY01091605.1:1..6609,
CO   gap(2720),complement(AAHY01091606.1:1..6711),gap(4422),
CO   complement(AAHY01091607.1:1..16395),gap(20),AAHY01091608.1:1..1918,gap(20),
CO   AAHY01091609.1:1..15132,gap(20),complement(AAHY01091610.1:1..1106),
CO   gap(7922),complement(AAHY01091611.1:1..13880),gap(621),
CO   complement(AAHY01091612.1:1..6516),gap(1675),
CO   complement(AAHY01091613.1:1..1202),gap(20),
CO   complement(AAHY01091614.1:1..9075),gap(20),AAHY01091615.1:1..5623,gap(20),
CO   AAHY01091616.1:1..18084,gap(534),complement(AAHY01091617.1:1..366),
CO   gap(658),complement(AAHY01091618.1:1..4075),gap(29),AAHY01091619.1:1..6004,
CO   gap(59),complement(AAHY01091620.1:1..66581),gap(470),
CO   complement(AAHY01091621.1:1..1924),gap(20),
CO   complement(AAHY01091622.1:1..18044),gap(20),AAHY01091623.1:1..1039,gap(20),
CO   AAHY01091624.1:1..1293,gap(20),complement(AAHY01091625.1:1..15318),gap(20),
CO   complement(AAHY01091626.1:1..2194),gap(39),
CO   complement(AAHY01091627.1:1..4180),gap(20),
CO   complement(AAHY01091628.1:1..5101),gap(20),
CO   complement(AAHY01091629.1:1..27350),gap(20),
CO   complement(AAHY01091630.1:1..3985),gap(819),
CO   complement(AAHY01091631.1:1..2421),gap(20),
CO   complement(AAHY01091632.1:1..4668),gap(20),
CO   complement(AAHY01091633.1:1..8320),gap(20),AAHY01091634.1:1..1752,gap(20),
CO   complement(AAHY01091635.1:1..1192),gap(20),
CO   complement(AAHY01091636.1:1..12877),gap(20),
CO   complement(AAHY01091637.1:1..1804),gap(20),
CO   complement(AAHY01091638.1:1..4198),gap(20),
CO   complement(AAHY01091639.1:1..1338),gap(20),AAHY01091640.1:1..1559,gap(414),
CO   complement(AAHY01091641.1:1..1901),gap(20),
CO   complement(AAHY01091642.1:1..15021),gap(20),
CO   complement(AAHY01091643.1:1..35774),gap(415),
CO   complement(AAHY01091644.1:1..3404),gap(2752),
CO   complement(AAHY01091645.1:1..3044),gap(7631),
CO   complement(AAHY01091646.1:1..3073),gap(20),
CO   complement(AAHY01091647.1:1..4255),gap(493),
CO   complement(AAHY01091648.1:1..1243),gap(149),
CO   complement(AAHY01091649.1:1..19971),gap(20),
CO   complement(AAHY01091650.1:1..7805),gap(49),
CO   complement(AAHY01091651.1:1..3087),gap(20),
CO   complement(AAHY01091652.1:1..16937),gap(675),
CO   complement(AAHY01091653.1:1..9001),gap(151),AAHY01091654.1:1..1149,
CO   gap(500),complement(AAHY01091655.1:1..8413),gap(20),AAHY01091656.1:1..1938,
CO   gap(20),complement(AAHY01091657.1:1..3035),gap(708),
CO   complement(AAHY01091658.1:1..1481),gap(20),
CO   complement(AAHY01091659.1:1..1364),gap(20),
CO   complement(AAHY01091660.1:1..4654),gap(20),
CO   complement(AAHY01091661.1:1..1219),gap(20),AAHY01091662.1:1..9517,
CO   gap(1516),complement(AAHY01091663.1:1..1783),gap(20),
CO   AAHY01091664.1:1..1025,gap(20),AAHY01091665.1:1..1250,gap(1606),
CO   complement(AAHY01091666.1:1..1603),gap(1114),AAHY01091667.1:1..1248,
CO   gap(498),AAHY01091668.1:1..2796,gap(20),AAHY01091669.1:1..3194,gap(20),
CO   complement(AAHY01091670.1:1..1518),gap(50),AAHY01091671.1:1..2413,gap(20),
CO   AAHY01091672.1:1..1692,gap(2043),AAHY01091673.1:1..1947,gap(20),
CO   AAHY01091674.1:1..1006,gap(299),AAHY01091675.1:1..1465,gap(200),
CO   complement(AAHY01091676.1:1..9758),gap(829),AAHY01091677.1:1..6993,gap(20),
CO   complement(AAHY01091678.1:1..3717),gap(20),
CO   complement(AAHY01091679.1:1..1609),gap(20),AAHY01091680.1:1..5534,gap(20),
CO   complement(AAHY01091681.1:1..1631),gap(20),
CO   complement(AAHY01091682.1:1..1062),gap(20),
CO   complement(AAHY01091683.1:1..12479),gap(266),AAHY01091684.1:1..1003,
CO   gap(20),AAHY01091685.1:1..1078,gap(130),complement(AAHY01091686.1:1..1175),
CO   gap(20),complement(AAHY01091687.1:1..1075),gap(20),
CO   complement(AAHY01091688.1:1..3590),gap(328),
CO   complement(AAHY01091689.1:1..4468),gap(20),
CO   complement(AAHY01091690.1:1..3324),gap(20),
CO   complement(AAHY01091691.1:1..4002),gap(20),
CO   complement(AAHY01091692.1:1..6568),gap(223),
CO   complement(AAHY01091693.1:1..26910),gap(6914),
CO   complement(AAHY01091694.1:1..14192),gap(20),
CO   complement(AAHY01091695.1:1..1123),gap(20),AAHY01091696.1:1..1457,
CO   gap(5309),complement(AAHY01091697.1:1..4548),gap(611),
CO   complement(AAHY01091698.1:1..4703),gap(20),
CO   complement(AAHY01091699.1:1..3159),gap(47),
CO   complement(AAHY01091700.1:1..8204),gap(20),AAHY01091701.1:1..1032,gap(20),
CO   AAHY01091702.1:1..1530,gap(415),complement(AAHY01091703.1:1..7204),gap(20),
CO   complement(AAHY01091704.1:1..6853),gap(173),
CO   complement(AAHY01091705.1:1..2127),gap(136),
CO   complement(AAHY01091706.1:1..1511),gap(20),
CO   complement(AAHY01091707.1:1..1100),gap(335),AAHY01091708.1:1..1575,
CO   gap(1041),AAHY01091709.1:1..631,gap(180),AAHY01091710.1:1..1761,gap(645),
CO   AAHY01091711.1:1..2041,gap(267),complement(AAHY01091712.1:1..13117),
CO   gap(20),complement(AAHY01091713.1:1..5187),gap(227),
CO   complement(AAHY01091714.1:1..11922),gap(20),
CO   complement(AAHY01091715.1:1..3075),gap(94),AAHY01091716.1:1..3856,gap(239),
CO   AAHY01091717.1:1..1318,gap(308),AAHY01091718.1:1..4701,gap(571),
CO   AAHY01091719.1:1..1882,gap(159),complement(AAHY01091720.1:1..7275),
CO   gap(982),AAHY01091721.1:1..10192,gap(38),AAHY01091722.1:1..5922,gap(488),
CO   complement(AAHY01091723.1:1..18622),gap(20),
CO   complement(AAHY01091724.1:1..36884),gap(20),
CO   complement(AAHY01091725.1:1..4473),gap(20),AAHY01091726.1:1..2135,gap(20),
CO   AAHY01091727.1:1..1393,gap(20),complement(AAHY01091728.1:1..10636),
CO   gap(1389),complement(AAHY01091729.1:1..1611),gap(20),
CO   complement(AAHY01091730.1:1..2828),gap(20),
CO   complement(AAHY01091731.1:1..1160),gap(1331),AAHY01091732.1:1..8533,
CO   gap(20),complement(AAHY01091733.1:1..17764),gap(410),
CO   complement(AAHY01091734.1:1..8891),gap(558),
CO   complement(AAHY01091735.1:1..2724),gap(718),AAHY01091736.1:1..6443,gap(20),
CO   AAHY01091737.1:1..1252,gap(1762),complement(AAHY01091738.1:1..2222),
CO   gap(20),complement(AAHY01091739.1:1..1783),gap(20),
CO   complement(AAHY01091740.1:1..1868),gap(20),
CO   complement(AAHY01091741.1:1..10863),gap(350),
CO   complement(AAHY01091742.1:1..2636),gap(20),
CO   complement(AAHY01091743.1:1..6045),gap(20),AAHY01091744.1:1..18829,
CO   gap(245),complement(AAHY01091745.1:1..71150),gap(20),
CO   AAHY01091746.1:1..1005,gap(2291),complement(AAHY01091747.1:1..1666),
CO   gap(4123),complement(AAHY01091748.1:1..1223),gap(20),
CO   AAHY01091749.1:1..1227,gap(20),AAHY01091750.1:1..1687,gap(20),
CO   AAHY01091751.1:1..2367,gap(20),AAHY01091752.1:1..2238,gap(5385),
CO   complement(AAHY01091753.1:1..6880),gap(20),
CO   complement(AAHY01091754.1:1..11503),gap(20),
CO   complement(AAHY01091755.1:1..31714),gap(249),
CO   complement(AAHY01091756.1:1..4458),gap(156),
CO   complement(AAHY01091757.1:1..6352),gap(20),
CO   complement(AAHY01091758.1:1..1384),gap(4425),
CO   complement(AAHY01091759.1:1..6502),gap(20),
CO   complement(AAHY01091760.1:1..74184),gap(20),
CO   complement(AAHY01091761.1:1..35197),gap(20),
CO   complement(AAHY01091762.1:1..23264),gap(20),
CO   complement(AAHY01091763.1:1..18553),gap(20),
CO   complement(AAHY01091764.1:1..9997),gap(20),AAHY01091765.1:1..1835,gap(20),
CO   AAHY01091766.1:1..1026,gap(20),complement(AAHY01091767.1:1..6123),gap(20),
CO   complement(AAHY01091768.1:1..7274),gap(20),
CO   complement(AAHY01091769.1:1..1010),gap(20),
CO   complement(AAHY01091770.1:1..1736),gap(7046),AAHY01091771.1:1..1306,
CO   gap(110),complement(AAHY01091772.1:1..49838),gap(20),
CO   AAHY01091773.1:1..1802,gap(20),AAHY01091774.1:1..1107,gap(20),
CO   AAHY01091775.1:1..2944,gap(20),AAHY01091776.1:1..1085,gap(20),
CO   complement(AAHY01091777.1:1..9336),gap(20),
CO   complement(AAHY01091778.1:1..33613),gap(20),
CO   complement(AAHY01091779.1:1..2247),gap(12973),AAHY01091780.1:1..2543,
CO   gap(20),AAHY01091781.1:1..5883,gap(434),complement(AAHY01091782.1:1..4134),
CO   gap(20),complement(AAHY01091783.1:1..4394),gap(2318),
CO   complement(AAHY01091784.1:1..12870),gap(20),
CO   complement(AAHY01091785.1:1..2658),gap(20),AAHY01091786.1:1..1198,gap(20),
CO   AAHY01091787.1:1..2460,gap(20),complement(AAHY01091788.1:1..9900),gap(20),
CO   complement(AAHY01091789.1:1..22884),gap(20),
CO   complement(AAHY01091790.1:1..10536),gap(20),
CO   complement(AAHY01091791.1:1..5394),gap(1684),
CO   complement(AAHY01091792.1:1..18192),gap(248),AAHY01091793.1:1..1565,
CO   gap(138),complement(AAHY01091794.1:1..1429),gap(20),
CO   complement(AAHY01091795.1:1..3278),gap(121),
CO   complement(AAHY01091796.1:1..1133),gap(20),
CO   complement(AAHY01091797.1:1..8893),gap(20),AAHY01091798.1:1..2279,gap(20),
CO   complement(AAHY01091799.1:1..1708),gap(20),
CO   complement(AAHY01091800.1:1..1247),gap(20),
CO   complement(AAHY01091801.1:1..6603),gap(20),AAHY01091802.1:1..11640,gap(20),
CO   complement(AAHY01091803.1:1..11096),gap(20),
CO   complement(AAHY01091804.1:1..3765),gap(20),
CO   complement(AAHY01091805.1:1..2011),gap(1025),
CO   complement(AAHY01091806.1:1..13092),gap(20),
CO   complement(AAHY01091807.1:1..1851),gap(20),AAHY01091808.1:1..6412,gap(20),
CO   complement(AAHY01091809.1:1..14407),gap(20),
CO   complement(AAHY01091810.1:1..36528),gap(20),
CO   complement(AAHY01091811.1:1..2749),gap(58),
CO   complement(AAHY01091812.1:1..2820),gap(116),
CO   complement(AAHY01091813.1:1..7394),gap(20),
CO   complement(AAHY01091814.1:1..15703),gap(20),
CO   complement(AAHY01091815.1:1..24050),gap(20),AAHY01091816.1:1..2144,gap(20),
CO   complement(AAHY01091817.1:1..10793),gap(20),
CO   complement(AAHY01091818.1:1..7708),gap(20),
CO   complement(AAHY01091819.1:1..14049),gap(3016),AAHY01091820.1:1..1371,
CO   gap(20),complement(AAHY01091821.1:1..35561),gap(1384),
CO   complement(AAHY01091822.1:1..1116),gap(20),
CO   complement(AAHY01091823.1:1..4124),gap(223),
CO   complement(AAHY01091824.1:1..37896),gap(140),
CO   complement(AAHY01091825.1:1..23504),gap(20),
CO   complement(AAHY01091826.1:1..3439),gap(20),
CO   complement(AAHY01091827.1:1..10926),gap(59),
CO   complement(AAHY01091828.1:1..116759),gap(246),
CO   complement(AAHY01091829.1:1..28553),gap(20),
CO   complement(AAHY01091830.1:1..6486),gap(844),
CO   complement(AAHY01091831.1:1..13471),gap(20),
CO   complement(AAHY01091832.1:1..10342),gap(20),AAHY01091833.1:1..8985,
CO   gap(839),complement(AAHY01091834.1:1..14958),gap(743),
CO   AAHY01091835.1:1..1256,gap(20),AAHY01091836.1:1..1035,gap(20),
CO   complement(AAHY01091837.1:1..1175),gap(76),AAHY01091838.1:1..1232,gap(20),
CO   complement(AAHY01091839.1:1..8967),gap(776),
CO   complement(AAHY01091840.1:1..3949),gap(20),AAHY01091841.1:1..1186,gap(20),
CO   complement(AAHY01091842.1:1..1895),gap(20),AAHY01091843.1:1..42127,
CO   gap(654),complement(AAHY01091844.1:1..4306),gap(3159),
CO   complement(AAHY01091845.1:1..1100),gap(20),
CO   complement(AAHY01091846.1:1..1049),gap(20),
CO   complement(AAHY01091847.1:1..24704),gap(20),
CO   complement(AAHY01091848.1:1..10590),gap(20),
CO   complement(AAHY01091849.1:1..1274),gap(20),
CO   complement(AAHY01091850.1:1..1439),gap(20),AAHY01091851.1:1..5727,gap(20),
CO   AAHY01091852.1:1..8889,gap(60),complement(AAHY01091853.1:1..10637),
CO   gap(186),AAHY01091854.1:1..1547,gap(20),complement(AAHY01091855.1:1..1249),
CO   gap(20),complement(AAHY01091856.1:1..4957),gap(20),AAHY01091857.1:1..1440,
CO   gap(20),AAHY01091858.1:1..38695,gap(20),AAHY01091859.1:1..19295,gap(4571),
CO   complement(AAHY01091860.1:1..6016),gap(163),
CO   complement(AAHY01091861.1:1..1138),gap(20),
CO   complement(AAHY01091862.1:1..78845),gap(20),
CO   complement(AAHY01091863.1:1..25372),gap(3034),
CO   complement(AAHY01091864.1:1..24516),gap(1632),
CO   complement(AAHY01091865.1:1..4824),gap(50),
CO   complement(AAHY01091866.1:1..48266),gap(20),
CO   complement(AAHY01091867.1:1..16903),gap(3810),
CO   complement(AAHY01091868.1:1..7918),gap(538),AAHY01091869.1:1..2731,
CO   gap(295),complement(AAHY01091870.1:1..74646),gap(20),
CO   complement(AAHY01091871.1:1..1250),gap(20),
CO   complement(AAHY01091872.1:1..4572),gap(20),
CO   complement(AAHY01091873.1:1..4029),gap(20),
CO   complement(AAHY01091874.1:1..58956),gap(20),
CO   complement(AAHY01091875.1:1..7195),gap(20),
CO   complement(AAHY01091876.1:1..2294),gap(20),
CO   complement(AAHY01091877.1:1..1068),gap(20),AAHY01091878.1:1..1064,gap(20),
CO   complement(AAHY01091879.1:1..4678),gap(20),
CO   complement(AAHY01091880.1:1..1209),gap(20),
CO   complement(AAHY01091881.1:1..28582),gap(49),AAHY01091882.1:1..4101,gap(20),
CO   AAHY01091883.1:1..1904,gap(1331),complement(AAHY01091884.1:1..12915),
CO   gap(175),complement(AAHY01091885.1:1..13162),gap(20),
CO   complement(AAHY01091886.1:1..3198),gap(637),
CO   complement(AAHY01091887.1:1..1730),gap(20),
CO   complement(AAHY01091888.1:1..4635),gap(20),AAHY01091889.1:1..2339,gap(20),
CO   complement(AAHY01091890.1:1..3527),gap(20),AAHY01091891.1:1..19768,gap(20),
CO   complement(AAHY01091892.1:1..15463),gap(20),
CO   complement(AAHY01091893.1:1..2959),gap(20),
CO   complement(AAHY01091894.1:1..2194),gap(1067),
CO   complement(AAHY01091895.1:1..1136),gap(20),
CO   complement(AAHY01091896.1:1..2594),gap(20),AAHY01091897.1:1..1033,gap(714),
CO   complement(AAHY01091898.1:1..15357),gap(20),
CO   complement(AAHY01091899.1:1..10236),gap(10803),
CO   complement(AAHY01091900.1:1..17669),gap(20),AAHY01091901.1:1..7219,
CO   gap(959),complement(AAHY01091902.1:1..3624),gap(20),
CO   complement(AAHY01091903.1:1..50213),gap(20),
CO   complement(AAHY01091904.1:1..2042),gap(20),
CO   complement(AAHY01091905.1:1..2820),gap(20),
CO   complement(AAHY01091906.1:1..9644),gap(370),AAHY01091907.1:1..1490,
CO   gap(2993),complement(AAHY01091908.1:1..12839),gap(2179),
CO   AAHY01091909.1:1..5906,gap(7694),AAHY01091910.1:1..1427,gap(397),
CO   complement(AAHY01091911.1:1..3512),gap(339),
CO   complement(AAHY01091912.1:1..8090),gap(203),
CO   complement(AAHY01091913.1:1..1299),gap(442),
CO   complement(AAHY01091914.1:1..21427),gap(20),AAHY01091915.1:1..1147,gap(20),
CO   complement(AAHY01091916.1:1..8682),gap(20),
CO   complement(AAHY01091917.1:1..3460),gap(20),
CO   complement(AAHY01091918.1:1..1961),gap(20),AAHY01091919.1:1..1260,gap(20),
CO   AAHY01091920.1:1..2030,gap(20),complement(AAHY01091921.1:1..8999),gap(20),
CO   complement(AAHY01091922.1:1..1945),gap(2080),
CO   complement(AAHY01091923.1:1..52403),gap(439),
CO   complement(AAHY01091924.1:1..1033),gap(20),AAHY01091925.1:1..1384,gap(20),
CO   complement(AAHY01091926.1:1..2552),gap(435),
CO   complement(AAHY01091927.1:1..9737),gap(20),AAHY01091928.1:1..1347,gap(20),
CO   complement(AAHY01091929.1:1..3739),gap(20),
CO   complement(AAHY01091930.1:1..2152),gap(20),
CO   complement(AAHY01091931.1:1..1376),gap(20),AAHY01091932.1:1..1883,gap(20),
CO   AAHY01091933.1:1..1189,gap(810),AAHY01091934.1:1..8989,gap(20),
CO   complement(AAHY01091935.1:1..1009),gap(1114),
CO   complement(AAHY01091936.1:1..2423),gap(20),
CO   complement(AAHY01091937.1:1..1065),gap(20),AAHY01091938.1:1..1094,
CO   gap(1672),AAHY01091939.1:1..1791,gap(20),
CO   complement(AAHY01091940.1:1..2397),gap(2292),
CO   complement(AAHY01091941.1:1..48321),gap(31),
CO   complement(AAHY01091942.1:1..1183),gap(1099),AAHY01091943.1:1..1752,
CO   gap(721),AAHY01091944.1:1..6721,gap(20),complement(AAHY01091945.1:1..1559),
CO   gap(7765),AAHY01091946.1:1..1464,gap(20),AAHY01091947.1:1..20895,gap(20),
CO   AAHY01091948.1:1..8410,gap(361),AAHY01091949.1:1..1936,gap(20),
CO   complement(AAHY01091950.1:1..1095),gap(20),
CO   complement(AAHY01091951.1:1..9225),gap(20),
CO   complement(AAHY01091952.1:1..1132),gap(20),
CO   complement(AAHY01091953.1:1..2279),gap(20),AAHY01091954.1:1..1179,gap(199),
CO   complement(AAHY01091955.1:1..20293),gap(1869),
CO   complement(AAHY01091956.1:1..25585),gap(20),
CO   complement(AAHY01091957.1:1..1304),gap(20),
CO   complement(AAHY01091958.1:1..2235),gap(20),
CO   complement(AAHY01091959.1:1..7902),gap(20),
CO   complement(AAHY01091960.1:1..18129),gap(20),
CO   complement(AAHY01091961.1:1..3536),gap(521),
CO   complement(AAHY01091962.1:1..11371),gap(20),
CO   complement(AAHY01091963.1:1..49047),gap(20),
CO   complement(AAHY01091964.1:1..25187),gap(20),
CO   complement(AAHY01091965.1:1..14703),gap(20),AAHY01091966.1:1..1477,gap(20),
CO   complement(AAHY01091967.1:1..1281),gap(20),AAHY01091968.1:1..18614,gap(92),
CO   complement(AAHY01091969.1:1..39172),gap(265),
CO   complement(AAHY01091970.1:1..2529),gap(20),
CO   complement(AAHY01091971.1:1..60563),gap(211),
CO   complement(AAHY01091972.1:1..22238),gap(2582),
CO   complement(AAHY01091973.1:1..1012),gap(20),
CO   complement(AAHY01091974.1:1..1559),gap(20),
CO   complement(AAHY01091975.1:1..1598),gap(20),
CO   complement(AAHY01091976.1:1..1169),gap(20),
CO   complement(AAHY01091977.1:1..4860),gap(21690),
CO   complement(AAHY01091978.1:1..7690),gap(20),AAHY01091979.1:1..2868,gap(20),
CO   AAHY01091980.1:1..1272,gap(674),AAHY01091981.1:1..1084,gap(5037),
CO   complement(AAHY01091982.1:1..1088),gap(20),
CO   complement(AAHY01091983.1:1..2709),gap(20),
CO   complement(AAHY01091984.1:1..19771),gap(4075),
CO   complement(AAHY01091985.1:1..5905),gap(20),AAHY01091986.1:1..1536,gap(20),
CO   AAHY01091987.1:1..1016,gap(20),complement(AAHY01091988.1:1..5258),
CO   gap(2238),AAHY01091989.1:1..2752,gap(32),AAHY01091990.1:1..3089,gap(20),
CO   complement(AAHY01091991.1:1..2175),gap(20),AAHY01091992.1:1..1546,
CO   gap(3206),complement(AAHY01091993.1:1..1857),gap(20),
CO   complement(AAHY01091994.1:1..27802),gap(20),
CO   complement(AAHY01091995.1:1..1502),gap(20),
CO   complement(AAHY01091996.1:1..18225),gap(20),
CO   complement(AAHY01091997.1:1..18397),gap(20),AAHY01091998.1:1..6949,gap(20),
CO   complement(AAHY01091999.1:1..15037),gap(20),AAHY01092000.1:1..1073,gap(20),
CO   AAHY01092001.1:1..5865,gap(20),complement(AAHY01092002.1:1..1479),gap(20),
CO   AAHY01092003.1:1..1361,gap(20),complement(AAHY01092004.1:1..1228),gap(20),
CO   AAHY01092005.1:1..2523,gap(4342),complement(AAHY01092006.1:1..13989),
CO   gap(20),complement(AAHY01092007.1:1..11574),gap(728),
CO   complement(AAHY01092008.1:1..27172),gap(215),
CO   complement(AAHY01092009.1:1..1681),gap(20),
CO   complement(AAHY01092010.1:1..33198),gap(736),
CO   complement(AAHY01092011.1:1..1513),gap(20),
CO   complement(AAHY01092012.1:1..22302),gap(20),AAHY01092013.1:1..1283,gap(20),
CO   complement(AAHY01092014.1:1..4924),gap(20),AAHY01092015.1:1..1001,gap(20),
CO   complement(AAHY01092016.1:1..1129),gap(20),
CO   complement(AAHY01092017.1:1..1067),gap(20),AAHY01092018.1:1..1272,gap(20),
CO   complement(AAHY01092019.1:1..1445),gap(643),
CO   complement(AAHY01092020.1:1..1165),gap(20),
CO   complement(AAHY01092021.1:1..1125),gap(600),
CO   complement(AAHY01092022.1:1..31259),gap(20),AAHY01092023.1:1..5260,gap(20),
CO   complement(AAHY01092024.1:1..1223),gap(2949),
CO   complement(AAHY01092025.1:1..8011),gap(20),
CO   complement(AAHY01092026.1:1..7967),gap(376),
CO   complement(AAHY01092027.1:1..26501),gap(20),
CO   complement(AAHY01092028.1:1..2183),gap(20),
CO   complement(AAHY01092029.1:1..2783),gap(20),
CO   complement(AAHY01092030.1:1..10694),gap(20),
CO   complement(AAHY01092031.1:1..2214),gap(20),
CO   complement(AAHY01092032.1:1..29160),gap(217),
CO   complement(AAHY01092033.1:1..2702),gap(187),
CO   complement(AAHY01092034.1:1..17596),gap(20),
CO   complement(AAHY01092035.1:1..1670),gap(20),
CO   complement(AAHY01092036.1:1..103222),gap(978),
CO   complement(AAHY01092037.1:1..66720),gap(158),
CO   complement(AAHY01092038.1:1..9517),gap(20),AAHY01092039.1:1..14294,gap(20),
CO   complement(AAHY01092040.1:1..34974),gap(20),AAHY01092041.1:1..6428,
CO   gap(121),complement(AAHY01092042.1:1..52512),gap(20),
CO   AAHY01092043.1:1..29465,gap(101),AAHY01092044.1:1..26506,gap(212),
CO   AAHY01092045.1:1..1176,gap(348),AAHY01092046.1:1..11971,gap(79),
CO   AAHY01092047.1:1..23953,gap(95),complement(AAHY01092048.1:1..580),gap(370),
CO   complement(AAHY01092049.1:1..5321),gap(303),AAHY01092050.1:1..14822,
CO   gap(188),complement(AAHY01092051.1:1..18998),gap(76),
CO   AAHY01092052.1:1..27628,gap(315),AAHY01092053.1:1..6476,gap(20),
CO   AAHY01092054.1:1..6002,gap(144),complement(AAHY01092055.1:1..7838),gap(37),
CO   AAHY01092056.1:1..12589,gap(30),complement(AAHY01092057.1:1..2973),
CO   gap(166),complement(AAHY01092058.1:1..15582),gap(129),
CO   AAHY01092059.1:1..3520,gap(20),AAHY01092060.1:1..7920,gap(154),
CO   AAHY01092061.1:1..1969,gap(127),complement(AAHY01092062.1:1..5821),gap(20),
CO   complement(AAHY01092063.1:1..9896),gap(20),AAHY01092064.1:1..1675,gap(160),
CO   complement(AAHY01092065.1:1..1303),gap(20),
CO   complement(AAHY01092066.1:1..16443),gap(262),
CO   complement(AAHY01092067.1:1..7222),gap(20),
CO   complement(AAHY01092068.1:1..1567),gap(20),
CO   complement(AAHY01092069.1:1..1119),gap(83),
CO   complement(AAHY01092070.1:1..13541),gap(202),
CO   complement(AAHY01092071.1:1..4234),gap(20),
CO   complement(AAHY01092072.1:1..7018),gap(20),
CO   complement(AAHY01092073.1:1..7388),gap(143),
CO   complement(AAHY01092074.1:1..4831),gap(263),
CO   complement(AAHY01092075.1:1..18107),gap(127),
CO   complement(AAHY01092076.1:1..61686),gap(461),
CO   complement(AAHY01092077.1:1..8764),gap(338),
CO   complement(AAHY01092078.1:1..2495),gap(956),AAHY01092079.1:1..495,gap(538),
CO   complement(AAHY01092080.1:1..42976),gap(89),
CO   complement(AAHY01092081.1:1..7033),gap(172),
CO   complement(AAHY01092082.1:1..37059),gap(20),
CO   complement(AAHY01092083.1:1..24146),gap(921),
CO   complement(AAHY01092084.1:1..21486),gap(20),AAHY01092085.1:1..3580,
CO   gap(165),AAHY01092086.1:1..9270,gap(20),AAHY01092087.1:1..41186,gap(679),
CO   AAHY01092088.1:1..8251,gap(183),complement(AAHY01092089.1:1..1644),
CO   gap(1216),complement(AAHY01092090.1:1..1238),gap(64),
CO   complement(AAHY01092091.1:1..35412),gap(286),
CO   complement(AAHY01092092.1:1..18209),gap(123),
CO   complement(AAHY01092093.1:1..8267),gap(461),
CO   complement(AAHY01092094.1:1..15969),gap(209),
CO   complement(AAHY01092095.1:1..24215),gap(274),
CO   complement(AAHY01092096.1:1..2448),gap(409),
CO   complement(AAHY01092097.1:1..3544),gap(271),
CO   complement(AAHY01092098.1:1..10049),gap(130),
CO   complement(AAHY01092099.1:1..17761),gap(266),
CO   complement(AAHY01092100.1:1..6794),gap(415),
CO   complement(AAHY01092101.1:1..13585),gap(291),AAHY01092102.1:1..4233,
CO   gap(427),AAHY01092103.1:1..5101,gap(20),
CO   complement(AAHY01092104.1:1..18586),gap(258),
CO   complement(AAHY01092105.1:1..1669),gap(20),
CO   complement(AAHY01092106.1:1..18584),gap(354),
CO   complement(AAHY01092107.1:1..13965),gap(20),
CO   complement(AAHY01092108.1:1..31261),gap(173),
CO   complement(AAHY01092109.1:1..8037),gap(142),
CO   complement(AAHY01092110.1:1..1142),gap(20),
CO   complement(AAHY01092111.1:1..2808),gap(60),
CO   complement(AAHY01092112.1:1..1968),gap(20),
CO   complement(AAHY01092113.1:1..15595),gap(909),
CO   complement(AAHY01092114.1:1..38646),gap(399),
CO   complement(AAHY01092115.1:1..4371),gap(1364),
CO   complement(AAHY01092116.1:1..1068),gap(136),
CO   complement(AAHY01092117.1:1..15622),gap(20),AAHY01092118.1:1..1289,gap(20),
CO   complement(AAHY01092119.1:1..20398),gap(914),
CO   complement(AAHY01092120.1:1..18629),gap(153),
CO   complement(AAHY01092121.1:1..19912),gap(20),
CO   complement(AAHY01092122.1:1..31419),gap(49),
CO   complement(AAHY01092123.1:1..2101),gap(195),AAHY01092124.1:1..10707,
CO   gap(375),complement(AAHY01092125.1:1..4304),gap(354),AAHY01092126.1:1..983,
CO   gap(2094),complement(AAHY01092127.1:1..1114),gap(20),
CO   AAHY01092128.1:1..1092,gap(138),AAHY01092129.1:1..24252,gap(82),
CO   AAHY01092130.1:1..32762,gap(84),AAHY01092131.1:1..45057,gap(2383),
CO   complement(AAHY01092132.1:1..2371),gap(81),AAHY01092133.1:1..5194,gap(20),
CO   AAHY01092134.1:1..2078,gap(99),AAHY01092135.1:1..6646,gap(472),
CO   complement(AAHY01092136.1:1..8538),gap(805),
CO   complement(AAHY01092137.1:1..9463),gap(54),
CO   complement(AAHY01092138.1:1..22906),gap(20),
CO   complement(AAHY01092139.1:1..15680),gap(272),
CO   complement(AAHY01092140.1:1..1089),gap(20),
CO   complement(AAHY01092141.1:1..12755),gap(20),
CO   complement(AAHY01092142.1:1..15875),gap(20),
CO   complement(AAHY01092143.1:1..8384),gap(20),
CO   complement(AAHY01092144.1:1..9629),gap(382),AAHY01092145.1:1..20671,
CO   gap(20),complement(AAHY01092146.1:1..57344),gap(20),
CO   complement(AAHY01092147.1:1..15049),gap(20),AAHY01092148.1:1..15378,
CO   gap(20),complement(AAHY01092149.1:1..20559),gap(20),
CO   complement(AAHY01092150.1:1..6771),gap(20),AAHY01092151.1:1..9655,gap(20),
CO   complement(AAHY01092152.1:1..7986),gap(20),
CO   complement(AAHY01092153.1:1..5635),gap(103),
CO   complement(AAHY01092154.1:1..65722),gap(20),
CO   complement(AAHY01092155.1:1..18159),gap(20),AAHY01092156.1:1..9661,gap(20),
CO   complement(AAHY01092157.1:1..19384),gap(80),
CO   complement(AAHY01092158.1:1..4222),gap(120),
CO   complement(AAHY01092159.1:1..37043),gap(20),
CO   complement(AAHY01092160.1:1..5732),gap(41),
CO   complement(AAHY01092161.1:1..11916),gap(91),
CO   complement(AAHY01092162.1:1..6931),gap(318),
CO   complement(AAHY01092163.1:1..11677),gap(62),
CO   complement(AAHY01092164.1:1..624),gap(1090),
CO   complement(AAHY01092165.1:1..13760),gap(236),
CO   complement(AAHY01092166.1:1..9835),gap(131),
CO   complement(AAHY01092167.1:1..10824),gap(198),
CO   complement(AAHY01092168.1:1..21778),gap(20),
CO   complement(AAHY01092169.1:1..38355),gap(63),
CO   complement(AAHY01092170.1:1..11059),gap(20),
CO   complement(AAHY01092171.1:1..34558),gap(75),AAHY01092172.1:1..10052,
CO   gap(20),AAHY01092173.1:1..7559,gap(20),AAHY01092174.1:1..2591,gap(649),
CO   complement(AAHY01092175.1:1..17256),gap(391),AAHY01092176.1:1..9308,
CO   gap(188),complement(AAHY01092177.1:1..2072),gap(24),
CO   complement(AAHY01092178.1:1..43619),gap(694),
CO   complement(AAHY01092179.1:1..5199),gap(162),
CO   complement(AAHY01092180.1:1..4130),gap(710),AAHY01092181.1:1..20578,
CO   gap(20),complement(AAHY01092182.1:1..21054),gap(20),
CO   complement(AAHY01092183.1:1..8364),gap(171),AAHY01092184.1:1..35976,
CO   gap(88),complement(AAHY01092185.1:1..450),gap(20),AAHY01092186.1:1..2166,
CO   gap(253),complement(AAHY01092187.1:1..1333),gap(370),
CO   complement(AAHY01092188.1:1..30523),gap(20),
CO   complement(AAHY01092189.1:1..9148),gap(20),
CO   complement(AAHY01092190.1:1..20029),gap(120),
CO   complement(AAHY01092191.1:1..39598),gap(20),
CO   complement(AAHY01092192.1:1..17265),gap(184),
CO   complement(AAHY01092193.1:1..6359),gap(20),
CO   complement(AAHY01092194.1:1..1650),gap(62),
CO   complement(AAHY01092195.1:1..4799),gap(3962),
CO   complement(AAHY01092196.1:1..92858),gap(250),
CO   complement(AAHY01092197.1:1..16250),gap(25),
CO   complement(AAHY01092198.1:1..69320),gap(240),
CO   complement(AAHY01092199.1:1..17191),gap(127),
CO   complement(AAHY01092200.1:1..55453),gap(29),
CO   complement(AAHY01092201.1:1..60149),gap(48),
CO   complement(AAHY01092202.1:1..35997),gap(20),
CO   complement(AAHY01092203.1:1..3325),gap(20),
CO   complement(AAHY01092204.1:1..46015),gap(111),
CO   complement(AAHY01092205.1:1..2007),gap(232),
CO   complement(AAHY01092206.1:1..10989),gap(20),
CO   complement(AAHY01092207.1:1..14356),gap(66),
CO   complement(AAHY01092208.1:1..3316),gap(167),
CO   complement(AAHY01092209.1:1..6856),gap(70),
CO   complement(AAHY01092210.1:1..6208),gap(200),
CO   complement(AAHY01092211.1:1..5895),gap(20),
CO   complement(AAHY01092212.1:1..10817),gap(20),
CO   complement(AAHY01092213.1:1..36568),gap(321),AAHY01092214.1:1..14283,
CO   gap(20),complement(AAHY01092215.1:1..3697),gap(6472),
CO   complement(AAHY01092216.1:1..15421))
//


spacer
spacer