Dbfetch

ID   CH466603; SV 1; linear; genomic DNA; CON; MUS; 7579203 BP.
XX
AC   CH466603;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009791257 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7579203
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-7579203
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; a557d42b965d10bcf4818e4a970a85f2.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000215.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000002781; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003184; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003190; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003269; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003273; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003429; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003865; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003868; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003873; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004612; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006599; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007837; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008140; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008461; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009487; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000012640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014402; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014418; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030470; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030713; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030731; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030796; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030798; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030824; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030851; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038239; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038300; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038520; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038539; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038782; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038973; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039745; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040046; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040231; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045411; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047884; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050063; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050425; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050650; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053801; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055978; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057342; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058975; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059070; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060177; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063511; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066516; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067173; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074115; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074129; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000084234; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000100916; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000110206; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032117; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032123; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032124; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032142; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032144; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032145; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032147; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032160; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032164; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032178; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032182; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032191; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032192; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032200; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032210; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032211; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032214; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032217; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032220; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032221; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032222; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032224; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032233; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032237; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032240; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032242; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032243; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032248; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032250; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032254; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032262; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032264; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032266; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032271; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032272; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032273; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032274; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032275; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032281; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032295; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032299; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032303; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032102; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032108; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032109; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032127; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032129; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032130; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032132; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032134; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032139; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032143; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032157; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032161; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032170; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032171; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032179; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032189; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032193; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032196; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032199; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032200; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032201; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032203; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032212; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032216; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032219; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032221; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032222; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032227; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032229; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032233; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032241; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032243; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032245; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032249; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032251; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032252; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032253; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032254; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032255; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032260; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032271; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032274; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032278; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032282; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032032; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032038; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032039; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032057; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032059; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032060; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032062; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032075; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032079; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032093; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032097; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032107; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032115; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032125; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032126; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032129; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032132; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032135; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032136; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032137; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032139; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032148; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032152; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032155; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032157; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032158; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032163; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032165; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032169; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032177; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032179; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032181; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032185; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032187; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032188; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032189; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032190; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032196; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032210; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032214; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0032218; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032107; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032113; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032114; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032132; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032134; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032135; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032137; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032151; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032155; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032169; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032173; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032182; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032183; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032191; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032192; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032201; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032202; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032205; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032208; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032211; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032212; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032213; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032215; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032224; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032228; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032231; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032233; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032234; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032239; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032241; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032245; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032253; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032255; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032257; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032262; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032263; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032264; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032265; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032266; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032267; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032272; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032283; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032286; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032290; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032294; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031823; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031829; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031830; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031848; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031850; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031851; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031853; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031867; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031871; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031885; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031889; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031898; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031899; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031907; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031917; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031918; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031921; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031924; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031927; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031928; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031929; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031930; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031939; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031943; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031946; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031948; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031949; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031954; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031956; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031960; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031968; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031970; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031972; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031976; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031977; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031978; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031979; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031980; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031985; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031996; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031999; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032003; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032007; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032591; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032597; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032598; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032616; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032618; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032619; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032621; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032631; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032638; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032643; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032647; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032661; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032665; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032674; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032675; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032683; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032684; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032693; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032694; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032697; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032700; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032703; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032704; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032705; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032707; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032716; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032720; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032723; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032725; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032726; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032731; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032733; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032737; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032745; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032747; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032753; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032754; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032755; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032756; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032762; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032765; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032768; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032769; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032776; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032783; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032787; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024437; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031153; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031159; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031160; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031178; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031180; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031181; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031183; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031195; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031199; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031213; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031217; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031226; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031227; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031235; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031245; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031246; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031249; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031252; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031255; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031256; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031257; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031268; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031272; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031275; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031277; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031282; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031284; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031288; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031296; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031298; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031300; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031304; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031305; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031306; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031307; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031308; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031313; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031324; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031327; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031331; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031335; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031792; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031798; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031799; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031817; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031819; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031820; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031822; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031831; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031835; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031849; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031853; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031862; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031863; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031871; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031872; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031881; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031885; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031888; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031891; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031892; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031893; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031895; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031904; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031908; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031911; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031913; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031914; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031919; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031921; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031925; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031933; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031935; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031937; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031941; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031942; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031943; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031944; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031945; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031950; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031961; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031964; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031968; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031972; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031941; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031947; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031948; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031966; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031968; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031969; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031971; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031989; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031993; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032011; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032020; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032021; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032029; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032030; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032039; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032040; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032043; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032046; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032049; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032050; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032051; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032053; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032062; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032066; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032069; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032071; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032072; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032077; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032078; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032082; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032090; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032092; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032094; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032098; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032099; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032100; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032101; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032102; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032107; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032121; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032125; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0032129; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031902; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031908; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031927; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031929; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031930; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031932; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031940; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031944; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031958; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031962; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031971; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031972; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031980; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031981; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031990; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031991; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031994; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031997; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032000; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032001; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032002; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032004; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032013; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032017; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032020; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032022; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032023; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032028; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032030; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032034; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032042; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032044; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032046; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032051; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032052; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032053; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032054; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032055; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032056; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032061; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032072; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032075; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032079; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0032083; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032026; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032045; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032048; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032050; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032067; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032071; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032085; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032089; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032098; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032099; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032107; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032108; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032117; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032118; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032121; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032124; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032127; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032128; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032129; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032131; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032140; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032144; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032147; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032149; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032150; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032155; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032157; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032161; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032169; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032171; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032173; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032177; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032179; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032180; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032181; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032188; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032202; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032206; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0032210; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031938; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031944; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031945; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031963; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031965; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031966; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031968; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031977; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031981; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031995; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031999; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032008; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032009; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032017; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032018; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032027; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032028; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032031; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032034; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032037; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032038; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032039; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032041; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032050; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032054; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032057; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032059; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032060; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032065; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032067; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032071; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032079; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032081; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032083; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032087; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032089; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032090; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032091; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032092; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032093; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032098; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032109; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032112; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032116; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032120; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032611; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032617; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032618; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032636; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032638; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032639; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032641; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032659; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032663; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032677; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032681; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032690; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032691; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032699; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032713; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032716; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032719; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032720; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032721; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032723; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032732; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032736; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032739; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032741; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032742; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032747; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032748; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032752; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032760; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032762; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032764; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032769; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032770; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032771; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032772; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032773; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032774; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032779; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032782; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032785; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032786; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032796; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032800; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032804; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030874; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030880; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030881; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030899; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030901; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030902; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030904; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030918; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030922; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030936; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030940; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030949; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030950; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030958; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030969; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030972; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030975; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030978; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030979; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030980; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030981; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030990; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030994; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030997; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030999; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031005; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031007; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031011; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031019; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031021; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031023; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031027; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031028; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031029; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031030; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031031; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031033; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031038; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031044; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031047; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031051; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031055; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031267; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031273; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031274; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031292; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031294; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031295; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031297; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031303; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031312; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031316; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031330; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031334; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031343; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031344; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031352; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031353; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031362; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031363; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031366; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031369; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031372; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031373; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031374; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031376; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031385; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031389; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031392; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031394; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031400; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031402; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031406; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031414; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031416; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031418; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031423; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031424; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031425; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031426; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031427; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031428; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031433; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031442; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031445; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031449; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031453; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003044; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005051; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005891; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008605; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000012796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014562; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025202; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032658; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033060; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037220; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047356; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048015; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069772; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070518; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071296; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072453; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072836; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077528; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084937; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085351; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098438; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107669; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107729; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107771; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107834; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107893; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107966; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107967; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107968; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118515; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118831; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119710; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120262; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128088; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131384; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142663; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146760; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164538; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167273; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167786; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206839; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209066; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209245; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209287; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000209984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210060; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210086; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211337; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083422; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083442; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083445; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083500; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083504; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083505; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083511; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083547; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083580; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083648; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083676; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083703; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083704; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083720; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083741; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083753; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083769; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083782; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083799; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083800; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083803; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083810; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083858; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083868; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083873; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083879; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083882; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083908; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083915; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083926; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083961; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083963; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083972; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083989; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083990; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084003; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084008; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084012; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084026; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084043; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084047; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084072; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084089; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0083488; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083508; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083511; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083566; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083570; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083571; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083577; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083580; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083616; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083649; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083717; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083745; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083772; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083773; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083810; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083822; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083838; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083851; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083868; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083869; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083872; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083881; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083929; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083939; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083944; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083950; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083953; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083977; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083984; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083995; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084030; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084032; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084042; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084058; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084060; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084073; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084078; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084086; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084089; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084100; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084116; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084120; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084145; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0084163; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0083430; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083450; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083453; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083508; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083512; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083513; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083519; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083564; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083593; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083661; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083689; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083716; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083717; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083733; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083755; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083767; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083783; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083796; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083813; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083814; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083817; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083826; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083874; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083884; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083889; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083895; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083898; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083923; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083931; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083942; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083977; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083979; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083989; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084005; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084007; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084021; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084026; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084034; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084048; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084070; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084095; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0084112; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083474; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083477; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083532; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083536; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083537; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083543; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083588; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083621; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083689; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083717; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083744; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083745; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083762; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083782; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083794; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083810; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083823; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083840; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083841; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083844; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083854; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083902; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083912; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083917; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083923; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083926; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083952; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083959; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083970; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084005; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084007; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084017; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084034; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084035; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084048; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084053; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084060; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084063; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084074; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084095; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084120; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084137; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083030; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083050; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083053; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083108; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083112; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083113; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083119; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083161; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083262; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083290; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083317; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083318; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083334; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083356; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083368; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083384; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083397; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083414; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083418; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083424; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083472; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083482; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083487; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083493; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083496; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083520; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083528; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083539; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083575; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083577; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083587; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083603; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083617; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083622; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083630; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083633; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083644; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083661; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083665; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083692; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083709; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083945; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083965; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083968; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084023; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084027; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084028; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084034; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084045; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084056; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084083; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084116; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084184; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084212; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084239; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084240; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084256; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084257; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084278; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084290; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084306; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084319; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084336; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084337; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084340; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084349; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084395; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084405; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084410; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084416; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084419; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084447; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084454; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084465; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084499; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084501; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084510; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084526; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084539; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084544; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084552; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084566; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084572; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084576; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084577; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084587; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084591; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084616; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084633; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051940; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083549; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083568; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083571; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083628; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083632; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083633; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083639; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083672; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083773; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083801; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083828; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083829; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083845; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083868; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083880; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083897; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083910; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083928; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083929; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083932; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083942; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083991; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084001; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084006; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084012; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084033; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084040; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084051; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084088; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084090; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084099; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084116; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084129; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084134; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084142; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084145; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084156; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084178; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084203; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084219; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0082980; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082999; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083002; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083058; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083062; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083063; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083069; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083099; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083132; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083200; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083228; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083255; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083256; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083272; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083273; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083294; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083322; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083335; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083352; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083353; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083356; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083364; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083412; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083422; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083427; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083433; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083436; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083462; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083469; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083480; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083515; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083517; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083527; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083543; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083557; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083562; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083573; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083584; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083606; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083631; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0083648; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083158; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083178; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083181; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083236; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083240; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083241; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083247; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083286; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083319; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083387; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083415; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083442; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083443; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083459; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083460; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083481; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083493; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083509; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083522; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083539; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083540; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083543; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083552; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083600; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083610; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083615; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083621; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083624; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083648; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083655; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083666; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083701; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083703; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083713; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083729; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083743; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083748; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083756; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083759; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083770; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083788; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083792; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083817; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0083834; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083024; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083043; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083046; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083101; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083105; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083106; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083112; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083142; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083175; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083240; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083268; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083296; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083297; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083313; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083314; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083336; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083348; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083364; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083377; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083394; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083395; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083398; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083408; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083456; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083466; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083471; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083477; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083480; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083505; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083512; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083556; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083558; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083568; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083585; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083586; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083599; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083604; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083612; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083615; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083626; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083644; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083648; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083673; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0083690; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083171; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083190; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083193; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083253; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083254; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083260; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083303; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083336; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083404; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083432; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083459; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083460; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083476; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083477; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083497; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083509; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083525; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083538; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083555; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083556; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083559; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083569; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083617; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083627; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083632; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083639; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083642; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083668; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083675; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083686; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083720; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083722; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083731; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083747; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083749; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083762; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083767; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083775; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083789; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083807; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083811; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083836; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0083853; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083062; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083082; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083085; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083140; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083144; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083145; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083151; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083192; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083225; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083293; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083321; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083348; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083349; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083365; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083366; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083387; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083416; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083429; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083446; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083447; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083450; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083458; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083506; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083516; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083521; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083527; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083530; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083556; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083563; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083574; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083610; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083620; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083636; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083638; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083651; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083656; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083664; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083667; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083678; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083695; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083699; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083724; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083741; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084219; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084239; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084242; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084297; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084301; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084302; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084308; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084360; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084393; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084461; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084489; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084516; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084517; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084533; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084581; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084594; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084611; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084612; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084615; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084622; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084670; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084680; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084685; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084691; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084694; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084720; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084726; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084737; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084772; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084774; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084783; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084800; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084801; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084815; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084820; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084828; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084831; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084842; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084848; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084852; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084853; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084867; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084892; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084909; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082971; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082991; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082994; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083049; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083053; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083054; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083060; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083092; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083125; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083193; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083221; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083248; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083249; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083265; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083315; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083328; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083346; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083347; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083350; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083356; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083405; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083415; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083420; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083426; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083454; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083461; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083472; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083509; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083511; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083520; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083537; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083550; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083555; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083563; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083566; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083568; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083579; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083589; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083594; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083619; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083635; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082088; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082108; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082111; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082167; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082171; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082172; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082178; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082187; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082214; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082247; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082315; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082342; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082369; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082370; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082386; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082387; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082408; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082420; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082436; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082449; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082466; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082467; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082470; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082480; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082528; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082538; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082543; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082549; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082578; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082585; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082596; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082631; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082633; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082642; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082659; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082660; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082673; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082678; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082686; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082689; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082700; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082715; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082720; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082746; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082763; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7579203
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    3757..4324
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   gene            <8566..>83487
FT                   /locus_tag="mCG_54748"
FT                   /note="gene_id=mCG54748.1"
FT   mRNA            join(<8566..9624,10064..10166,44907..45501,45684..46007,
FT                   79917..80043,80239..80299,82518..>83487)
FT                   /locus_tag="mCG_54748"
FT                   /product="mCG54748"
FT                   /note="gene_id=mCG54748.1 transcript_id=mCT54931.1 created
FT                   on 04-JUN-2002"
FT   CDS             join(<8568..9624,10064..10166,44907..45501,45684..46007,
FT                   79917..80043,80239..80299,82518..83487)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54748"
FT                   /product="mCG54748"
FT                   /note="gene_id=mCG54748.1 transcript_id=mCT54931.1
FT                   protein_id=mCP30178.1"
FT                   /protein_id="EDL22642.1"
FT                   /translation="HKITPAGEKPYEYTQWDKAFKYHSHLQKLERNQTGDKNSEVFQHS
FT                   KVLACQSTLQRNKRTNTGEKPYKCNECDKAFLQLKYLRVHERTHSGKKPYECNQCGKAF
FT                   LHLNYLRIHERTHTGEKPYQCNQCGKAFTQRSHLQRHKVVHTGVRPYICNQCNKAYPQQ
FT                   NYLRKHERTHTGEKPYICNQCNKAFSHQSNLRIHEKTHTGEKPYKCNQCDKAFSHQSNL
FT                   QIHERTHTGEKPYKCNQCDKAFAHLKYLRAHERTHTQEKPYKCNQCGKAFLYLSCLRVH
FT                   ERTHTGEKPYKCNQCDKAFAHLKYLRAHERIHTQEKPYKCNQCGKAFLLLSCLRVHERT
FT                   HTGEKPYKCDQCAIFGYMKEHTLERNLTNVINVVRPLQKAGILKPIKHKITPAGEKPYE
FT                   YTQWDKAFKYHSHLQKLERNQTGDKNSEVFQHSKVLTCQSTLQRNKRTDTREKPYKCNE
FT                   CDKAFLKLKYLRLHERIYSGKKPYECNQCGKAFLHPSYLRMHERTHTGEKPYQCNQCGK
FT                   AFTRRSHLQSHKVVHTGERPYICNQCNKAYPRKSCLRKHERTHTGEKPYKCDQCGKAFT
FT                   QSSHLKTHKKPYKCNECDKAFSQPRYLRIHERTHTGEKPYKCYQCDKAFPQGNNLKVHT
FT                   RRHIGDIPMNEINVVKPLYMTNLLGSIKEQIMETGEKHYQHNQCGKAFAESSHLQTHKD
FT                   ALTFDDVHVHFTQEEWSLLDPSQKRLYKDVMLETYRNFIAIGYNWEDHNIEEHCQSDKR
FT                   YRRHERNPAGENQYEYILCDKAFTYHSHLQKHEGIQTQEKPSEGFQHSEVLACHSSLQI
FT                   HKRTDTGEKPYKCNQCDKSFSQLRYLRVHERTHTGEKPYVCNQCGKTFAHHCTLHLHRR
FT                   THTGEKPYECNQCGKAFAKNSYLQTHKVIHTGEKPFKCNQCDKAYSQQSHLLIHKRTHT
FT                   GEKPYKCSQCGKSFVSHSHLQAHERIHTGEKPYKCNQCDKAFSQHPSLQMHKRTHTGEK
FT                   PYKCNQCDKAFAQNSSLQMHTRTHTGEKPYECHQCGKAFSRHSSLQTHKRHHTGEKPYE
FT                   CNHCGEVFAYLSSLQYHKRNHLGEEPYPVL"
FT   assembly_gap    22067..22086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    63159..63178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    65525..65544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    92246..92265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    95056..95075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    103068..104150
FT                   /estimated_length=1083
FT                   /gap_type="unknown"
FT   gene            complement(116311..>133378)
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /note="gene_id=mCG22131.2"
FT   mRNA            complement(join(116311..116563,117989..120291,
FT                   121285..121380,121726..121852,131146..131300,
FT                   133219..133376))
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, transcript variant
FT                   mCT23887"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT23887.1 created
FT                   on 18-MAR-2003"
FT   mRNA            complement(join(116312..116563,118122..118254,
FT                   121285..121380,121726..121852,131146..131300,
FT                   133219..133365))
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, transcript variant
FT                   mCT181303"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT181303.0 created
FT                   on 18-MAR-2003"
FT   CDS             complement(join(116503..116563,118122..118254,
FT                   121285..121380,121726..121852,131146..131280))
FT                   /codon_start=1
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, isoform CRA_a"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT181303.0
FT                   protein_id=mCP104225.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D082"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:1917180"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D082"
FT                   /protein_id="EDL22643.1"
FT                   /translation="MTLEGFGFATKKTSRTEDRGAMAADPNFQQKSQPLGAEEQPESCE
FT                   RWMSFEDVTVNFSQEEWQHLDSAQRCLYQEVMLEIYSHLLAVGYSIPSPGVIFRMEKGK
FT                   EAQTAKAEFPGQRCQGERPYKCSSCWKAFCTKVQLQEHERIHTGERPYVCTHCGKAFRS
FT                   SMCDNIGTNNSVIFLKAICV"
FT   mRNA            complement(join(116639..120291,121285..121380,
FT                   121726..121852,128582..128687,131146..131365,
FT                   133219..>133378))
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, transcript variant
FT                   mCT191761"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT191761.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(116639..120291,121285..121380,
FT                   121726..121852,131146..131300,133219..>133370))
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, transcript variant
FT                   mCT191760"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT191760.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(116639..120291,121285..121380,
FT                   121726..121852,131146..>131601))
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, transcript variant
FT                   mCT191762"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT191762.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(117989..120291,121285..121380,
FT                   121726..121852,131146..131300,133219..>133219))
FT                   /codon_start=1
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, isoform CRA_b"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT191760.0
FT                   protein_id=mCP112706.0 isoform=CRA_b"
FT                   /protein_id="EDL22644.1"
FT                   /translation="ASPSSTSMTLEGFGFATKKTSRTEDRGAMAADPNFQQKSQPLGAE
FT                   EQPESCERWMSFEDVTVNFSQEEWQHLDSAQRCLYQEVMLEIYSHLLAVGYSIPSPGVI
FT                   FRMEKGKEAQTAKAEFPGQRCQEKSGNDTLPQKASGKTSVYSNVASEVTRDGSWCSLLQ
FT                   ELWQGADITKRGQQNQILLFPPGSFLKKTLSKNSDHEYQKPRETIPLGPYLISTQEGLP
FT                   QYHSLPKSLDVSLGANGHNERDQLIDIVASSQLLIPGSCNANCVVTHGGEESYRSTGNG
FT                   DVLSHKQPLIYGNRFQVKADQSSQCQEVLYAISLHKPEITLTVDRPIVSYNGGKAFLYV
FT                   SDSLSHPFQLKVDRVVHTGGDPYKCSSCEKSFCNAAALQQHEQIHTEEKLYVCTLCGKA
FT                   FSDGSAFYEHELIHKNHTPFICDICGKAFLRKSELTSHKQCHNGEKPYKCNDCEKSFKF
FT                   PSQLKVHHQIHTGEKPYECRECGKSFSKTAKLKVHQRIHTGEKPYVCSQCGKAFNQKSI
FT                   LDRHEKLHPGEKPYKCNDCGKSFNYPSQLKVHCHSHTGEKPYKCHECGKSFNFPCELKV
FT                   HYQNHTGEKPYKCRECWKLFSKMSQLKAHYRVHTGERPYKCSHCGKAFSTKEQVQEHER
FT                   IHTGEKPFVCTECGKAFSSRSSFRKHQLIHTKEKPFVSQKCETGLQEATLIPHQQLHIG
FT                   EKPYKCPDCGKLFNYPSQLKSHYQIHTGEKPCKCPDCGKSFSKTSQLKAHSRIHTGERP
FT                   YVCSVCGKAFKQLSTLSRHEKIHMVEKPYKCSFCGKSFCSPSELKVHLLIHTGERPYKC
FT                   SSCWKAFCTKVQLQEHERIHTGERPYVCTHCGKAFRSRSVFSKHKLIHRKETPFICERC
FT                   GKVFLQKSELTSHLQTHIEDKP"
FT   CDS             complement(join(117989..120291,121285..121380,
FT                   121726..121852,131146..>131346))
FT                   /codon_start=1
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, isoform CRA_d"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT191762.0
FT                   protein_id=mCP112708.0 isoform=CRA_d"
FT                   /protein_id="EDL22646.1"
FT                   /translation="DHCNHSGLRISFCATASPSSTSMTLEGFGFATKKTSRTEDRGAMA
FT                   ADPNFQQKSQPLGAEEQPESCERWMSFEDVTVNFSQEEWQHLDSAQRCLYQEVMLEIYS
FT                   HLLAVGYSIPSPGVIFRMEKGKEAQTAKAEFPGQRCQEKSGNDTLPQKASGKTSVYSNV
FT                   ASEVTRDGSWCSLLQELWQGADITKRGQQNQILLFPPGSFLKKTLSKNSDHEYQKPRET
FT                   IPLGPYLISTQEGLPQYHSLPKSLDVSLGANGHNERDQLIDIVASSQLLIPGSCNANCV
FT                   VTHGGEESYRSTGNGDVLSHKQPLIYGNRFQVKADQSSQCQEVLYAISLHKPEITLTVD
FT                   RPIVSYNGGKAFLYVSDSLSHPFQLKVDRVVHTGGDPYKCSSCEKSFCNAAALQQHEQI
FT                   HTEEKLYVCTLCGKAFSDGSAFYEHELIHKNHTPFICDICGKAFLRKSELTSHKQCHNG
FT                   EKPYKCNDCEKSFKFPSQLKVHHQIHTGEKPYECRECGKSFSKTAKLKVHQRIHTGEKP
FT                   YVCSQCGKAFNQKSILDRHEKLHPGEKPYKCNDCGKSFNYPSQLKVHCHSHTGEKPYKC
FT                   HECGKSFNFPCELKVHYQNHTGEKPYKCRECWKLFSKMSQLKAHYRVHTGERPYKCSHC
FT                   GKAFSTKEQVQEHERIHTGEKPFVCTECGKAFSSRSSFRKHQLIHTKEKPFVSQKCETG
FT                   LQEATLIPHQQLHIGEKPYKCPDCGKLFNYPSQLKSHYQIHTGEKPCKCPDCGKSFSKT
FT                   SQLKAHSRIHTGERPYVCSVCGKAFKQLSTLSRHEKIHMVEKPYKCSFCGKSFCSPSEL
FT                   KVHLLIHTGERPYKCSSCWKAFCTKVQLQEHERIHTGERPYVCTHCGKAFRSRSVFSKH
FT                   KLIHRKETPFICERCGKVFLQKSELTSHLQTHIEDKP"
FT   CDS             complement(join(117989..120291,121285..121380,
FT                   121726..121852,131146..131280))
FT                   /codon_start=1
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, isoform CRA_e"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT23887.1
FT                   protein_id=mCP7734.2 isoform=CRA_e"
FT                   /db_xref="GOA:G3X9T1"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:1917180"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9T1"
FT                   /protein_id="EDL22647.1"
FT                   /translation="MTLEGFGFATKKTSRTEDRGAMAADPNFQQKSQPLGAEEQPESCE
FT                   RWMSFEDVTVNFSQEEWQHLDSAQRCLYQEVMLEIYSHLLAVGYSIPSPGVIFRMEKGK
FT                   EAQTAKAEFPGQRCQEKSGNDTLPQKASGKTSVYSNVASEVTRDGSWCSLLQELWQGAD
FT                   ITKRGQQNQILLFPPGSFLKKTLSKNSDHEYQKPRETIPLGPYLISTQEGLPQYHSLPK
FT                   SLDVSLGANGHNERDQLIDIVASSQLLIPGSCNANCVVTHGGEESYRSTGNGDVLSHKQ
FT                   PLIYGNRFQVKADQSSQCQEVLYAISLHKPEITLTVDRPIVSYNGGKAFLYVSDSLSHP
FT                   FQLKVDRVVHTGGDPYKCSSCEKSFCNAAALQQHEQIHTEEKLYVCTLCGKAFSDGSAF
FT                   YEHELIHKNHTPFICDICGKAFLRKSELTSHKQCHNGEKPYKCNDCEKSFKFPSQLKVH
FT                   HQIHTGEKPYECRECGKSFSKTAKLKVHQRIHTGEKPYVCSQCGKAFNQKSILDRHEKL
FT                   HPGEKPYKCNDCGKSFNYPSQLKVHCHSHTGEKPYKCHECGKSFNFPCELKVHYQNHTG
FT                   EKPYKCRECWKLFSKMSQLKAHYRVHTGERPYKCSHCGKAFSTKEQVQEHERIHTGEKP
FT                   FVCTECGKAFSSRSSFRKHQLIHTKEKPFVSQKCETGLQEATLIPHQQLHIGEKPYKCP
FT                   DCGKLFNYPSQLKSHYQIHTGEKPCKCPDCGKSFSKTSQLKAHSRIHTGERPYVCSVCG
FT                   KAFKQLSTLSRHEKIHMVEKPYKCSFCGKSFCSPSELKVHLLIHTGERPYKCSSCWKAF
FT                   CTKVQLQEHERIHTGERPYVCTHCGKAFRSRSVFSKHKLIHRKETPFICERCGKVFLQK
FT                   SELTSHLQTHIEDKP"
FT   CDS             complement(join(117989..120291,121285..121380,
FT                   121726..121852,128582..>128653))
FT                   /codon_start=1
FT                   /gene="Zfp715"
FT                   /locus_tag="mCG_22131"
FT                   /product="zinc finger protein 715, isoform CRA_c"
FT                   /note="gene_id=mCG22131.2 transcript_id=mCT191761.0
FT                   protein_id=mCP112707.0 isoform=CRA_c"
FT                   /protein_id="EDL22645.1"
FT                   /translation="TLNVDQLALNSEICLSPSQVLGLKRWMSFEDVTVNFSQEEWQHLD
FT                   SAQRCLYQEVMLEIYSHLLAVGYSIPSPGVIFRMEKGKEAQTAKAEFPGQRCQEKSGND
FT                   TLPQKASGKTSVYSNVASEVTRDGSWCSLLQELWQGADITKRGQQNQILLFPPGSFLKK
FT                   TLSKNSDHEYQKPRETIPLGPYLISTQEGLPQYHSLPKSLDVSLGANGHNERDQLIDIV
FT                   ASSQLLIPGSCNANCVVTHGGEESYRSTGNGDVLSHKQPLIYGNRFQVKADQSSQCQEV
FT                   LYAISLHKPEITLTVDRPIVSYNGGKAFLYVSDSLSHPFQLKVDRVVHTGGDPYKCSSC
FT                   EKSFCNAAALQQHEQIHTEEKLYVCTLCGKAFSDGSAFYEHELIHKNHTPFICDICGKA
FT                   FLRKSELTSHKQCHNGEKPYKCNDCEKSFKFPSQLKVHHQIHTGEKPYECRECGKSFSK
FT                   TAKLKVHQRIHTGEKPYVCSQCGKAFNQKSILDRHEKLHPGEKPYKCNDCGKSFNYPSQ
FT                   LKVHCHSHTGEKPYKCHECGKSFNFPCELKVHYQNHTGEKPYKCRECWKLFSKMSQLKA
FT                   HYRVHTGERPYKCSHCGKAFSTKEQVQEHERIHTGEKPFVCTECGKAFSSRSSFRKHQL
FT                   IHTKEKPFVSQKCETGLQEATLIPHQQLHIGEKPYKCPDCGKLFNYPSQLKSHYQIHTG
FT                   EKPCKCPDCGKSFSKTSQLKAHSRIHTGERPYVCSVCGKAFKQLSTLSRHEKIHMVEKP
FT                   YKCSFCGKSFCSPSELKVHLLIHTGERPYKCSSCWKAFCTKVQLQEHERIHTGERPYVC
FT                   THCGKAFRSRSVFSKHKLIHRKETPFICERCGKVFLQKSELTSHLQTHIEDKP"
FT   assembly_gap    152903..153392
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    169035..169054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <172518..180648
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /note="gene_id=mCG22133.3"
FT   mRNA            join(<172518..172599,172703..173188,173347..173625,
FT                   173801..173848,176155..176406,176506..176808,
FT                   177079..177178,177480..177615,179762..180553)
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /product="sialic acid binding Ig-like lectin F, transcript
FT                   variant mCT191766"
FT                   /note="gene_id=mCG22133.3 transcript_id=mCT191766.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<172584..172599,172703..172763,172826..173188,
FT                   173347..173625,173801..173848,176155..176406,
FT                   176506..176808,177079..177178,177480..177615,
FT                   179762..180648)
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /product="sialic acid binding Ig-like lectin F, transcript
FT                   variant mCT191765"
FT                   /note="gene_id=mCG22133.3 transcript_id=mCT191765.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(172584..172599,172703..172763,172826..173188,
FT                   173347..173625,173801..173848,176155..176406,
FT                   176506..176808,177082..177178,177480..177615,
FT                   179762..180648)
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /product="sialic acid binding Ig-like lectin F, transcript
FT                   variant mCT23889"
FT                   /note="gene_id=mCG22133.3 transcript_id=mCT23889.2 created
FT                   on 18-MAR-2003"
FT   CDS             join(<172703..172763,172826..173188,173347..173625,
FT                   173801..173848,176155..176406,176506..176808,
FT                   177079..177178,177480..177615,179762..179953)
FT                   /codon_start=1
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /product="sialic acid binding Ig-like lectin F, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22133.3 transcript_id=mCT191765.0
FT                   protein_id=mCP112711.0 isoform=CRA_b"
FT                   /protein_id="EDL22649.1"
FT                   /translation="EPRAFHCVMRWAWLLPLLWAGCLATDGYSLSVTGSVTVQEGLCVF
FT                   VACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNC
FT                   SLDIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIALTEVPNIQVTSTLVSGNSTKL
FT                   LCSVPWACEQGTPPIFSWMSSALTSLGHRTTLSSELNLTPRPQDNGTNLTCQVNLPGTG
FT                   VTVERTQQLSVIYAPQKMTIRVSWGDDTGTKVLQSGASLQIQEGESLSLVCMADSNPPA
FT                   VLSWERPTQKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRSLLQLL
FT                   GPSCSFEGQGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFTVKSSSAGQWANSSLI
FT                   LSMEFSSNHRLSCEAWSDNRVQRATILLVSGPKVSQAGKSETSRGTVLGAIWGAGLMAL
FT                   LAVCLCLIFFTVKVLRKKSALKVAATKGNHLAKNPASTINSASITSSNIALGYPIQGHL
FT                   NEPGSQTQKEQPPLATVPDTQKDEPELHYASLSFQGPMPPKPQNTEAMKSVYTEIKIHK
FT                   C"
FT   CDS             join(172727..172763,172826..173188,173347..173625,
FT                   173801..173848,176155..176406,176506..176808,
FT                   177082..177178,177480..177615,179762..179953)
FT                   /codon_start=1
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /product="sialic acid binding Ig-like lectin F, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG22133.3 transcript_id=mCT23889.2
FT                   protein_id=mCP7743.2 isoform=CRA_d"
FT                   /protein_id="EDL22651.1"
FT                   /translation="MRWAWLLPLLWAGCLATDGYSLSVTGSVTVQEGLCVFVACQVQYP
FT                   NSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCSLDIRDAQ
FT                   KIDTGTYFFRLDGSVKYSFQKSMLSVLVIALTEVPNIQVTSTLVSGNSTKLLCSVPWAC
FT                   EQGTPPIFSWMSSALTSLGHRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQ
FT                   LSVIYAPQKMTIRVSWGDDTGTKVLQSGASLQIQEGESLSLVCMADSNPPAVLSWERPT
FT                   QKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRSLLQLLGPSCSFEG
FT                   QGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFTVKSSSAGQWANSSLILSMEFSSN
FT                   HRLSCEAWSDNRVQRATILLVSGPKVSQGKSETSRGTVLGAIWGAGLMALLAVCLCLIF
FT                   FTVKVLRKKSALKVAATKGNHLAKNPASTINSASITSSNIALGYPIQGHLNEPGSQTQK
FT                   EQPPLATVPDTQKDEPELHYASLSFQGPMPPKPQNTEAMKSVYTEIKIHKC"
FT   mRNA            join(<172727..172763,172826..172973,173040..173188,
FT                   173347..173625,173801..173998,174283..174429,
FT                   176717..176808,177079..177178,177480..177615,
FT                   179762..179950)
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /product="sialic acid binding Ig-like lectin F, transcript
FT                   variant mCT181304"
FT                   /note="gene_id=mCG22133.3 transcript_id=mCT181304.0 created
FT                   on 18-MAR-2003"
FT   CDS             join(172727..172763,172826..172973,173040..173188,
FT                   173347..173625,173801..173998,174283..174338)
FT                   /codon_start=1
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /product="sialic acid binding Ig-like lectin F, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22133.3 transcript_id=mCT181304.0
FT                   protein_id=mCP104226.0 isoform=CRA_a"
FT                   /protein_id="EDL22648.1"
FT                   /translation="MRWAWLLPLLWAGCLATDGYSLSVTGSVTVQEGLCVFVACQVQYP
FT                   NSKGPVFGYWFREGANIFYLMGKENSHNCSLDIRDAQKIDTGTYFFRLDGSVKYSFQKS
FT                   MLSVLVIALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTSLGHRT
FT                   TLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIYAPQKMTIRVSWGDDTGR
FT                   VKFLLPGMGTGTASAGDEQVFWTSGRRKLRIPPPLTHILQSPHYISYQGWNYTTELNPR
FT                   HFLKRGS"
FT   CDS             join(<172768..173188,173347..173625,173801..173848,
FT                   176155..176406,176506..176808,177079..177178,
FT                   177480..177615,179762..179953)
FT                   /codon_start=1
FT                   /gene="Siglecf"
FT                   /locus_tag="mCG_22133"
FT                   /product="sialic acid binding Ig-like lectin F, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG22133.3 transcript_id=mCT191766.0
FT                   protein_id=mCP112712.0 isoform=CRA_c"
FT                   /protein_id="EDL22650.1"
FT                   /translation="VGTGTGLVGQDQDNPHFFAGCLATDGYSLSVTGSVTVQEGLCVFV
FT                   ACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCS
FT                   LDIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIALTEVPNIQVTSTLVSGNSTKLL
FT                   CSVPWACEQGTPPIFSWMSSALTSLGHRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGV
FT                   TVERTQQLSVIYAPQKMTIRVSWGDDTGTKVLQSGASLQIQEGESLSLVCMADSNPPAV
FT                   LSWERPTQKPFQLSTPAELQLPRAELEDQGKYICQAQNSQGAQTASVSLSIRSLLQLLG
FT                   PSCSFEGQGLHCSCSSRAWPAPSLRWRLGEGVLEGNSSNGSFTVKSSSAGQWANSSLIL
FT                   SMEFSSNHRLSCEAWSDNRVQRATILLVSGPKVSQAGKSETSRGTVLGAIWGAGLMALL
FT                   AVCLCLIFFTVKVLRKKSALKVAATKGNHLAKNPASTINSASITSSNIALGYPIQGHLN
FT                   EPGSQTQKEQPPLATVPDTQKDEPELHYASLSFQGPMPPKPQNTEAMKSVYTEIKIHKC
FT                   "
FT   assembly_gap    181471..181556
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    211365..211444
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            <229407..239490
FT                   /locus_tag="mCG_22132"
FT                   /note="gene_id=mCG22132.2"
FT   mRNA            join(<229407..229513,229649..229742,229874..230251,
FT                   230386..232349,232557..232604,232705..233317,
FT                   233575..233662,233758..233869,238953..239489)
FT                   /locus_tag="mCG_22132"
FT                   /product="mCG22132, transcript variant mCT191763"
FT                   /note="gene_id=mCG22132.2 transcript_id=mCT191763.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<229422..229513,229649..229742,229874..230251,
FT                   230386..230664,231652..231699,232086..232349,
FT                   232557..232604,232705..232962,233033..233317,
FT                   233575..233662,233758..233869,238953..>239023)
FT                   /locus_tag="mCG_22132"
FT                   /product="mCG22132, transcript variant mCT191764"
FT                   /note="gene_id=mCG22132.2 transcript_id=mCT191764.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<229436..229513,229649..229742,229874..230251,
FT                   232086..232604,232705..232962,233033..233317,
FT                   233575..233662,233758..233869,238953..239490)
FT                   /locus_tag="mCG_22132"
FT                   /product="mCG22132, transcript variant mCT23888"
FT                   /note="gene_id=mCG22132.2 transcript_id=mCT23888.1 created
FT                   on 30-MAY-2002"
FT   CDS             join(<229658..229742,229874..230251,232086..232604,
FT                   232705..232962,233033..233317,233575..233662,
FT                   233758..233869,238953..239219)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22132"
FT                   /product="mCG22132, isoform CRA_c"
FT                   /note="gene_id=mCG22132.2 transcript_id=mCT23888.1
FT                   protein_id=mCP7739.1 isoform=CRA_c"
FT                   /protein_id="EDL22654.1"
FT                   /translation="EGGQLVQVQDPPKATMSLLLFLLSFLLDGPQGQMESYFLQVQRIV
FT                   KAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARG
FT                   RFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEVPDLHENPS
FT                   HLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHY
FT                   TCQAENRLGSQQHTLDLSVLCEYDLPKVPGPKKDKGVTSGYKQSDYCAACVGDPMSDAP
FT                   THPQLPSLGGMFCPERRAWPVWNQFPVFIADPPQDLRVTVSQANRTVLEILRNAISLPV
FT                   LEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQN
FT                   PLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSS
FT                   NASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFS
FT                   KGAVLGFGITALLALCLIVVIVKTLQKKGTQEEPSRPKLSRGSTILDYINVVPKTRSLA
FT                   RNWKAEPDAPSRSSPLDTHFPKPKKKQKDPHFTYPGCPDPTSSSQVPVSENNPEELHYA
FT                   ALNFSRLRLQETQDPQDTYSDYTEVRVH"
FT   CDS             join(<229658..229742,229874..230251,230386..230664,
FT                   231652..231699,232086..232349,232557..232604,
FT                   232705..232962,233033..233317,233575..233662,
FT                   233758..233869,238953..>239023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22132"
FT                   /product="mCG22132, isoform CRA_b"
FT                   /note="gene_id=mCG22132.2 transcript_id=mCT191764.0
FT                   protein_id=mCP112710.0 isoform=CRA_b"
FT                   /protein_id="EDL22653.1"
FT                   /translation="EGGQLVQVQDPPKATMSLLLFLLSFLLDGPQGQMESYFLQVQRIV
FT                   KAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARG
FT                   RFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIF
FT                   IPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQH
FT                   HDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQS
FT                   LRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLG
FT                   SQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPAN
FT                   VSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQM
FT                   SSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSL
FT                   SLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSKGAVLGFGITALLALCLIV
FT                   VIVKTLQKKGTQEEPSRPKLSRGSTILDYINVVPKTRSLARNWKAEPDAPSRSSPLDTH
FT                   FPKP"
FT   CDS             join(<231755..232349,232557..232604,232705..232970)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22132"
FT                   /product="mCG22132, isoform CRA_a"
FT                   /note="gene_id=mCG22132.2 transcript_id=mCT191763.0
FT                   protein_id=mCP112709.0 isoform=CRA_a"
FT                   /protein_id="EDL22652.1"
FT                   /translation="KVWGGGKGQVGTLFTASPYPPSCSLSLSLCLSLCPSLSIFMPLSV
FT                   CLCVYVFVCLSVSVFVSISMSITISLSLYLHPSSVSLSHFCLFLSSFFSLYHCPSHPLS
FT                   AVCVSLVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTL
FT                   ALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNA
FT                   ISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFT
FT                   CAAQNPLGAQRISLSLSVHCE"
FT   assembly_gap    245115..245134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <251716..257751
FT                   /gene="Lim2"
FT                   /locus_tag="mCG_133333"
FT                   /note="gene_id=mCG133333.1"
FT   mRNA            join(<251716..251753,252182..252362,255173..255322,
FT                   256904..257038,257246..257751)
FT                   /gene="Lim2"
FT                   /locus_tag="mCG_133333"
FT                   /product="lens intrinsic membrane protein 2"
FT                   /note="gene_id=mCG133333.1 transcript_id=mCT134698.1
FT                   created on 30-MAY-2002"
FT   CDS             join(<251718..251753,252182..252362,255173..255322,
FT                   256904..257038,257246..257307)
FT                   /codon_start=1
FT                   /gene="Lim2"
FT                   /locus_tag="mCG_133333"
FT                   /product="lens intrinsic membrane protein 2"
FT                   /note="gene_id=mCG133333.1 transcript_id=mCT134698.1
FT                   protein_id=mCP63604.0"
FT                   /protein_id="EDL22655.1"
FT                   /translation="AEGGLRTDSATQITMYSFMGGGLFCAWVGTILLVVATATDHWMQY
FT                   RLSGSFAHQGLWRYCLGNKCFLQTESIAYWNATRAFMILSALCATSGIIMGVLAFAQQS
FT                   TFTRLSRPFSAGIMFFASTLFVLLALAIYTGVTVSFLGRRFGDWRFSWSYILGWVALLM
FT                   TFFAGIFYMCAYRMHECRRLATPR"
FT   gene            258726..259845
FT                   /gene="Nkg7"
FT                   /locus_tag="mCG_22139"
FT                   /note="gene_id=mCG22139.1"
FT   mRNA            join(258726..259058,259135..259281,259637..259845)
FT                   /gene="Nkg7"
FT                   /locus_tag="mCG_22139"
FT                   /product="natural killer cell group 7 sequence, transcript
FT                   variant mCT181305"
FT                   /note="gene_id=mCG22139.1 transcript_id=mCT181305.0 created
FT                   on 18-MAR-2003"
FT   mRNA            join(258736..259058,259135..259281,259373..259507,
FT                   259637..259845)
FT                   /gene="Nkg7"
FT                   /locus_tag="mCG_22139"
FT                   /product="natural killer cell group 7 sequence, transcript
FT                   variant mCT23896"
FT                   /note="gene_id=mCG22139.1 transcript_id=mCT23896.2 created
FT                   on 18-MAR-2003"
FT   CDS             join(258902..259058,259135..259281,259373..259507,
FT                   259637..259695)
FT                   /codon_start=1
FT                   /gene="Nkg7"
FT                   /locus_tag="mCG_22139"
FT                   /product="natural killer cell group 7 sequence, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22139.1 transcript_id=mCT23896.2
FT                   protein_id=mCP7729.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CY55"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR004032"
FT                   /db_xref="MGI:MGI:1931250"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CY55"
FT                   /protein_id="EDL22657.1"
FT                   /translation="MEPCRSLALFAGSLGLTSSLIALTTDFWIVATGPHFSAHSGLWPT
FT                   SQETQVAGYIHVTQSFCILAVLWGLVSVSFLVLSCIPALSAPGRGPLVSTVMAFSAALS
FT                   ILVAMAVYTSMRWSQTPFSQVQTFFSWSFYLGWVSFILFLFAGCLSLGAHCRTRRAEYE
FT                   TL"
FT   CDS             join(258902..259058,259135..259281,259637..259695)
FT                   /codon_start=1
FT                   /gene="Nkg7"
FT                   /locus_tag="mCG_22139"
FT                   /product="natural killer cell group 7 sequence, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22139.1 transcript_id=mCT181305.0
FT                   protein_id=mCP104227.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C2L9"
FT                   /db_xref="InterPro:IPR004032"
FT                   /db_xref="MGI:MGI:1931250"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C2L9"
FT                   /protein_id="EDL22656.1"
FT                   /translation="MEPCRSLALFAGSLGLTSSLIALTTDFWIVATGPHFSAHSGLWPT
FT                   SQETQVAGYIHVTQSFCILAVLWGLVSVSFLVLSCIPALSAPGRGPLVSTVMAFSAGCL
FT                   SLGAHCRTRRAEYETL"
FT   gene            262381..265014
FT                   /locus_tag="mCG_22141"
FT                   /note="gene_id=mCG22141.2"
FT   mRNA            join(262381..262485,263234..263415,263767..263907,
FT                   264452..264571,264818..265014)
FT                   /locus_tag="mCG_22141"
FT                   /product="mCG22141"
FT                   /note="gene_id=mCG22141.2 transcript_id=mCT23898.3 created
FT                   on 18-MAR-2003"
FT   CDS             join(263247..263415,263767..263907,264452..264571,
FT                   264818..264891)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22141"
FT                   /product="mCG22141"
FT                   /note="gene_id=mCG22141.2 transcript_id=mCT23898.3
FT                   protein_id=mCP7737.2"
FT                   /db_xref="GOA:A1A539"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="MGI:MGI:1921526"
FT                   /db_xref="UniProtKB/TrEMBL:A1A539"
FT                   /protein_id="EDL22658.1"
FT                   /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQEC
FT                   THGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSG
FT                   LLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGF
FT                   PVCL"
FT   gene            265694..281333
FT                   /gene="Etfb"
FT                   /locus_tag="mCG_22142"
FT                   /note="gene_id=mCG22142.2"
FT   mRNA            join(265694..265805,275716..275891,276174..276342,
FT                   277903..277965,279864..280022,280955..281333)
FT                   /gene="Etfb"
FT                   /locus_tag="mCG_22142"
FT                   /product="electron transferring flavoprotein, beta
FT                   polypeptide, transcript variant mCT23899"
FT                   /note="gene_id=mCG22142.2 transcript_id=mCT23899.2 created
FT                   on 18-MAR-2003"
FT   mRNA            join(<265730..265805,275716..275874,276174..276342,
FT                   277903..277965,279864..280022,280955..281164)
FT                   /gene="Etfb"
FT                   /locus_tag="mCG_22142"
FT                   /product="electron transferring flavoprotein, beta
FT                   polypeptide, transcript variant mCT191734"
FT                   /note="gene_id=mCG22142.2 transcript_id=mCT191734.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(265749..265805,275716..275891,276174..276342,
FT                   277903..277965,279864..280022,280955..281125)
FT                   /codon_start=1
FT                   /gene="Etfb"
FT                   /locus_tag="mCG_22142"
FT                   /product="electron transferring flavoprotein, beta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG22142.2 transcript_id=mCT23899.2
FT                   protein_id=mCP7738.2 isoform=CRA_b"
FT                   /protein_id="EDL22660.1"
FT                   /translation="MAELRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIA
FT                   VEEAVRLKEKKLVKEIIAVSCGPSQCQVLRDPERPIRQTCFWGPWSADRGIHVEIPGAQ
FT                   AESLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVT
FT                   LEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVVKAGD
FT                   LGVDLTSKVSVISVEEPPQRSAGVKVETTEDLVAKLKEVGRI"
FT   assembly_gap    269827..271675
FT                   /estimated_length=1849
FT                   /gap_type="unknown"
FT   CDS             join(<275834..275874,276174..276342,277903..277965,
FT                   279864..280022,280955..281125)
FT                   /codon_start=1
FT                   /gene="Etfb"
FT                   /locus_tag="mCG_22142"
FT                   /product="electron transferring flavoprotein, beta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG22142.2 transcript_id=mCT191734.0
FT                   protein_id=mCP112713.0 isoform=CRA_a"
FT                   /protein_id="EDL22659.1"
FT                   /translation="RRSLPSAVAPHSARRPIRQTCFWGPWSADRGIHVEIPGAQAESLG
FT                   PLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDK
FT                   VKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVVKAGDLGVDL
FT                   TSKVSVISVEEPPQRSAGVKVETTEDLVAKLKEVGRI"
FT   gene            <287323..295546
FT                   /locus_tag="mCG_22135"
FT                   /note="gene_id=mCG22135.2"
FT   mRNA            join(<287323..287529,288160..288453,288575..288859,
FT                   289720..289974,290793..291071,294167..295546)
FT                   /locus_tag="mCG_22135"
FT                   /product="mCG22135"
FT                   /note="gene_id=mCG22135.2 transcript_id=mCT23891.2 created
FT                   on 30-MAY-2002"
FT   CDS             join(<287325..287529,288160..288453,288575..288859,
FT                   289720..289974,290793..291071,294167..294411)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22135"
FT                   /product="mCG22135"
FT                   /note="gene_id=mCG22135.2 transcript_id=mCT23891.2
FT                   protein_id=mCP7742.1"
FT                   /protein_id="EDL22661.1"
FT                   /translation="KVLAAGGLGSQAPLISLDPMHQARLRFDQIRGGLELTSARLDDAG
FT                   VYTVEVIRGGVSQQIREFVVGVFEPLPQLSVQPRAPETEEGAAELRLSCVGWNPGSGKL
FT                   SWSRDGRALGTSDPEGAEPPRIRTERDQLLISRPVRSDHARYTCQVRSPFGHTEAAADV
FT                   SVFYGPDAPVIRVSSDRDASPALYVTAGSNVTLHCSAPSRPPADIAWSLADPTEAAVPA
FT                   GPRLLLPAVGPGHGGAYACIAANPRTGHRRRSVFNLTVADLPPGAPQCSVEGGPVDRSL
FT                   RFRCSWPGGVPAASLQFQGLPEGVRAGPVPSTLLVTVPARPELSGVAVTCLARHLVATR
FT                   TCTIIPEAPQEVLLQPIVEETQPGDVVVALEVTGCPPPSRASWARQGRPLAPGGGGRLQ
FT                   LSQDGRKLLINNFSLDWDLGNYSVLCSSALGAGGNQITLTGHQPQSNSLSRWQPMDCSG
FT                   SHPGVTKASGPLSMKCSEYNILLWSSSMELRMPEDWTLRVRLPVSHLSQKTQTVLLHLR
FT                   APM"
FT   gene            complement(299007..303948)
FT                   /locus_tag="mCG_22137"
FT                   /note="gene_id=mCG22137.2"
FT   mRNA            complement(join(299007..299406,299902..300022,
FT                   300195..300329,301477..301596,302364..302596,
FT                   303846..303948))
FT                   /locus_tag="mCG_22137"
FT                   /product="mCG22137"
FT                   /note="gene_id=mCG22137.2 transcript_id=mCT23893.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(299214..299406,299902..299948))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22137"
FT                   /product="mCG22137"
FT                   /note="gene_id=mCG22137.2 transcript_id=mCT23893.1
FT                   protein_id=mCP7747.1"
FT                   /protein_id="EDL22662.1"
FT                   /translation="MAVPPADFQWYKDDRLLSSGSAEGLKVQTERTRSMLLFANVSARH
FT                   YGNYTCRAANRLGASSASMRLLRASAPGGGVGHG"
FT   assembly_gap    303405..303426
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    313318..313570
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   gene            complement(318238..>329601)
FT                   /gene="4931406B18Rik"
FT                   /locus_tag="mCG_22136"
FT                   /note="gene_id=mCG22136.1"
FT   mRNA            complement(join(318238..318681,318950..319375,
FT                   321462..321564,321704..321985,322826..323107,
FT                   324669..324959,327852..327953,328960..>329601))
FT                   /gene="4931406B18Rik"
FT                   /locus_tag="mCG_22136"
FT                   /product="RIKEN cDNA 4931406B18"
FT                   /note="gene_id=mCG22136.1 transcript_id=mCT23892.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(319270..319375,321462..321564,
FT                   321704..321985,322826..323107,324669..324959,
FT                   327852..327953,328960..>328963))
FT                   /codon_start=1
FT                   /gene="4931406B18Rik"
FT                   /locus_tag="mCG_22136"
FT                   /product="RIKEN cDNA 4931406B18"
FT                   /note="gene_id=mCG22136.1 transcript_id=mCT23892.1
FT                   protein_id=mCP7724.1"
FT                   /protein_id="EDL22663.1"
FT                   /translation="AGHSVRDQSQQQEPSLFSLVLEMRWGLTSLLLLYLGLLSPVLVDV
FT                   KKTAMEDGLCSMVPCVIEFYKAPFRNPMAVSYRLNENISFRVGTSHPSAPMGDLSTEEV
FT                   EYCILMTHSMLRRKYMTNSLYVGLGTQKDLTQNPELHIPESSVAGEPVTLSCTIQSTCQ
FT                   EPNALFLSWKGPIMSSNTTISIHPSSALAIELKPEDQGTTLRCHLKLSLDNLSSSKVVK
FT                   LQLVSPTRLLNYSCLLKRTLTCSCSFHGIPTPLVQWWVGGTPVSVNRIDGILHLTTTTL
FT                   EPWTNSTIHLIWEPEIIRRLRCEGKNQYGVHASRIFLIPDKSSVSSVFLRGLIQGIVYG
FT                   AIASALFLFFLVVLVMKMLNWWEENQTCKNKEAPTPVKPVLGGANAAEV"
FT   assembly_gap    333569..333765
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    343453..343498
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            complement(351772..>356879)
FT                   /gene="Cd33"
FT                   /locus_tag="mCG_22140"
FT                   /note="gene_id=mCG22140.1"
FT   mRNA            complement(join(351772..352785,353643..353709,
FT                   353989..354082,355815..356093,356379..356759,
FT                   356835..>356879))
FT                   /gene="Cd33"
FT                   /locus_tag="mCG_22140"
FT                   /product="CD33 antigen"
FT                   /note="gene_id=mCG22140.1 transcript_id=mCT23897.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(352639..352785,353643..353709,
FT                   353989..354082,355815..356093,356379..356759,
FT                   356835..>356877))
FT                   /codon_start=1
FT                   /gene="Cd33"
FT                   /locus_tag="mCG_22140"
FT                   /product="CD33 antigen"
FT                   /note="gene_id=mCG22140.1 transcript_id=mCT23897.1
FT                   protein_id=mCP7730.0"
FT                   /protein_id="EDL22664.1"
FT                   /translation="CAMLWPLPLFLLCAGSLAQDLEFQLVAPESVTVEEGLCVHVPCSV
FT                   FYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSL
FT                   FIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNL
FT                   TCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAG
FT                   VTVERTIQLNVTRKSGQMRELVLVAVGEATVKLLILGLCLVFLIVMFCRRKTTKLSVHM
FT                   GCENPIKAHQQDSKVHSNPENPRPLQKDSPQEQSSVHTKISLDFMGGKPQEYSEI"
FT   assembly_gap    373269..373288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    376339..376358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    384390..384409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    385519..387535
FT                   /estimated_length=2017
FT                   /gap_type="unknown"
FT   gene            392186..394017
FT                   /locus_tag="mCG_147784"
FT                   /note="gene_id=mCG147784.0"
FT   mRNA            392186..394017
FT                   /locus_tag="mCG_147784"
FT                   /product="mCG147784"
FT                   /note="gene_id=mCG147784.0 transcript_id=mCT188047.0
FT                   created on 13-JAN-2004"
FT   CDS             392396..393523
FT                   /codon_start=1
FT                   /locus_tag="mCG_147784"
FT                   /product="mCG147784"
FT                   /note="gene_id=mCG147784.0 transcript_id=mCT188047.0
FT                   protein_id=mCP109094.0"
FT                   /protein_id="EDL22665.1"
FT                   /translation="MHRRVHTGEKPYKCRDCGKSFTYSFTLNVHRRIHKVEKPHKCSIC
FT                   GKALASKYQLEEHERIHTGEKPYVCTECGKGFHGRSGFLRHQITHTRDKPFVCHKCGKA
FT                   FFQRSQLTSHQQTHTGEKPYTCHYCGKSFSHTSQLTVHHRIHTGERPYKCDYCAKSFSN
FT                   SSQLKEHLRIHTGETPYACSECGKAFSRRSSLNLHTKIHTGEKHHICSECGKAFSQKSV
FT                   LRTHQRIHTGEKPYKCSDCGKALASKGQLRDHQRIHTGEKPYMCPECGKGFFGRSSLHR
FT                   HQITHTKERPFVCQKCGKTFIQKSALTSHQQIHTGEKPYVCPECGKGFYNKSSLPRHQM
FT                   THTRGRSFVCQKCGKAFLQKSVLKCHQRTHTCKKP"
FT   gene            398176..>409754
FT                   /locus_tag="mCG_133316"
FT                   /note="gene_id=mCG133316.1"
FT   mRNA            join(398176..398323,404911..405037,407812..>409754)
FT                   /locus_tag="mCG_133316"
FT                   /product="mCG133316, transcript variant mCT175253"
FT                   /note="gene_id=mCG133316.1 transcript_id=mCT175253.0
FT                   created on 18-MAR-2003"
FT   mRNA            join(398193..398323,402625..402853,404911..405037,
FT                   407812..407984,408012..>409754)
FT                   /locus_tag="mCG_133316"
FT                   /product="mCG133316, transcript variant mCT134681"
FT                   /note="gene_id=mCG133316.1 transcript_id=mCT134681.2
FT                   created on 18-MAR-2003"
FT   CDS             join(402716..402853,404911..405037,407812..407984,
FT                   408012..409754)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133316"
FT                   /product="mCG133316, isoform CRA_a"
FT                   /note="gene_id=mCG133316.1 transcript_id=mCT134681.2
FT                   protein_id=mCP63576.2 isoform=CRA_a"
FT                   /protein_id="EDL22666.1"
FT                   /translation="MLTYLQNPEKIRERPRVETTEDMPTDMNFCQMPQQLGAEEQDGLC
FT                   ERLVSFDDVTVDFSQEEWQHLDSAQRRLYQDVMLEIYSHLLSVGKLQLDTQHQQIFVKA
FT                   SFLSDAASEVTKHGSIYCSVLEKLWQEGDPAAKTDQQSRVLPKILTIGSAWDYEETEES
FT                   TLLEPHLISTQYVPPRANSDSQSNTIKQLNDIIGSDQFFTQASSNGVCTVPHQTEKPYT
FT                   ESQFGNIVSLNPPLMDHEINFQDKPVEYTGCGKVFTGETAFCQQQITNSMETSFICHTC
FT                   GKTFLHKSKLTSHSETPREETPYECPDCAKSLRGTTSLQVLRGVQTKEKPYECHVCGKS
FT                   FSYTSHLKVHLRTHTGEKPYACSDCGKAFSQKSVLTIHQRIHTGEKPYTCSDCGKMFVC
FT                   ASDLTKHCRFHTGEKPYECPDCGKSFSIKSNLLAHHRIHTSEGPYKCFHCGESFRKISQ
FT                   LKVHHQIHTDRRSFVCSDCGMAFSQKSVLTTHQRIHSGEKCYPCSDCGKLFLYASDLKK
FT                   HCRFHTGEKPYKCHDCGKSYSVKSHLHVHHRIHTGERPYKCDDCGKSFRRNSHLQMHQQ
FT                   THTGEKPYKCSDCGKSFRRASHLKVHHRIHTGEKPFVCSECGKAFNDRSVLSTHQRIHT
FT                   GEKPYICSDCGKAMSSKANLKEHQRIHTGEKPYVCAECGKAFSDKSSFYRHCKIHSRGK
FT                   PFVRNKGEKGFLQNSQVTSMTSYEQTQNAEKL"
FT   CDS             join(405004..405037,407812..409754)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133316"
FT                   /product="mCG133316, isoform CRA_b"
FT                   /note="gene_id=mCG133316.1 transcript_id=mCT175253.0
FT                   protein_id=mCP98172.0 isoform=CRA_b"
FT                   /protein_id="EDL22667.1"
FT                   /translation="MLEIYSHLLSVGKLQLDTQHQQIFVKASFLSDAASEVTKHGSIYC
FT                   SVLEKLWQEGDPAAKTDQQSRVLPVSPGAFQNQKILTIGSAWDYEETEESTLLEPHLIS
FT                   TQYVPPRANSDSQSNTIKQLNDIIGSDQFFTQASSNGVCTVPHQTEKPYTESQFGNIVS
FT                   LNPPLMDHEINFQDKPVEYTGCGKVFTGETAFCQQQITNSMETSFICHTCGKTFLHKSK
FT                   LTSHSETPREETPYECPDCAKSLRGTTSLQVLRGVQTKEKPYECHVCGKSFSYTSHLKV
FT                   HLRTHTGEKPYACSDCGKAFSQKSVLTIHQRIHTGEKPYTCSDCGKMFVCASDLTKHCR
FT                   FHTGEKPYECPDCGKSFSIKSNLLAHHRIHTSEGPYKCFHCGESFRKISQLKVHHQIHT
FT                   DRRSFVCSDCGMAFSQKSVLTTHQRIHSGEKCYPCSDCGKLFLYASDLKKHCRFHTGEK
FT                   PYKCHDCGKSYSVKSHLHVHHRIHTGERPYKCDDCGKSFRRNSHLQMHQQTHTGEKPYK
FT                   CSDCGKSFRRASHLKVHHRIHTGEKPFVCSECGKAFNDRSVLSTHQRIHTGEKPYICSD
FT                   CGKAMSSKANLKEHQRIHTGEKPYVCAECGKAFSDKSSFYRHCKIHSRGKPFVRNKGEK
FT                   GFLQNSQVTSMTSYEQTQNAEKL"
FT   assembly_gap    421787..421806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            426202..437311
FT                   /gene="4933405K07Rik"
FT                   /locus_tag="mCG_133317"
FT                   /note="gene_id=mCG133317.0"
FT   mRNA            join(426202..426308,428819..429011,431016..431142,
FT                   431580..431672,435420..437311)
FT                   /gene="4933405K07Rik"
FT                   /locus_tag="mCG_133317"
FT                   /product="RIKEN cDNA 4933405K07, transcript variant
FT                   mCT134682"
FT                   /note="gene_id=mCG133317.0 transcript_id=mCT134682.0
FT                   created on 18-MAR-2003"
FT   mRNA            join(<426203..426308,431016..431142,431580..431672,
FT                   435420..437249)
FT                   /gene="4933405K07Rik"
FT                   /locus_tag="mCG_133317"
FT                   /product="RIKEN cDNA 4933405K07, transcript variant
FT                   mCT191747"
FT                   /note="gene_id=mCG133317.0 transcript_id=mCT191747.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<426303..426308,431016..431142,431580..431672,
FT                   435420..436951)
FT                   /codon_start=1
FT                   /gene="4933405K07Rik"
FT                   /locus_tag="mCG_133317"
FT                   /product="RIKEN cDNA 4933405K07, isoform CRA_a"
FT                   /note="gene_id=mCG133317.0 transcript_id=mCT191747.0
FT                   protein_id=mCP112694.0 isoform=CRA_a"
FT                   /protein_id="EDL22668.1"
FT                   /translation="ALRLVSFEDVTVNFSQEEWQHLDSAQRRLYQDVLLEIYSHLLAVG
FT                   YSRPEVILKMKKVKDSPMGKVDFPHQRCGQGEAEHDSHQMCVKAAFPNDVSRVITTGGS
FT                   YCSIIEEPWQGGDPKTSDPQNHIPPSSSGAFFSQKTLITDGREAAGGSIPLGAHVISTQ
FT                   KRSLRCCPCEKTLQPHLQADRDHQSSATEQPDGIVDSCQSFTQGLPTAVCPIHSTGEEA
FT                   RRGDQCASVPSPQQPFMQHGTLSQDKPVEYTKYEKVFTAGSALCQQQTTNPLETHFICH
FT                   ICGKSFLQKSELSFHPGTDRGETHHGCPGCRKSLPSTSSLQARHGTHTKEKPYRCPDCG
FT                   KSFSYASHLKIHLRIHTGERPYVCSDCGKAFSQKSVLTTHRRIHTGERPYTCNHCGKLF
FT                   VYASDLKKHSRFHTGEKPYECRDCGKLFNNKSHLPVHYRIHTGEKPYRCCDCGKSFRRK
FT                   SHLKVHSRTHTGEKPYECPDCGRAFSHSSVLSTHQRIHTGERPYLCSDCGKAMSSKAQL
FT                   NEHRRIHTGEKPYVCSECGKAFSCRSSLQAHRRTHSREKPFVCHTCGKGFLHKSQLSSH
FT                   QQTHTGENP"
FT   CDS             join(428940..429011,431016..431142,431580..431672,
FT                   435420..436951)
FT                   /codon_start=1
FT                   /gene="4933405K07Rik"
FT                   /locus_tag="mCG_133317"
FT                   /product="RIKEN cDNA 4933405K07, isoform CRA_b"
FT                   /note="gene_id=mCG133317.0 transcript_id=mCT134682.0
FT                   protein_id=mCP63580.1 isoform=CRA_b"
FT                   /protein_id="EDL22669.1"
FT                   /translation="MAADMNFCQKLQRLGTEEQDGPCERLVSFEDVTVNFSQEEWQHLD
FT                   SAQRRLYQDVLLEIYSHLLAVGYSRPEVILKMKKVKDSPMGKVDFPHQRCGQGEAEHDS
FT                   HQMCVKAAFPNDVSRVITTGGSYCSIIEEPWQGGDPKTSDPQNHIPPSSSGAFFSQKTL
FT                   ITDGREAAGGSIPLGAHVISTQKRSLRCCPCEKTLQPHLQADRDHQSSATEQPDGIVDS
FT                   CQSFTQGLPTAVCPIHSTGEEARRGDQCASVPSPQQPFMQHGTLSQDKPVEYTKYEKVF
FT                   TAGSALCQQQTTNPLETHFICHICGKSFLQKSELSFHPGTDRGETHHGCPGCRKSLPST
FT                   SSLQARHGTHTKEKPYRCPDCGKSFSYASHLKIHLRIHTGERPYVCSDCGKAFSQKSVL
FT                   TTHRRIHTGERPYTCNHCGKLFVYASDLKKHSRFHTGEKPYECRDCGKLFNNKSHLPVH
FT                   YRIHTGEKPYRCCDCGKSFRRKSHLKVHSRTHTGEKPYECPDCGRAFSHSSVLSTHQRI
FT                   HTGERPYLCSDCGKAMSSKAQLNEHRRIHTGEKPYVCSECGKAFSCRSSLQAHRRTHSR
FT                   EKPFVCHTCGKGFLHKSQLSSHQQTHTGENP"
FT   gene            453737..468294
FT                   /gene="Ceacam18"
FT                   /locus_tag="mCG_22151"
FT                   /note="gene_id=mCG22151.2"
FT   mRNA            join(453737..453846,455788..456141,458264..458536,
FT                   460847..461122,464506..464643,467509..468294)
FT                   /gene="Ceacam18"
FT                   /locus_tag="mCG_22151"
FT                   /product="CEA-related cell adhesion molecule 1"
FT                   /note="gene_id=mCG22151.2 transcript_id=mCT23908.2 created
FT                   on 17-JUN-2003"
FT   CDS             join(453795..453846,455788..456141,458264..458536,
FT                   460847..461122,464506..464643,467509..467546)
FT                   /codon_start=1
FT                   /gene="Ceacam18"
FT                   /locus_tag="mCG_22151"
FT                   /product="CEA-related cell adhesion molecule 1"
FT                   /note="gene_id=mCG22151.2 transcript_id=mCT23908.2
FT                   protein_id=mCP7746.2"
FT                   /protein_id="EDL22670.1"
FT                   /translation="MDFSRPSFSPWRWLTLVASLLTCGICQASGQIFISPDSLLGVEKY
FT                   RTILTLENVPEDVLEYSWYRGKDNSTENMIFSYKPPNTRHPGPSYSGRENVTRAGSLVV
FT                   RMSAVNDTGYYTVEVDTSNETQRATGWLQIVKLRSNPGISANTSALVEGMDSVVAKCLT
FT                   NSSNISWYVNFVPTSGSNRMTISPDGKTLIIHRVSRYDHTLQCAIEDVPEILQKSELIQ
FT                   LTVAYGPDYVSLWTQPYFFAGVLTADIGSSVQLECNCFSKPEPRYHWIHNGSFLSIPEN
FT                   NMTLPSLSWEQMGSYRCVVENPETQLTFYRDVTIQPPRPPLPTVNRELYIPGPLVIFLI
FT                   LLTSLGGAFVCRVLVYSLFQSCSRGKTCHKCPWQTN"
FT   gene            complement(470125..>479193)
FT                   /gene="Siglece"
FT                   /locus_tag="mCG_22146"
FT                   /note="gene_id=mCG22146.1"
FT   mRNA            complement(join(470125..470742,475140..475221,
FT                   475574..475667,476586..476843,478021..478068,
FT                   478258..478536,478742..>479193))
FT                   /gene="Siglece"
FT                   /locus_tag="mCG_22146"
FT                   /product="sialic acid binding Ig-like lectin E"
FT                   /note="gene_id=mCG22146.1 transcript_id=mCT23903.1 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(470539..470742,475140..475221,
FT                   475574..475667,476586..476843,478021..478068,
FT                   478258..478536,478742..>479186))
FT                   /codon_start=1
FT                   /gene="Siglece"
FT                   /locus_tag="mCG_22146"
FT                   /product="sialic acid binding Ig-like lectin E"
FT                   /note="gene_id=mCG22146.1 transcript_id=mCT23903.1
FT                   protein_id=mCP7736.1"
FT                   /protein_id="EDL22671.1"
FT                   /translation="LDMLLLLLLLLLWGIKGVEGQNPQEVFTLNVERKVVVQEGLCVLV
FT                   PCNFSYLKKRLTDWTDSDPVHGFWYREGTDRRKDSIVATNNPIRKAVKETRNRFFLLGD
FT                   PWRNDCSLNIREIRKKDAGLYFFRLERGKTKYNYMWDKMTLVVTALTNTPQILLPETLE
FT                   AGHPSNLTCSVPWDCGWTAPPIFSWTGTSVSFLSTNTTGSSVLTITPQPQDHGTNLTCQ
FT                   VTLPGTNVSTRMTIRLNVSYAPKNLTVTIYQGADSVSTILKNGSSLPISEGQSLRLICS
FT                   TDSYPPANLSWSWDNLTLCPSKLSKPGLLELFPVHLKHGGVYTCQAQHALGSQHISLSL
FT                   SPQSSATLSEMMMGTFVGSGVTALLFLSVCILLLAVRSYRRKPARPAVVAPHPDALKVS
FT                   VSQNPLVESQADDSSEPLPSILEAAPSSTEEEIHYATLSFHEMKPMNLWGQQDTTTEYS
FT                   EIKFPQRTAWP"
FT   gene            <491065..497343
FT                   /gene="Atpbd3"
FT                   /locus_tag="mCG_22147"
FT                   /note="gene_id=mCG22147.1"
FT   mRNA            join(<491065..491122,494153..494695,495476..497343)
FT                   /gene="Atpbd3"
FT                   /locus_tag="mCG_22147"
FT                   /product="ATP binding domain 3"
FT                   /note="gene_id=mCG22147.1 transcript_id=mCT23906.1 created
FT                   on 30-MAY-2002"
FT   CDS             join(<494158..494695,495476..496230)
FT                   /codon_start=1
FT                   /gene="Atpbd3"
FT                   /locus_tag="mCG_22147"
FT                   /product="ATP binding domain 3"
FT                   /note="gene_id=mCG22147.1 transcript_id=mCT23906.1
FT                   protein_id=mCP7740.0"
FT                   /protein_id="EDL22672.1"
FT                   /translation="TSQTTQFSFKMPAPTCFSCHKTRAALRRPRSGQALCGSCFCAAFE
FT                   AEVLHTVLAGHLLPPGAVVAVGASGGKDSTVLAHVLRELAPRLGITLHLVAVDEGIGGY
FT                   RDAALEAVRSQAARWELPLTIVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRR
FT                   ALEEGARLVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGVLGSTGEGCALPRCRP
FT                   LQFASQKEVVLYAHFRHLRYFSEECVYAPEAFRGHARDLLKLLEAARPSAVLDLVHSAE
FT                   RLALAPAAKPPPPGTCSRCGALASHKLCQACALLDGLNRGLPRLAIGKGRRVLQVEPPQ
FT                   PGNPSLVTSDPVAPAGPCTCKQPKDKANPCGNGGDRAGATCVSQCDLSPGNGEDRAGAT
FT                   CVSQRDLSLGNGGDRAGATCVSQCDLSPVAE"
FT   assembly_gap    501578..501597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    508936..508955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <511047..>547944
FT                   /gene="Klk14"
FT                   /locus_tag="mCG_133331"
FT                   /note="gene_id=mCG133331.0"
FT   mRNA            join(<511047..511226,513047..513300,513426..513562,
FT                   513959..514065,542491..542759,544965..545101,
FT                   547762..>547944)
FT                   /gene="Klk14"
FT                   /locus_tag="mCG_133331"
FT                   /product="kallikrein 14"
FT                   /note="gene_id=mCG133331.0 transcript_id=mCT134696.0
FT                   created on 30-MAY-2002"
FT   CDS             join(<511048..511226,513047..513300,513426..513562,
FT                   513959..514065,542491..542759,544965..545101,
FT                   547762..547944)
FT                   /codon_start=1
FT                   /gene="Klk14"
FT                   /locus_tag="mCG_133331"
FT                   /product="kallikrein 14"
FT                   /note="gene_id=mCG133331.0 transcript_id=mCT134696.0
FT                   protein_id=mCP63506.0"
FT                   /protein_id="EDL22673.1"
FT                   /translation="LPVAIAQSQGDHKIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVL
FT                   LSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLL
FT                   KLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQA
FT                   CHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGV
FT                   YANLGYTVHLGKHALGRVENGEQAMEVVRSIPHPEYQVTPTHLNHDHDIMLLELKSPVQ
FT                   LSSHVRTLKLSADDCLPTGTCCRVSGWGTTTSPQVNYPKTLQCANIELRSDEECRQVYP
FT                   GKITANMLCAGTKEGGKDSCEGDSGGPLICNGKLYGIISWGDFPCGQPNRPGVYTRVSK
FT                   YLRWIREIIRNTPEQRWTKGTQ"
FT   assembly_gap    515574..516881
FT                   /estimated_length=1308
FT                   /gap_type="unknown"
FT   assembly_gap    529901..530138
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   gene            complement(568849..>577760)
FT                   /locus_tag="mCG_1048654"
FT                   /note="gene_id=mCG1048654.0"
FT   mRNA            complement(join(568849..569612,570473..570612,
FT                   577670..>577760))
FT                   /locus_tag="mCG_1048654"
FT                   /product="mCG1048654"
FT                   /note="gene_id=mCG1048654.0 transcript_id=mCT166358.0
FT                   created on 30-MAY-2002"
FT   CDS             complement(join(569452..569612,570473..>570590))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048654"
FT                   /product="mCG1048654"
FT                   /note="gene_id=mCG1048654.0 transcript_id=mCT166358.0
FT                   protein_id=mCP63656.0"
FT                   /protein_id="EDL22674.1"
FT                   /translation="IEEVLGILLFPPLQPWDYRCTTMPCFSYGFWGWNSVSTHRRIWAA
FT                   TSYLPKSPAVTHSCWFWPWNLGDTGIMAIKSIRATATIIIMMTASTY"
FT   assembly_gap    580527..580701
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    587607..587739
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   gene            <591249..595178
FT                   /locus_tag="mCG_144712"
FT                   /note="gene_id=mCG144712.0"
FT   mRNA            join(<591249..591407,592434..592690,593576..593709,
FT                   594840..595178)
FT                   /locus_tag="mCG_144712"
FT                   /product="mCG144712"
FT                   /note="gene_id=mCG144712.0 transcript_id=mCT184136.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<591250..591407,592434..592690,593576..593709,
FT                   594840..594995)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144712"
FT                   /product="mCG144712"
FT                   /note="gene_id=mCG144712.0 transcript_id=mCT184136.0
FT                   protein_id=mCP105451.0"
FT                   /db_xref="GOA:Q9CV76"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1916761"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CV76"
FT                   /protein_id="EDL22675.1"
FT                   /translation="LSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVL
FT                   TAAHCRDKYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPI
FT                   HLTRAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFP
FT                   GRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCK
FT                   YTDWIRIVIRNN"
FT   gene            596217..600874
FT                   /gene="Klk11"
FT                   /locus_tag="mCG_22149"
FT                   /note="gene_id=mCG22149.2"
FT   mRNA            join(596217..596402,598097..598171,598498..598654,
FT                   599105..599370,599937..600073,600394..600872)
FT                   /gene="Klk11"
FT                   /locus_tag="mCG_22149"
FT                   /product="kallikrein 11, transcript variant mCT173431"
FT                   /note="gene_id=mCG22149.2 transcript_id=mCT173431.0 created
FT                   on 19-SEP-2002"
FT   assembly_gap    597258..597277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(597920..597954,598097..598171,598498..598654,
FT                   599105..599370,599937..600073,600394..600874)
FT                   /gene="Klk11"
FT                   /locus_tag="mCG_22149"
FT                   /product="kallikrein 11, transcript variant mCT23907"
FT                   /note="gene_id=mCG22149.2 transcript_id=mCT23907.1 created
FT                   on 19-SEP-2002"
FT   CDS             join(598135..598171,598498..598654,599105..599370,
FT                   599937..600073,600394..600546)
FT                   /codon_start=1
FT                   /gene="Klk11"
FT                   /locus_tag="mCG_22149"
FT                   /product="kallikrein 11, isoform CRA_a"
FT                   /note="gene_id=mCG22149.2 transcript_id=mCT173431.0
FT                   protein_id=mCP96350.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A1R3UCI4"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1929977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R3UCI4"
FT                   /protein_id="EDL22676.1"
FT                   /translation="MILRLIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLL
FT                   CGATLIAPKWLLTAAHCRKPHYVILLGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNK
FT                   DHRNDIMLVKMSSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTTSSPQLRLPHSLRCA
FT                   NVSIIEHKECEKAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDP
FT                   CAVTRKPGVYTKVCKYFNWIHEVMRNN"
FT   CDS             join(598135..598171,598498..598654,599105..599370,
FT                   599937..600073,600394..600546)
FT                   /codon_start=1
FT                   /gene="Klk11"
FT                   /locus_tag="mCG_22149"
FT                   /product="kallikrein 11, isoform CRA_a"
FT                   /note="gene_id=mCG22149.2 transcript_id=mCT23907.1
FT                   protein_id=mCP7741.1 isoform=CRA_a"
FT                   /db_xref="GOA:A0A1R3UCI4"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1929977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R3UCI4"
FT                   /protein_id="EDL22677.1"
FT                   /translation="MILRLIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLL
FT                   CGATLIAPKWLLTAAHCRKPHYVILLGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNK
FT                   DHRNDIMLVKMSSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTTSSPQLRLPHSLRCA
FT                   NVSIIEHKECEKAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDP
FT                   CAVTRKPGVYTKVCKYFNWIHEVMRNN"
FT   gene            602648..607025
FT                   /gene="Klk10"
FT                   /locus_tag="mCG_22144"
FT                   /note="gene_id=mCG22144.1"
FT   mRNA            join(602648..602760,603113..603239,604350..604533,
FT                   605071..605306,605931..606064,606485..607025)
FT                   /gene="Klk10"
FT                   /locus_tag="mCG_22144"
FT                   /product="kallikrein 10, transcript variant mCT23901"
FT                   /note="gene_id=mCG22144.1 transcript_id=mCT23901.1 created
FT                   on 19-MAR-2003"
FT   mRNA            join(<602693..602760,603113..603239,604350..604533,
FT                   605071..605345,605931..606064,606485..607024)
FT                   /gene="Klk10"
FT                   /locus_tag="mCG_22144"
FT                   /product="kallikrein 10, transcript variant mCT191737"
FT                   /note="gene_id=mCG22144.1 transcript_id=mCT191737.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<602731..602760,603113..603239,604350..604533,
FT                   605071..605345,605931..606064,606485..606637)
FT                   /codon_start=1
FT                   /gene="Klk10"
FT                   /locus_tag="mCG_22144"
FT                   /product="kallikrein 10, isoform CRA_a"
FT                   /note="gene_id=mCG22144.1 transcript_id=mCT191737.0
FT                   protein_id=mCP112714.0 isoform=CRA_a"
FT                   /protein_id="EDL22678.1"
FT                   /translation="VSFLLTGDSQASTPASASQVSAMRVPLLHLSTASGSWSLVKLLLP
FT                   LLMVQLWAAQALLLPGNATRVDLEASGAQCERDYHPWQVSLFHNLQFQCAGVLVDQNWV
FT                   LTAAHCWRNKPLRARVGDDHLLLFQKEQLRSTSSPVFHPKYQACSGPILPHRSDEHDLM
FT                   MLKLSSPVMLTSNVHPVQLPFRCSQPGQECQVSGWGTSASRRVKYNRSLSCSKVTLLSQ
FT                   KQCETFYPGVITNSMICAEADGNQDSCQSDSGGPLVCDDTLHGVLSWGIYPCGAAQHPS
FT                   VYSEICKYTPWIRRVIRFK"
FT   CDS             join(603149..603239,604350..604533,605071..605306,
FT                   605931..606064,606485..606637)
FT                   /codon_start=1
FT                   /gene="Klk10"
FT                   /locus_tag="mCG_22144"
FT                   /product="kallikrein 10, isoform CRA_b"
FT                   /note="gene_id=mCG22144.1 transcript_id=mCT23901.1
FT                   protein_id=mCP7727.2 isoform=CRA_b"
FT                   /protein_id="EDL22679.1"
FT                   /translation="MRVPLLHLSTASGSWSLVKLLLPLLMVQLWAAQALLLPGNATRVD
FT                   LEASGAQCERDYHPWQVSLFHNLQFQCAGVLVDQNWVLTAAHCWRNKPLRARVGDDHLL
FT                   LFQKEQLRSTSSPVFHPKYQACSGPILPHRSDEHDLMMLKLSSPVMLTSNVHPVQLPFR
FT                   CSQPGQELKYNRSLSCSKVTLLSQKQCETFYPGVITNSMICAEADGNQDSCQSDSGGPL
FT                   VCDDTLHGVLSWGIYPCGAAQHPSVYSEICKYTPWIRRVIRFK"
FT   gene            613546..617985
FT                   /gene="Klk9"
FT                   /locus_tag="mCG_1051030"
FT                   /note="gene_id=mCG1051030.0"
FT   mRNA            join(613546..613627,613767..613923,615851..616116,
FT                   617139..617275,617578..617985)
FT                   /gene="Klk9"
FT                   /locus_tag="mCG_1051030"
FT                   /product="kallikrein 9"
FT                   /note="gene_id=mCG1051030.0 transcript_id=mCT194819.0
FT                   created on 27-JAN-2005"
FT   CDS             join(613585..613627,613767..613923,615851..616116,
FT                   617139..617275,617578..617730)
FT                   /codon_start=1
FT                   /gene="Klk9"
FT                   /locus_tag="mCG_1051030"
FT                   /product="kallikrein 9"
FT                   /note="gene_id=mCG1051030.0 transcript_id=mCT194819.0
FT                   protein_id=mCP115847.0"
FT                   /db_xref="GOA:Q32M27"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1921082"
FT                   /db_xref="UniProtKB/TrEMBL:Q32M27"
FT                   /protein_id="EDL22680.1"
FT                   /translation="MKLGLTLVLFSLLAGHCGADTRAVGARECVRNSQPWQAGLFYLTR
FT                   QLCGATLINDQWLLTAAHCRKPYLWVRLGEHHLWRWEGPEQLLLVTDFFPHPGFNPDLS
FT                   ANDHNDDIMLIRLPRKVRLTPAVQPLNLTESRPPVGTQCLISGWGSVSSSKLQYPMTLQ
FT                   CANISILDNKLCRWAYPGHISEKMLCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGS
FT                   EPCSRPRRPAVYTNVFDYLEWIESTMEKN"
FT   gene            <619163..625407
FT                   /gene="Klk8"
FT                   /locus_tag="mCG_22150"
FT                   /note="gene_id=mCG22150.1"
FT   mRNA            join(<619163..619718,620209..620368,620650..620912,
FT                   623665..623798,625199..625407)
FT                   /gene="Klk8"
FT                   /locus_tag="mCG_22150"
FT                   /product="kallikrein 8"
FT                   /note="gene_id=mCG22150.1 transcript_id=mCT23905.1 created
FT                   on 31-MAY-2002"
FT   CDS             join(<619493..619718,620209..620368,620650..620912,
FT                   623665..623798,625199..625354)
FT                   /codon_start=1
FT                   /gene="Klk8"
FT                   /locus_tag="mCG_22150"
FT                   /product="kallikrein 8"
FT                   /note="gene_id=mCG22150.1 transcript_id=mCT23905.1
FT                   protein_id=mCP7745.1"
FT                   /protein_id="EDL22681.1"
FT                   /translation="SSALAFSAPSSILQQDSRQLRKHLLPPVPQTTRSQAPPSDFLLVP
FT                   PSSSEATMGRPPPCAIQPWILLLLFMGAWAGLTRAQGSKILEGRECIPHSQPWQAALFQ
FT                   GERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNN
FT                   SNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNT
FT                   LNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWG
FT                   SDPCGKPEKPGVYTKICRYTTWIKKTMDNRD"
FT   gene            632844..637852
FT                   /gene="Klk7"
FT                   /locus_tag="mCG_133321"
FT                   /note="gene_id=mCG133321.1"
FT   mRNA            join(632844..633044,633476..633580,633913..634054,
FT                   634368..634615,634803..634939,636803..637852)
FT                   /gene="Klk7"
FT                   /locus_tag="mCG_133321"
FT                   /product="kallikrein 7 (chymotryptic, stratum corneum)"
FT                   /note="gene_id=mCG133321.1 transcript_id=mCT134686.1
FT                   created on 20-SEP-2002"
FT   CDS             join(633514..633580,633913..634054,634368..634615,
FT                   634803..634939,636803..636958)
FT                   /codon_start=1
FT                   /gene="Klk7"
FT                   /locus_tag="mCG_133321"
FT                   /product="kallikrein 7 (chymotryptic, stratum corneum)"
FT                   /note="gene_id=mCG133321.1 transcript_id=mCT134686.1
FT                   protein_id=mCP63680.1"
FT                   /db_xref="GOA:A0A0B6VPC4"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1346336"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B6VPC4"
FT                   /protein_id="EDL22682.1"
FT                   /translation="MGVWLLSLITVLLSLALETAGQGERIIDGYKCKEGSHPWQVALLK
FT                   GNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKT
FT                   HVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSD
FT                   VKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPC
FT                   GQPNDPGVYTQVCKYKRWVMETMKTHR"
FT   assembly_gap    641470..641489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    646813..647852
FT                   /estimated_length=1040
FT                   /gap_type="unknown"
FT   gene            648174..655402
FT                   /gene="Klk6"
FT                   /locus_tag="mCG_133315"
FT                   /note="gene_id=mCG133315.1"
FT   mRNA            join(648174..648209,649128..649283,649675..649735,
FT                   650417..650573,652039..652286,652752..652888,
FT                   655105..655402)
FT                   /gene="Klk6"
FT                   /locus_tag="mCG_133315"
FT                   /product="kallikrein 6, transcript variant mCT134680"
FT                   /note="gene_id=mCG133315.1 transcript_id=mCT134680.1
FT                   created on 20-SEP-2002"
FT   mRNA            join(<648175..648213,649128..649283,649675..649735,
FT                   650417..650573,652039..652286,652752..652888,
FT                   655105..655402)
FT                   /gene="Klk6"
FT                   /locus_tag="mCG_133315"
FT                   /product="kallikrein 6, transcript variant mCT191746"
FT                   /note="gene_id=mCG133315.1 transcript_id=mCT191746.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<649068..649283,649675..649735,650417..650573,
FT                   652039..652286,652752..652888,655105..655402)
FT                   /gene="Klk6"
FT                   /locus_tag="mCG_133315"
FT                   /product="kallikrein 6, transcript variant mCT191745"
FT                   /note="gene_id=mCG133315.1 transcript_id=mCT191745.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<649227..649283,649675..649735,650417..650573,
FT                   652039..652286,652752..652888,655105..655263)
FT                   /codon_start=1
FT                   /gene="Klk6"
FT                   /locus_tag="mCG_133315"
FT                   /product="kallikrein 6, isoform CRA_b"
FT                   /note="gene_id=mCG133315.1 transcript_id=mCT191745.0
FT                   protein_id=mCP112692.0 isoform=CRA_b"
FT                   /protein_id="EDL22684.1"
FT                   /translation="VVSFPSNLSAGRYTAGHQQMPMKMLTMKMLALCLVLAKSAWSEEQ
FT                   EKVVHGGPCLKDSHPFQAALYTSGHLLCGGVLIDPQWVLTAAHCKKPNLQVILGKHNLR
FT                   QTETFQRQISVDRTIVHPRYNPETHDNDIMMVHLKNPVKFSKKIQPLPLKNDCSEENPN
FT                   CQILGWGKMENGDFPDTIQCADVHLVPREQCERAYPGKITQSMVCAGDMKEGNDSCQGD
FT                   SGGPLVCGGRLRGLVSWGDMPCGSKEKPGVYTDVCTHIRWIQNILRNKWL"
FT   CDS             join(<649227..649283,649675..649735,650417..650573,
FT                   652039..652286,652752..652888,655105..655263)
FT                   /codon_start=1
FT                   /gene="Klk6"
FT                   /locus_tag="mCG_133315"
FT                   /product="kallikrein 6, isoform CRA_b"
FT                   /note="gene_id=mCG133315.1 transcript_id=mCT191746.0
FT                   protein_id=mCP112693.0 isoform=CRA_b"
FT                   /protein_id="EDL22685.1"
FT                   /translation="VVSFPSNLSAGRYTAGHQQMPMKMLTMKMLALCLVLAKSAWSEEQ
FT                   EKVVHGGPCLKDSHPFQAALYTSGHLLCGGVLIDPQWVLTAAHCKKPNLQVILGKHNLR
FT                   QTETFQRQISVDRTIVHPRYNPETHDNDIMMVHLKNPVKFSKKIQPLPLKNDCSEENPN
FT                   CQILGWGKMENGDFPDTIQCADVHLVPREQCERAYPGKITQSMVCAGDMKEGNDSCQGD
FT                   SGGPLVCGGRLRGLVSWGDMPCGSKEKPGVYTDVCTHIRWIQNILRNKWL"
FT   CDS             join(649675..649735,650417..650573,652039..652286,
FT                   652752..652888,655105..655263)
FT                   /codon_start=1
FT                   /gene="Klk6"
FT                   /locus_tag="mCG_133315"
FT                   /product="kallikrein 6, isoform CRA_a"
FT                   /note="gene_id=mCG133315.1 transcript_id=mCT134680.1
FT                   protein_id=mCP63575.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q91Y82"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1343166"
FT                   /db_xref="UniProtKB/TrEMBL:Q91Y82"
FT                   /protein_id="EDL22683.1"
FT                   /translation="MPMKMLTMKMLALCLVLAKSAWSEEQEKVVHGGPCLKDSHPFQAA
FT                   LYTSGHLLCGGVLIDPQWVLTAAHCKKPNLQVILGKHNLRQTETFQRQISVDRTIVHPR
FT                   YNPETHDNDIMMVHLKNPVKFSKKIQPLPLKNDCSEENPNCQILGWGKMENGDFPDTIQ
FT                   CADVHLVPREQCERAYPGKITQSMVCAGDMKEGNDSCQGDSGGPLVCGGRLRGLVSWGD
FT                   MPCGSKEKPGVYTDVCTHIRWIQNILRNKWL"
FT   gene            <665841..675171
FT                   /locus_tag="mCG_145357"
FT                   /note="gene_id=mCG145357.0"
FT   mRNA            join(<665841..665961,668742..669006,670974..671230,
FT                   671431..671564,674709..675171)
FT                   /locus_tag="mCG_145357"
FT                   /product="mCG145357"
FT                   /note="gene_id=mCG145357.0 transcript_id=mCT184781.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<665841..665961,668742..669006,670974..671230,
FT                   671431..671564,674709..674861)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145357"
FT                   /product="mCG145357"
FT                   /note="gene_id=mCG145357.0 transcript_id=mCT184781.0
FT                   protein_id=mCP105460.0"
FT                   /protein_id="EDL22686.1"
FT                   /translation="PEPLSLDLYFLPGAAVMARTGHPWKWAMATLITTLVLGVSEPVLA
FT                   GDVSSCDNPSGTEPSGTNRDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLG
FT                   PNKLYCGAVLISPQWLLTAAHCRKPVFRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYS
FT                   HPGHSNDLMLIKMNRKIRDSHSVKPVEIACDCATEGTRCMVSGWGTTSSSHNNFPKVLQ
FT                   CLNITVLSEERCKNSYPGQIDKTMFCAGDEEGRDSCQGDSGGPVVCNGKLQGLVSWGDF
FT                   PCAQRNRPGVYTNLCEFVKWIKDTMNSN"
FT   assembly_gap    670469..670914
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    677276..678029
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    689724..689743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    695930..698981
FT                   /estimated_length=3052
FT                   /gap_type="unknown"
FT   assembly_gap    701341..702050
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   gene            704835..709480
FT                   /gene="Klk4"
FT                   /locus_tag="mCG_22153"
FT                   /note="gene_id=mCG22153.2"
FT   mRNA            join(704835..704890,705317..705388,707232..707394,
FT                   707622..707872,707956..708092,708910..709480)
FT                   /gene="Klk4"
FT                   /locus_tag="mCG_22153"
FT                   /product="kallikrein 4 (prostase, enamel matrix, prostate)"
FT                   /note="gene_id=mCG22153.2 transcript_id=mCT23910.2 created
FT                   on 19-SEP-2002"
FT   CDS             join(705325..705388,707232..707394,707622..707872,
FT                   707956..708092,708910..709062)
FT                   /codon_start=1
FT                   /gene="Klk4"
FT                   /locus_tag="mCG_22153"
FT                   /product="kallikrein 4 (prostase, enamel matrix, prostate)"
FT                   /note="gene_id=mCG22153.2 transcript_id=mCT23910.2
FT                   protein_id=mCP7728.2"
FT                   /db_xref="GOA:Q9Z0M1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:1861379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0M1"
FT                   /protein_id="EDL22687.1"
FT                   /translation="MMVTARTPWGWFLGCLILEVTGASASSVSSRIIQGQDCSPHSQPW
FT                   QAALFSEDGFFCSGVLVHPQWVLSAAHCLQESYIVGLGLHNLKGSQEPGSRMLEAHLSI
FT                   QHPNFNDPSFANDLMLIKLNESVIESNTIRSIPVATQCPTPGDTCLVSGWGQLKNGKLP
FT                   SLLQCVNLSVASEETCRLLYDPVYHLSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLV
FT                   SMGQGKCGQPGIPSVYTNLCKFTNWIQTIIQTN"
FT   assembly_gap    712850..712869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    716818..719390
FT                   /estimated_length=2573
FT                   /gap_type="unknown"
FT   assembly_gap    724739..726704
FT                   /estimated_length=1966
FT                   /gap_type="unknown"
FT   gene            <732314..>753129
FT                   /gene="Klk15"
FT                   /locus_tag="mCG_12422"
FT                   /note="gene_id=mCG12422.1"
FT   mRNA            join(<732314..732494,750946..751110,751940..752170,
FT                   752291..752427,752984..>753129)
FT                   /gene="Klk15"
FT                   /locus_tag="mCG_12422"
FT                   /product="kallikrein 15"
FT                   /note="gene_id=mCG12422.1 transcript_id=mCT13162.1 created
FT                   on 03-JUN-2002"
FT   CDS             join(732314..732494,750946..751110,751940..752170,
FT                   752291..752427,752984..>753129)
FT                   /codon_start=1
FT                   /gene="Klk15"
FT                   /locus_tag="mCG_12422"
FT                   /product="kallikrein 15"
FT                   /note="gene_id=mCG12422.1 transcript_id=mCT13162.1
FT                   protein_id=mCP1156.1"
FT                   /protein_id="EDL22688.1"
FT                   /translation="MSLRKLTFLSPDAGSSHDLMLLQLSEPADITEAVSVMSLPTEEPK
FT                   LGSRCLASGWGSTRPAQDGDKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLT
FT                   AAHCQTRYKGREQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAYVRPVALPRRC
FT                   PLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCNKDYPGRVLP
FT                   TMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLEWI
FT                   WENVR"
FT   gene            758354..759472
FT                   /gene="1700127D06Rik"
FT                   /locus_tag="mCG_142437"
FT                   /note="gene_id=mCG142437.0"
FT   mRNA            join(758354..758651,758748..758887,759261..759472)
FT                   /gene="1700127D06Rik"
FT                   /locus_tag="mCG_142437"
FT                   /product="RIKEN cDNA 1700127D06"
FT                   /note="gene_id=mCG142437.0 transcript_id=mCT180475.0
FT                   created on 11-FEB-2003"
FT   CDS             join(758465..758651,758748..758887,759261..759296)
FT                   /codon_start=1
FT                   /gene="1700127D06Rik"
FT                   /locus_tag="mCG_142437"
FT                   /product="RIKEN cDNA 1700127D06"
FT                   /note="gene_id=mCG142437.0 transcript_id=mCT180475.0
FT                   protein_id=mCP103397.0"
FT                   /protein_id="EDL22689.1"
FT                   /translation="MSFVTKHIQHHDYDFSNDLILFRLSKPADITDAVKPIGLPTEEPK
FT                   LGSTCFTSGWSTMAPYQFQNAKDLQCVNLKLLPNEECAKTESEGDRCHAVCRRDGWKKK
FT                   KKKKTLSGRLRRPTDL"
FT   gene            <764217..768486
FT                   /locus_tag="mCG_12421"
FT                   /note="gene_id=mCG12421.1"
FT   mRNA            join(<764217..764281,766240..766399,767399..767685,
FT                   767782..767918,768288..768486)
FT                   /locus_tag="mCG_12421"
FT                   /product="mCG12421"
FT                   /note="gene_id=mCG12421.1 transcript_id=mCT13161.1 created
FT                   on 31-MAY-2002"
FT   CDS             join(<764218..764281,766240..766399,767399..767685,
FT                   767782..767918,768288..768443)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12421"
FT                   /product="mCG12421"
FT                   /note="gene_id=mCG12421.1 transcript_id=mCT13161.1
FT                   protein_id=mCP1158.1"
FT                   /protein_id="EDL22690.1"
FT                   /translation="SWTPVTMRFLILFLALSLGGIDAAPPLQSRVVGGFNCEKNSQPWQ
FT                   VAVYDNKEHICGGVLLERNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPH
FT                   PGFNMSLLTLKEIPPGADFSNDLMLLRLSKPADITDAVKPITLPTKESKLGSTCLASGW
FT                   GSITPTKWQKPDDLQCVFLKLLPIKNCIENHNVKVTDVMLCAGEMSGGKNICKGDSGGP
FT                   LICDSVLQGITSTGPIPCGKPGVPAMYTNLIKFNSWIKDTMTKNS"
FT   assembly_gap    773925..773944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <781051..>785538
FT                   /locus_tag="mCG_1280"
FT                   /note="gene_id=mCG1280.1"
FT   mRNA            join(<781051..781096,783511..783670,784490..784776,
FT                   784873..785009,785383..>785538)
FT                   /locus_tag="mCG_1280"
FT                   /product="mCG1280"
FT                   /note="gene_id=mCG1280.1 transcript_id=mCT8547.1 created on
FT                   31-MAY-2002"
FT   CDS             join(781051..781096,783511..783670,784490..784776,
FT                   784873..785009,785383..785538)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1280"
FT                   /product="mCG1280"
FT                   /note="gene_id=mCG1280.1 transcript_id=mCT8547.1
FT                   protein_id=mCP9182.1"
FT                   /db_xref="GOA:A0A1R3UCH6"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:892019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R3UCH6"
FT                   /protein_id="EDL22691.1"
FT                   /translation="MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRY
FT                   KEYICGGVLLDANWVLTAAHCYYEKNNVWLGKNNLYQDEPSAQHRLVSKSFLHPCYNMS
FT                   LHRNRIQNPQDDYSYDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCLASGWGSIIPV
FT                   KFQYAKDLQCVNLKLLPNEDCDKAYVQKVTDVMLCAGVKGGGKDTCKGDSGGPLICDGV
FT                   LQGLTSWGYNPCGEPKKPGVYTKLIKFTSWIKDTLAQNP"
FT   assembly_gap    789026..789045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <791925..796240
FT                   /locus_tag="mCG_145361"
FT                   /note="gene_id=mCG145361.0"
FT   mRNA            join(<791925..792006,794190..794349,795144..795430,
FT                   795527..795663,796037..796240)
FT                   /locus_tag="mCG_145361"
FT                   /product="mCG145361"
FT                   /note="gene_id=mCG145361.0 transcript_id=mCT184785.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<791925..792006,794190..794349,795144..795430,
FT                   795527..795663,796037..796192)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145361"
FT                   /product="mCG145361"
FT                   /note="gene_id=mCG145361.0 transcript_id=mCT184785.0
FT                   protein_id=mCP105463.0"
FT                   /protein_id="EDL22692.1"
FT                   /translation="KLTACCSWTPVTMRFLILFLALSLGGIDAAPPVHSRIVGGFKCEK
FT                   NSQPWHVAVYRYNEYICGGVLLDANWVLTAAHCYYEENKVSLGKNNLYEEEPSAQHRLV
FT                   SKSFLHPGYNRSLHRNHIRHPEYDYSNDLMLLRLSKPADITDVVKPIALPTEEPKLGST
FT                   CLASGWGSTTPFKFQNAKDLQCVNLKLLPNEDCGKAHIEKVTDVMLCAGETDGGKDTCK
FT                   GDSGGPLICDGVLQGITSWGFTPCGEPKKPGVYTKLIKFTSWIKDTMAKNL"
FT   gene            <811771..815765
FT                   /locus_tag="mCG_145362"
FT                   /note="gene_id=mCG145362.0"
FT   mRNA            join(<811771..811842,813582..813741,814668..814954,
FT                   815051..815187,815562..815765)
FT                   /locus_tag="mCG_145362"
FT                   /product="mCG145362"
FT                   /note="gene_id=mCG145362.0 transcript_id=mCT184786.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<811773..811842,813582..813741,814668..814954,
FT                   815051..815187,815562..815717)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145362"
FT                   /product="mCG145362"
FT                   /note="gene_id=mCG145362.0 transcript_id=mCT184786.0
FT                   protein_id=mCP105464.0"
FT                   /protein_id="EDL22693.1"
FT                   /translation="CSSWTPVTMWFLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQP
FT                   WHVAVYRYNKYICGGVLLDRNWVLTAAHCHVSQYNVWLGKTKLFQREPSAQHRMVSKSF
FT                   PHPDYNMSLLIIHNPEPEDDESNDLMLLRLSEPADITDAVKPIALPTEEPKLGSTCLVS
FT                   GWGSITPTKFQTPDDLQCVSIKLLPNEVCVKNHNQKVTDVMLCAGEMGGGKDTCKGDSG
FT                   GPLICDGVLHGITAWGPIPCGKPNTPGVYTKLIKFTNWIKDTMAKNP"
FT   gene            <828585..832868
FT                   /locus_tag="mCG_1276"
FT                   /note="gene_id=mCG1276.1"
FT   mRNA            join(<828585..828672,830677..830836,831783..832069,
FT                   832166..832302,832672..832868)
FT                   /locus_tag="mCG_1276"
FT                   /product="mCG1276"
FT                   /note="gene_id=mCG1276.1 transcript_id=mCT8542.1 created on
FT                   31-MAY-2002"
FT   CDS             join(<828585..828672,830677..830836,831783..832069,
FT                   832166..832302,832672..832827)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1276"
FT                   /product="mCG1276"
FT                   /note="gene_id=mCG1276.1 transcript_id=mCT8542.1
FT                   protein_id=mCP9184.1"
FT                   /protein_id="EDL22694.1"
FT                   /translation="SSKLTACSSWTPVTMWFLILFPALSLGGIDAAPPLQSRVVGGFNC
FT                   EKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHR
FT                   LVSKSFPHPGFNMSLLMLQTIPPGADFSNDLMLLRLSKPADITDVVKPIALPTKEPKPG
FT                   SKCLASGWGSITPTRWQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDT
FT                   CRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA"
FT   assembly_gap    838613..838632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    853847..853866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    855613..855632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    856852..856871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    858042..858061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    864240..864527
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   gene            <870930..875506
FT                   /locus_tag="mCG_68207"
FT                   /note="gene_id=mCG68207.1"
FT   mRNA            join(<870930..871028,873121..873280,874414..874706,
FT                   874802..874938,875308..875506)
FT                   /locus_tag="mCG_68207"
FT                   /product="mCG68207"
FT                   /note="gene_id=mCG68207.1 transcript_id=mCT68394.1 created
FT                   on 31-MAY-2002"
FT   CDS             join(<870932..871028,873121..873280,874414..874706,
FT                   874802..874938,875308..875463)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68207"
FT                   /product="mCG68207"
FT                   /note="gene_id=mCG68207.1 transcript_id=mCT68394.1
FT                   protein_id=mCP43345.1"
FT                   /protein_id="EDL22695.1"
FT                   /translation="ILKSSKLTACGTWTPVTMRFLILFLALSLGGIDAAPPVQSRIIGG
FT                   FKCKKNSQPWHVAVLRSNKYICGGVLLDPNWVLTAAHCYGNDTSQHNVWLGKNKLFQRE
FT                   PSAQHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSKPADITDAVKPIDLPTE
FT                   EPKLGSTCLASGWGSITPTKYQIPNDLQCVFIKLLPNENCAKAYVHKVTDVMLCVGETG
FT                   GGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVFTKLIKFTSWIKDTMAKNP"
FT   assembly_gap    872742..872986
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    874061..874245
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    878120..878139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            922305..926592
FT                   /locus_tag="mCG_142421"
FT                   /note="gene_id=mCG142421.0"
FT   mRNA            join(922305..922424,924356..924515,925501..925787,
FT                   925884..926020,926391..926592)
FT                   /locus_tag="mCG_142421"
FT                   /product="mCG142421"
FT                   /note="gene_id=mCG142421.0 transcript_id=mCT180459.0
FT                   created on 24-APR-2003"
FT   CDS             join(922379..922424,924356..924515,925501..925787,
FT                   925884..926020,926391..926546)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142421"
FT                   /product="mCG142421"
FT                   /note="gene_id=mCG142421.0 transcript_id=mCT180459.0
FT                   protein_id=mCP103381.0"
FT                   /db_xref="GOA:Q3UNG6"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:892022"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UNG6"
FT                   /protein_id="EDL22696.1"
FT                   /translation="MRFLILFLALSLGEIDAAPPVQSRIVGGFNCEKNSQPWHVAVFRY
FT                   NKYICGGVLLNPNWVLTAAHCYGNQYNVWLGKNKLFQHESSAQHRLVSKSFPHPDYNMS
FT                   LMNDHTPHPEDDYSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPT
FT                   KWQIPNDLQCGFIKPLPNENCAKAYIHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGV
FT                   LQGITSWGSIPCAKPNAPAIYTKLIKFTSWIKDTMAKNP"
FT   gene            932699..>936892
FT                   /gene="Klk1b22"
FT                   /locus_tag="mCG_1051027"
FT                   /note="gene_id=mCG1051027.0"
FT   mRNA            join(932699..932763,934712..934871,935848..936128,
FT                   936225..936361,936737..>936892)
FT                   /gene="Klk1b22"
FT                   /locus_tag="mCG_1051027"
FT                   /product="kallikrein 1-related peptidase b22"
FT                   /note="gene_id=mCG1051027.0 transcript_id=mCT194816.0
FT                   created on 27-JAN-2005"
FT   CDS             join(932718..932763,934712..934871,935848..936128,
FT                   936225..936361,936737..936892)
FT                   /codon_start=1
FT                   /gene="Klk1b22"
FT                   /locus_tag="mCG_1051027"
FT                   /product="kallikrein 1-related peptidase b22"
FT                   /note="gene_id=mCG1051027.0 transcript_id=mCT194816.0
FT                   protein_id=mCP115848.0"
FT                   /db_xref="GOA:Q540N3"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="MGI:MGI:95291"
FT                   /db_xref="UniProtKB/TrEMBL:Q540N3"
FT                   /protein_id="EDL22697.1"
FT                   /translation="MRFLILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYYL
FT                   DEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMS
FT                   LLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIY
FT                   QNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQ
FT                   GITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP"
FT   gene            <956784..961624
FT                   /locus_tag="mCG_133312"
FT                   /note="gene_id=mCG133312.0"
FT   mRNA            join(<956784..957381,959408..959567,960534..960820,
FT                   960916..961052,961426..961624)
FT                   /locus_tag="mCG_133312"
FT                   /product="mCG133312"
FT                   /note="gene_id=mCG133312.0 transcript_id=mCT134677.0
FT                   created on 31-MAY-2002"
FT   CDS             join(<957315..957381,959408..959567,960534..960820,
FT                   960916..961052,961426..961581)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133312"
FT                   /product="mCG133312"
FT                   /note="gene_id=mCG133312.0 transcript_id=mCT134677.0
FT                   protein_id=mCP63570.0"
FT                   /protein_id="EDL22698.1"
FT                   /translation="SSWTPVTMWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPW
FT                   QVAVYYHKEHICGGVLLDRNWVLTAAHCYVDECEVWLGKNQLFQEEPSAQNRLVSKSFP
FT                   HPGFNMTLLTFEKLPPGADFSNDLMLLRLSKPADITDVVKPIDLPTKEPKLDSTCLVSG
FT                   WGSITPTKWQKPDDLQCMFTKLLPNENCAKAYLLKVTDVMLCTIEMGEDKGPCVGDSGG
FT                   PLICDGVLQGTVSIGPDPCGIPGVSAIYTNLVKFNSWIKDTMMKNA"
FT   assembly_gap    963225..976988
FT                   /estimated_length=13764
FT                   /gap_type="unknown"
FT   assembly_gap    978495..978514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    980012..986138
FT                   /estimated_length=6127
FT                   /gap_type="unknown"
FT   assembly_gap    987250..987728
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   gene            <1001494..1005680
FT                   /locus_tag="mCG_5702"
FT                   /note="gene_id=mCG5702.1"
FT   mRNA            join(<1001494..1001549,1003496..1003655,1004587..1004879,
FT                   1004975..1005111,1005482..1005680)
FT                   /locus_tag="mCG_5702"
FT                   /product="mCG5702"
FT                   /note="gene_id=mCG5702.1 transcript_id=mCT5186.1 created on
FT                   31-MAY-2002"
FT   CDS             join(<1001495..1001549,1003496..1003655,1004587..1004879,
FT                   1004975..1005111,1005482..1005637)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5702"
FT                   /product="mCG5702"
FT                   /note="gene_id=mCG5702.1 transcript_id=mCT5186.1
FT                   protein_id=mCP11491.1"
FT                   /protein_id="EDL22699.1"
FT                   /translation="PVTMWFLILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAV
FT                   FRYNKYICGGVLLNPNWVLTAAHCYGNATSQYNVWLGKNKLFQREPSAQHRWVSKSFPH
FT                   PDYNMSLLNDDIPQPKDKSNDLMLLRLSEPADITDAVKPIDLPTEEPKLGSTCLASGWG
FT                   SITPTKWQKPNDLQCVFIKLLPNENCTKPYLHKVTDVMLCAGEMGGGKDTCAGDSGGPL
FT                   ICDGILHGITSWGPVPCGKPNAPAIYTKLIKFASWIKDTMAKNP"
FT   gene            <1011468..1015549
FT                   /locus_tag="mCG_145360"
FT                   /note="gene_id=mCG145360.0"
FT   mRNA            join(<1011468..1011530,1013477..1013636,1014450..1014736,
FT                   1014836..1014972,1015348..1015549)
FT                   /locus_tag="mCG_145360"
FT                   /product="mCG145360"
FT                   /note="gene_id=mCG145360.0 transcript_id=mCT184784.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<1011470..1011530,1013477..1013636,1014450..1014736,
FT                   1014836..1014972,1015348..1015503)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145360"
FT                   /product="mCG145360"
FT                   /note="gene_id=mCG145360.0 transcript_id=mCT184784.0
FT                   protein_id=mCP105458.0"
FT                   /protein_id="EDL22700.1"
FT                   /translation="WTPVTMWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHV
FT                   AVYRYTQYLCGGVLLDPNWVLTAAHCYDDNYKVWLGKNNLFKDEPSAQHRFVSKAIPHP
FT                   GFNMSLMRKHIRFLEYDYSNDLMLLRLSKPADITDTVKPITLPTEEPKLGSTCLASGWG
FT                   SITPTKFQFTDDLYCVNLKLLPNEDCAKAHIEKVTDAMLCAGEMDGGKDTCKGDSGGPL
FT                   ICDGVLQGITSWGHTPCGEPDMPGVYTKLNKFTSWIKDTMAKNP"
FT   assembly_gap    1014340..1014359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1020638..1024948
FT                   /locus_tag="mCG_5713"
FT                   /note="gene_id=mCG5713.1"
FT   mRNA            join(<1020638..1020698,1022805..1022949,1023856..1024142,
FT                   1024239..1024375,1024751..1024948)
FT                   /locus_tag="mCG_5713"
FT                   /product="mCG5713"
FT                   /note="gene_id=mCG5713.1 transcript_id=mCT5182.1 created on
FT                   31-MAY-2002"
FT   CDS             join(<1020638..1020698,1022805..1022949,1023856..1024142,
FT                   1024239..1024375,1024751..1024906)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5713"
FT                   /product="mCG5713"
FT                   /note="gene_id=mCG5713.1 transcript_id=mCT5182.1
FT                   protein_id=mCP11489.1"
FT                   /protein_id="EDL22701.1"
FT                   /translation="WTPVTMWFLILFLALSLGGIDAAPPVQSQVDCENSQPWHVAVYRF
FT                   NKYQCGGVLLDRNWVLTAAHCYNDKYQVWLGKNNFLEDEPSDQHRLVSKAIPHPDFNMS
FT                   LLNEHTPQPEDDYSNDLMLLRLSKPADITDVVKPITLPTEEPKLGSTCLASGWGSTTPI
FT                   KFKYPDDLQCVNLKLLPNEDCDKAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGI
FT                   LQGITSWGPEPCGEPTEPSVYTKLIKFSSWIRETMANNP"
FT   gene            1029665..1033918
FT                   /locus_tag="mCG_5711"
FT                   /note="gene_id=mCG5711.1"
FT   mRNA            join(1029665..1029752,1031658..1031817,1032816..1033102,
FT                   1033197..1033333,1033705..1033918)
FT                   /locus_tag="mCG_5711"
FT                   /product="mCG5711"
FT                   /note="gene_id=mCG5711.1 transcript_id=mCT5180.1 created on
FT                   25-APR-2003"
FT   CDS             join(1029707..1029752,1031658..1031817,1032816..1033102,
FT                   1033197..1033333,1033705..1033860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5711"
FT                   /product="mCG5711"
FT                   /note="gene_id=mCG5711.1 transcript_id=mCT5180.1
FT                   protein_id=mCP11488.2"
FT                   /protein_id="EDL22702.1"
FT                   /translation="MWFLILFLALSLGGIDAAPPVQSRIFGGFNCEKNSQPWQVAVYRF
FT                   TKYQCGGVLLNANWVLTAAHCHNDKYQVWLGKNNFFEDEPSAQHRLVSKAIPHPDFNMS
FT                   LLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPV
FT                   IYEPADDLQCVNFKLLPNEDCVKAHIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDGV
FT                   LHGITSWGPSPCGKPNVPGIYTKLIKFNSWIKDTIAKNA"
FT   gene            <1038642..1042823
FT                   /locus_tag="mCG_146228"
FT                   /note="gene_id=mCG146228.0"
FT   mRNA            join(<1038642..1038730,1040727..1040886,1041734..1042020,
FT                   1042117..1042253,1042620..1042823)
FT                   /locus_tag="mCG_146228"
FT                   /product="mCG146228"
FT                   /note="gene_id=mCG146228.0 transcript_id=mCT186331.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<1038643..1038730,1040727..1040886,1041734..1042020,
FT                   1042117..1042253,1042620..1042775)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146228"
FT                   /product="mCG146228"
FT                   /note="gene_id=mCG146228.0 transcript_id=mCT186331.0
FT                   protein_id=mCP107394.0"
FT                   /protein_id="EDL22703.1"
FT                   /translation="SSKITACSSWTPVTMRFLILFLALSLGGIDAAPPVQSRIVGGFNC
FT                   EKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHR
FT                   LVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLG
FT                   STCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDT
FT                   CAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND"
FT   gene            complement(1043137..1049328)
FT                   /locus_tag="mCG_5707"
FT                   /note="gene_id=mCG5707.2"
FT   mRNA            complement(join(1043137..1043847,1043988..1044121,
FT                   1044532..1044678,1045559..1045759,1049272..1049327))
FT                   /locus_tag="mCG_5707"
FT                   /product="mCG5707, transcript variant mCT5191"
FT                   /note="gene_id=mCG5707.2 transcript_id=mCT5191.2 created on
FT                   19-MAR-2003"
FT   mRNA            complement(join(1043544..1043847,1044049..1044121,
FT                   1044532..1044678,1045559..1045759,1049272..1049328))
FT                   /locus_tag="mCG_5707"
FT                   /product="mCG5707, transcript variant mCT181329"
FT                   /note="gene_id=mCG5707.2 transcript_id=mCT181329.0 created
FT                   on 19-MAR-2003"
FT   CDS             complement(join(1043549..1043847,1043988..1044121,
FT                   1044532..1044632))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5707"
FT                   /product="mCG5707, isoform CRA_b"
FT                   /note="gene_id=mCG5707.2 transcript_id=mCT5191.2
FT                   protein_id=mCP11495.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D9U7"
FT                   /db_xref="MGI:MGI:1917254"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D9U7"
FT                   /protein_id="EDL22705.1"
FT                   /translation="MPHPPAHHVPLLSTSLPPPENDRLHLQFPQHCHRAGLLILLSLTF
FT                   FVVNCNRLRPRPQVSYHLAFYLCCCAMVLMLWAGTLSFLNQVRTWSYSIPSMERRLSYF
FT                   RWASRHHSLHLQQQTIMDRNLESVQKLSAVTSFVNSHGALQQSDSSTTQGTDESPWPDS
FT                   STSVPVAQFRSDLP"
FT   CDS             complement(join(1044108..1044121,1044532..1044678,
FT                   1045559..1045759,1049272..1049299))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5707"
FT                   /product="mCG5707, isoform CRA_a"
FT                   /note="gene_id=mCG5707.2 transcript_id=mCT181329.0
FT                   protein_id=mCP104251.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0U1RNM7"
FT                   /db_xref="MGI:MGI:1917254"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RNM7"
FT                   /protein_id="EDL22704.1"
FT                   /translation="MASDTTVSLPDLLSSWEEDRKLVLRGWSLTFIFLATLLVFSVVDG
FT                   RMAYVHGPYTGFIGLWIDCRRHKCVNVGQFTVYIHMSKGFIFLALALCLILLPTMFLSF
FT                   RPVCRRLKTIDFIFSFLSIVIVQDS"
FT   gene            1059926..1075922
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /note="gene_id=mCG134547.2"
FT   mRNA            join(1059926..1060010,1061454..1061497,1063223..1063261,
FT                   1063511..1063542,1073369..1075922)
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /product="RIKEN cDNA 2410002F23, transcript variant
FT                   mCT181297"
FT                   /note="gene_id=mCG134547.2 transcript_id=mCT181297.0
FT                   created on 19-MAR-2003"
FT   mRNA            join(1059933..1060025,1060440..1060618,1061454..1061497,
FT                   1062744..1062801,1063223..1063261,1063511..1063542,
FT                   1063815..1065680)
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /product="RIKEN cDNA 2410002F23, transcript variant
FT                   mCT135935"
FT                   /note="gene_id=mCG134547.2 transcript_id=mCT135935.1
FT                   created on 19-MAR-2003"
FT   mRNA            join(1059987..1060025,1061454..1061497,1062744..1062801,
FT                   1063223..1063261,1063511..1063542,1063815..1065518)
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /product="RIKEN cDNA 2410002F23, transcript variant
FT                   mCT181296"
FT                   /note="gene_id=mCG134547.2 transcript_id=mCT181296.0
FT                   created on 19-MAR-2003"
FT   mRNA            join(1059992..1060025,1060440..1060618,1061112..1061261,
FT                   1061454..1061497,1062744..1062801,1063223..1063261,
FT                   1063511..1063542,1063815..1065518)
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /product="RIKEN cDNA 2410002F23, transcript variant
FT                   mCT181295"
FT                   /note="gene_id=mCG134547.2 transcript_id=mCT181295.0
FT                   created on 19-MAR-2003"
FT   CDS             1063875..1064729
FT                   /codon_start=1
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /product="RIKEN cDNA 2410002F23, isoform CRA_a"
FT                   /note="gene_id=mCG134547.2 transcript_id=mCT181296.0
FT                   protein_id=mCP104219.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1914226"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TE80"
FT                   /protein_id="EDL22706.1"
FT                   /translation="MAERVLVPTQIGRGDRYYTYTELLAISRRFKQNPNELMVTWILRV
FT                   YDQGGPALSLNSGELGLLGDLTHDAIFNYRCKALRGAGCQTLLSWLLQAWRQRWESSLH
FT                   FEATELPFRPWTTMEEGIQLVRELGMIEWIYLDPEGPVDLAPEDVAFTQGLQRRLLTAA
FT                   PSELRLSLVSLLVRGMTVLEAVMEIQTIADVGLLWRQSHPGRTKLMLGPNPTRKDLLGW
FT                   LLSHGVPREQVDRQPTKVLLELYIKEAKRSRGHPNYGLNEEQPPPPPYSDQACGEEQPV
FT                   RHD"
FT   CDS             1063875..1064729
FT                   /codon_start=1
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /product="RIKEN cDNA 2410002F23, isoform CRA_a"
FT                   /note="gene_id=mCG134547.2 transcript_id=mCT135935.1
FT                   protein_id=mCP63674.1 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1914226"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TE80"
FT                   /protein_id="EDL22708.1"
FT                   /translation="MAERVLVPTQIGRGDRYYTYTELLAISRRFKQNPNELMVTWILRV
FT                   YDQGGPALSLNSGELGLLGDLTHDAIFNYRCKALRGAGCQTLLSWLLQAWRQRWESSLH
FT                   FEATELPFRPWTTMEEGIQLVRELGMIEWIYLDPEGPVDLAPEDVAFTQGLQRRLLTAA
FT                   PSELRLSLVSLLVRGMTVLEAVMEIQTIADVGLLWRQSHPGRTKLMLGPNPTRKDLLGW
FT                   LLSHGVPREQVDRQPTKVLLELYIKEAKRSRGHPNYGLNEEQPPPPPYSDQACGEEQPV
FT                   RHD"
FT   CDS             1063875..1064729
FT                   /codon_start=1
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /product="RIKEN cDNA 2410002F23, isoform CRA_a"
FT                   /note="gene_id=mCG134547.2 transcript_id=mCT181295.0
FT                   protein_id=mCP104218.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1914226"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TE80"
FT                   /protein_id="EDL22709.1"
FT                   /translation="MAERVLVPTQIGRGDRYYTYTELLAISRRFKQNPNELMVTWILRV
FT                   YDQGGPALSLNSGELGLLGDLTHDAIFNYRCKALRGAGCQTLLSWLLQAWRQRWESSLH
FT                   FEATELPFRPWTTMEEGIQLVRELGMIEWIYLDPEGPVDLAPEDVAFTQGLQRRLLTAA
FT                   PSELRLSLVSLLVRGMTVLEAVMEIQTIADVGLLWRQSHPGRTKLMLGPNPTRKDLLGW
FT                   LLSHGVPREQVDRQPTKVLLELYIKEAKRSRGHPNYGLNEEQPPPPPYSDQACGEEQPV
FT                   RHD"
FT   gene            complement(<1066289..>1070220)
FT                   /locus_tag="mCG_5709"
FT                   /note="gene_id=mCG5709.1"
FT   mRNA            complement(join(<1066289..1066401,1066480..1066658,
FT                   1066746..1066873,1067233..1067315,1067404..1067536,
FT                   1068198..1068293,1068373..1068471,1069051..1069197,
FT                   1069952..1070038,1070116..>1070220))
FT                   /locus_tag="mCG_5709"
FT                   /product="mCG5709"
FT                   /note="gene_id=mCG5709.1 transcript_id=mCT5178.1 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(1066289..1066401,1066480..1066658,
FT                   1066746..1066873,1067233..1067315,1067404..1067536,
FT                   1068198..1068293,1068373..1068471,1069051..1069197,
FT                   1069952..1070038,1070116..>1070220))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5709"
FT                   /product="mCG5709"
FT                   /note="gene_id=mCG5709.1 transcript_id=mCT5178.1
FT                   protein_id=mCP11497.0"
FT                   /protein_id="EDL22710.1"
FT                   /translation="VFRHGDRAPLASYPTDPHKEAASTLWPRGLGQLTKEGIRQQLELG
FT                   RFLRRRYKAFLSPEYKREEVYIRSTDFDRTLESAQANLAGLFPEAAPGSPETDWKPIPV
FT                   HTVPVSEDKLLRFPMRSCPRYHELLRESTEAADYQEALEGWTDFLTRLGNFTGLSLVGE
FT                   PLRRAWKVLDTLICQRAHGLDLPSWASPDVLRTLSQISALDIRAHVGPPRAAEKAQLTG
FT                   GILLDAILSNFSRTQRLGLPLKMVMYSAHDSTLLALQGALGLYDGNTPPYAACMAFEFR
FT                   GSSREPEEEDGENVTVSLIYRNDTSRPPLPLRVPGCPAPCPLGRFQQLTAPARPPAHGA
FT                   PCHGSYEPASPPATVPLLAGAVAVLAVLSLGLGLLAWRPRCLRALGGTV"
FT   CDS             1073884..1074264
FT                   /codon_start=1
FT                   /gene="2410002F23Rik"
FT                   /locus_tag="mCG_134547"
FT                   /product="RIKEN cDNA 2410002F23, isoform CRA_b"
FT                   /note="gene_id=mCG134547.2 transcript_id=mCT181297.0
FT                   protein_id=mCP104217.0 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:1914226"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CBG0"
FT                   /protein_id="EDL22707.1"
FT                   /translation="MCVPLSVSSLRYHCKEWGPSSGAFPLCTAGSHQWEVEAVTRTRVH
FT                   AHTHTHTHTRISPLLCTSNNLESHFKGIKRSQEPTKNTEWSQSKCLAAVSVVQSSEAVT
FT                   YQHQASHHDEHSATFTSWGTKF"
FT   gene            complement(1116517..1119644)
FT                   /gene="Clec11a"
FT                   /locus_tag="mCG_5708"
FT                   /note="gene_id=mCG5708.2"
FT   mRNA            complement(join(1116517..1117728,1118571..1118762,
FT                   1119015..1119052,1119445..1119644))
FT                   /gene="Clec11a"
FT                   /locus_tag="mCG_5708"
FT                   /product="C-type lectin domain family 11, member a,
FT                   transcript variant mCT181331"
FT                   /note="gene_id=mCG5708.2 transcript_id=mCT181331.0 created
FT                   on 29-MAY-2003"
FT   mRNA            complement(join(1116517..1117728,1118571..1118762,
FT                   1119015..1119216,1119361..1119642))
FT                   /gene="Clec11a"
FT                   /locus_tag="mCG_5708"
FT                   /product="C-type lectin domain family 11, member a,
FT                   transcript variant mCT5177"
FT                   /note="gene_id=mCG5708.2 transcript_id=mCT5177.2 created on
FT                   29-MAY-2003"
FT   CDS             complement(join(1117283..1117728,1118571..1118762,
FT                   1119015..1119216,1119361..1119507))
FT                   /codon_start=1
FT                   /gene="Clec11a"
FT                   /locus_tag="mCG_5708"
FT                   /product="C-type lectin domain family 11, member a, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5708.2 transcript_id=mCT5177.2
FT                   protein_id=mCP11484.1 isoform=CRA_b"
FT                   /protein_id="EDL22712.1"
FT                   /translation="MQAAWLLGALVVPQLLSFGHGARGPGREWEGGWGGALEEERERES
FT                   QMLKNLQEALGLPTGVGNEDNLAENPEDKEVWETTETQGEEEEEEITTAPSSSPNPFPS
FT                   PSPTPEDTVTYILGRLASLDAGLHQLHVRLHVLDTRVVELTQGLRQLRDAASDTRDSVQ
FT                   ALKEVQDRAEQEHGRLEGCLKGLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADR
FT                   QQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVSFFAWHRAFSLESGAQP
FT                   SAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVCEFPF"
FT   CDS             complement(join(1117283..1117728,1118571..1118762,
FT                   1119015..1119052,1119445..1119449))
FT                   /codon_start=1
FT                   /gene="Clec11a"
FT                   /locus_tag="mCG_5708"
FT                   /product="C-type lectin domain family 11, member a, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5708.2 transcript_id=mCT181331.0
FT                   protein_id=mCP104253.0 isoform=CRA_a"
FT                   /protein_id="EDL22711.1"
FT                   /translation="MDPSPTPEDTVTYILGRLASLDAGLHQLHVRLHVLDTRVVELTQG
FT                   LRQLRDAASDTRDSVQALKEVQDRAEQEHGRLEGCLKGLRLGHKCFLLSRDFETQAAAQ
FT                   ARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVS
FT                   FFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVC
FT                   EFPF"
FT   assembly_gap    1123206..1123941
FT                   /estimated_length=736
FT                   /gap_type="unknown"
FT   gene            <1125599..1171145
FT                   /locus_tag="mCG_5710"
FT                   /note="gene_id=mCG5710.1"
FT   mRNA            join(<1125599..1125901,1126059..1126262,1126693..1126764,
FT                   1128994..1129102,1129305..1129456,1132062..1132229,
FT                   1132629..1132745,1138604..1138670,1138922..1139252,
FT                   1139999..1140192,1146248..1146361,1146499..1146574,
FT                   1149822..1149869,1155758..1155840,1156080..1156204,
FT                   1156705..1156840,1157318..1157398,1158166..1158234,
FT                   1158559..1158677,1165716..1166279,1166460..1168345,
FT                   1170321..1171145)
FT                   /locus_tag="mCG_5710"
FT                   /product="mCG5710"
FT                   /note="gene_id=mCG5710.1 transcript_id=mCT5179.1 created on
FT                   31-MAY-2002"
FT   CDS             join(<1125614..1125901,1126059..1126262,1126693..1126764,
FT                   1128994..1129102,1129305..1129456,1132062..1132229,
FT                   1132629..1132745,1138604..1138670,1138922..1139252,
FT                   1139999..1140192,1146248..1146361,1146499..1146574,
FT                   1149822..1149869,1155758..1155840,1156080..1156204,
FT                   1156705..1156840,1157318..1157398,1158166..1158234,
FT                   1158559..1158677,1165716..1166279,1166460..1168345,
FT                   1170321..1171038)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5710"
FT                   /product="mCG5710"
FT                   /note="gene_id=mCG5710.1 transcript_id=mCT5179.1
FT                   protein_id=mCP11487.1"
FT                   /protein_id="EDL22713.1"
FT                   /translation="CCCPPSPRGPTMTHSPATSEDEERHSASECPEGGSESDSSPDGPG
FT                   RGPQGTRGRGSGAPGNLASTRGLQGRSMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPD
FT                   ATIWTAKQQVLCALSESLQDVLNYGLFQPATSGRDANFLEEERLLREYPQSFEKGVPYL
FT                   EFRYKTRVYKQTNLDEKQLAKLHTKTGLKKFLEYVQLGTSDKVARLLDKGLDPNYHDSD
FT                   SGETPLTLAAQTEGSVEVIRTLCLGGAHIDFRARDGMTALHKAACARHCLALTALLDLG
FT                   GSPNYKDRRGLTPLFHTAMVGGDPRCCELLLYNRAQLGIADENGWQEIHQACQRGHSQH
FT                   LEHLLFYGAEPGAQNASGNTALHICALYNKVAVIAGNFELGELIRNHREQDVVPFQESP
FT                   KYAARRRGPPGAGLTVPPALLRANSDTSMALPDWMVFSAPGASSSGTPGPTSGSQGQSQ
FT                   PSAPSTKLSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPRDGPAGGTG
FT                   GSGGPGGSLGSRGRRRKLYSAVPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGF
FT                   WEGQVKGRVGWFPSDCLEEVANRSQEGRQESRSDKAKRLFRHYTVGSYDSFDAPSWPAL
FT                   GPRRRSVWYIYSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYL
FT                   ESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPD
FT                   MDEAVHKKASQQAKRLPPPAISLRSKSMTSELEEMEYEQQPAAVPSMEKKRTVYQMALN
FT                   KLDEILAAAQQTISASESPGPGGLASLGKHRPKGFFATEPSLRGWRGGGPSPTSGAPSP
FT                   SHHSSSGGSSGPAQAPALRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVEGEPQKG
FT                   SLPPASSPTSPALPRSEPPPAGPSEKNSIPIPTIIIKAPSTSSSGRSSQGSSTEAEPPT
FT                   QPDGAGGGGSSPSPAPATSPVPPSPSPVPTPASPSGPATLDFTSQFGAALPYLRLESGG
FT                   SSGGYGAYAAGSRAYGGSGSSSAFTSFLPPRPLVHPLTGKALDPASPLGLALAARERAL
FT                   KESSEGGVTPQPPPRPPSPRYDAPPPTLHHHSPHSPHSPHARHEPVLRLWGDPARRELG
FT                   YRAGLGSQEKALTASPPAARRSLLHRLPPTAPGVGPLLLQLGPEPPTPHPGVSKAWRTA
FT                   APEEPERLPLHVRFLENCQARPPPAGTRGSSTEDGPGVPPPSPRRVLPTSPTSPRGNEE
FT                   NGLPLLVLPPPAPSVDVDDGEFLFAEPLPPPLEFSNSFEKPESPLTPGPPHPLPDPPSP
FT                   ATPLPAAPPPAVAAAPPTLDSTASSLTSYDSEVATLTQGAPAAPGDPPAPGPPAPAAPA
FT                   PPAPQPGPDPPPGTDSGIEEVDSRSSSDHPLETISSASTLSSLSAEGGGNTGGVAGGGA
FT                   GVASGTELLDTYVAYLDGQAFGGSGTPGPPYPPQLMTPSKLRGRALGTSGNLRPGPSGG
FT                   LRDPVTPTSPTVSVTGAGTDGLLALSACSGPSTAGVAGGPVAVEPEVPPVPLPTASSLP
FT                   RKLLPWEEGPGPPPPPLPGPLSQPQASALATVKASIISELSSKLQQFGGASTAGGALPW
FT                   ARGGSGGSTDSHHGGASYIPERTSSLQRQRLSEDSQTSLLSKPSSSIFQNWPKPPLPPL
FT                   PTGSGVSSSTAAAPGATSPSASSASASTRHLQGVEFEMRPPLLRRAPSPSLLPASDHKV
FT                   SPAPRPSSLPILPSGPLYPGLFDIRSSPTGGAGGSADPFAPVFVPPHPGISGGLGGALS
FT                   GASRSLSPTRLLSLPPDKPFGAKPLGFWTKFDVADWLEWLGLSEHRAQFLDHEIDGSHL
FT                   PALTKEDYVDLGVTRVGHRMNIDRALKFFLER"
FT   assembly_gap    1149382..1149401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1171573..1173162
FT                   /estimated_length=1590
FT                   /gap_type="unknown"
FT   gene            complement(1173739..>1188913)
FT                   /locus_tag="mCG_134545"
FT                   /note="gene_id=mCG134545.0"
FT   mRNA            complement(join(1173739..1174282,1174951..1175084,
FT                   1176553..1176673,1176844..1176916,1188205..1188406,
FT                   1188865..1188913))
FT                   /locus_tag="mCG_134545"
FT                   /product="mCG134545, transcript variant mCT135933"
FT                   /note="gene_id=mCG134545.0 transcript_id=mCT135933.0
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(1173948..1174282,1174951..1175084,
FT                   1176553..1176673,1176844..1176916,1187136..1187482))
FT                   /locus_tag="mCG_134545"
FT                   /product="mCG134545, transcript variant mCT181294"
FT                   /note="gene_id=mCG134545.0 transcript_id=mCT181294.0
FT                   created on 19-MAR-2003"
FT   mRNA            complement(join(1173950..1174282,1174951..1175084,
FT                   1176553..1176673,1176844..1176916,1188205..1188406,
FT                   1188869..>1188913))
FT                   /locus_tag="mCG_134545"
FT                   /product="mCG134545, transcript variant mCT191732"
FT                   /note="gene_id=mCG134545.0 transcript_id=mCT191732.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1174087..1174282,1174951..1175084,
FT                   1176553..1176673,1176844..1176916,1188205..1188406,
FT                   1188869..>1188913))
FT                   /codon_start=1
FT                   /locus_tag="mCG_134545"
FT                   /product="mCG134545, isoform CRA_c"
FT                   /note="gene_id=mCG134545.0 transcript_id=mCT191732.0
FT                   protein_id=mCP112696.0 isoform=CRA_c"
FT                   /protein_id="EDL22716.1"
FT                   /translation="QFLFVSRSLAGAEQRPSSSVFVPRGFKEQEAEVQEKSCAVWPSAS
FT                   ISPHLSGLPQTRFSRMQPEVEPLISPNLGAPGSHRETGSFLVDLESMEESMSRSLGKPA
FT                   KSSKQYLRQVISEYEALDRELPCIRKFSEPPSAQPLCLCMETSEDFTHVEVLQALEAEL
FT                   PGAMESGRVNSIRYENMNVICGTAGRRDRWLITVTDFQTRSRLLRSGLTLRGTAYPLVR
FT                   HDDLLLGDYRLHLRRSLVRRRMLEALGAEPADED"
FT   CDS             complement(join(1174087..1174282,1174951..1175084,
FT                   1176553..1176673,1176844..1176916,1188205..1188271))
FT                   /codon_start=1
FT                   /locus_tag="mCG_134545"
FT                   /product="mCG134545, isoform CRA_a"
FT                   /note="gene_id=mCG134545.0 transcript_id=mCT135933.0
FT                   protein_id=mCP63667.1 isoform=CRA_a"
FT                   /protein_id="EDL22714.1"
FT                   /translation="MQPEVEPLISPNLGAPGSHRETGSFLVDLESMEESMSRSLGKPAK
FT                   SSKQYLRQVISEYEALDRELPCIRKFSEPPSAQPLCLCMETSEDFTHVEVLQALEAELP
FT                   GAMESGRVNSIRYENMNVICGTAGRRDRWLITVTDFQTRSRLLRSGLTLRGTAYPLVRH
FT                   DDLLLGDYRLHLRRSLVRRRMLEALGAEPADED"
FT   CDS             complement(join(1174087..1174282,1174951..1175084,
FT                   1176553..1176673,1176844..1176890))
FT                   /codon_start=1
FT                   /locus_tag="mCG_134545"
FT                   /product="mCG134545, isoform CRA_b"
FT                   /note="gene_id=mCG134545.0 transcript_id=mCT181294.0
FT                   protein_id=mCP104216.0 isoform=CRA_b"
FT                   /protein_id="EDL22715.1"
FT                   /translation="MEESMSRSLGKPAKSSKQYLRQVISEYEALDRELPCIRKFSEPPS
FT                   AQPLCLCMETSEDFTHVEVLQALEAELPGAMESGRVNSIRYENMNVICGTAGRRDRWLI
FT                   TVTDFQTRSRLLRSGLTLRGTAYPLVRHDDLLLGDYRLHLRRSLVRRRMLEALGAEPAD
FT                   ED"
FT   gene            complement(1192580..1199469)
FT                   /locus_tag="mCG_147779"
FT                   /note="gene_id=mCG147779.0"
FT   mRNA            complement(join(1192580..1194605,1199258..1199469))
FT                   /locus_tag="mCG_147779"
FT                   /product="mCG147779"
FT                   /note="gene_id=mCG147779.0 transcript_id=mCT188042.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1193187..1193363)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147779"
FT                   /product="mCG147779"
FT                   /note="gene_id=mCG147779.0 transcript_id=mCT188042.0
FT                   protein_id=mCP109089.0"
FT                   /protein_id="EDL22717.1"
FT                   /translation="MKWFPLKVALDIAFRHSNRVVTKTEGIRRERESLSKAGWRRLGSA
FT                   SEDGHQKVLSFIH"
FT   gene            1197774..1213635
FT                   /gene="Syt3"
FT                   /locus_tag="mCG_5706"
FT                   /note="gene_id=mCG5706.2"
FT   mRNA            join(1197774..1197824,1198454..1198597,1199577..1199769,
FT                   1203981..1204509,1205884..1206256,1206834..1207052,
FT                   1208895..1209015,1209124..1209295,1209388..1209520,
FT                   1212632..1212699,1213142..1213635)
FT                   /gene="Syt3"
FT                   /locus_tag="mCG_5706"
FT                   /product="synaptotagmin III, transcript variant mCT5176"
FT                   /note="gene_id=mCG5706.2 transcript_id=mCT5176.2 created on
FT                   11-JUN-2003"
FT   mRNA            join(1197793..1197824,1198454..1198597,1199604..1199769,
FT                   1203981..1204509,1205884..1206256,1206834..1207052,
FT                   1208895..1209015,1209124..1209295,1209388..1209520,
FT                   1212632..1212699,1213142..1213635)
FT                   /gene="Syt3"
FT                   /locus_tag="mCG_5706"
FT                   /product="synaptotagmin III, transcript variant mCT185463"
FT                   /note="gene_id=mCG5706.2 transcript_id=mCT185463.0 created
FT                   on 11-JUN-2003"
FT   mRNA            join(1198252..1198597,1199604..1199769,1203981..1204509,
FT                   1205884..1206256,1206834..1207052,1208895..1209015,
FT                   1209124..1209295,1209388..1209520,1212632..1212699,
FT                   1213142..1213635)
FT                   /gene="Syt3"
FT                   /locus_tag="mCG_5706"
FT                   /product="synaptotagmin III, transcript variant mCT185464"
FT                   /note="gene_id=mCG5706.2 transcript_id=mCT185464.0 created
FT                   on 11-JUN-2003"
FT   CDS             join(1199619..1199769,1203981..1204509,1205884..1206256,
FT                   1206834..1207052,1208895..1209015,1209124..1209295,
FT                   1209388..1209520,1212632..1212697)
FT                   /codon_start=1
FT                   /gene="Syt3"
FT                   /locus_tag="mCG_5706"
FT                   /product="synaptotagmin III, isoform CRA_a"
FT                   /note="gene_id=mCG5706.2 transcript_id=mCT185463.0
FT                   protein_id=mCP106721.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9Y1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001565"
FT                   /db_xref="InterPro:IPR028682"
FT                   /db_xref="MGI:MGI:99665"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9Y1"
FT                   /protein_id="EDL22718.1"
FT                   /translation="MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYP
FT                   RGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPG
FT                   VGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYL
FT                   DMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSL
FT                   APTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTG
FT                   PGGRRGGGSGEAGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYL
FT                   LPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVV
FT                   LDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAM
FT                   DLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAV
FT                   VDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKG
FT                   GKGLSEKENSE"
FT   CDS             join(1199619..1199769,1203981..1204509,1205884..1206256,
FT                   1206834..1207052,1208895..1209015,1209124..1209295,
FT                   1209388..1209520,1212632..1212697)
FT                   /codon_start=1
FT                   /gene="Syt3"
FT                   /locus_tag="mCG_5706"
FT                   /product="synaptotagmin III, isoform CRA_a"
FT                   /note="gene_id=mCG5706.2 transcript_id=mCT185464.0
FT                   protein_id=mCP106722.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9Y1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001565"
FT                   /db_xref="InterPro:IPR028682"
FT                   /db_xref="MGI:MGI:99665"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9Y1"
FT                   /protein_id="EDL22719.1"
FT                   /translation="MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYP
FT                   RGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPG
FT                   VGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYL
FT                   DMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSL
FT                   APTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTG
FT                   PGGRRGGGSGEAGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYL
FT                   LPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVV
FT                   LDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAM
FT                   DLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAV
FT                   VDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKG
FT                   GKGLSEKENSE"
FT   CDS             join(1199619..1199769,1203981..1204509,1205884..1206256,
FT                   1206834..1207052,1208895..1209015,1209124..1209295,
FT                   1209388..1209520,1212632..1212697)
FT                   /codon_start=1
FT                   /gene="Syt3"
FT                   /locus_tag="mCG_5706"
FT                   /product="synaptotagmin III, isoform CRA_a"
FT                   /note="gene_id=mCG5706.2 transcript_id=mCT5176.2
FT                   protein_id=mCP11496.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9Y1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001565"
FT                   /db_xref="InterPro:IPR028682"
FT                   /db_xref="MGI:MGI:99665"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9Y1"
FT                   /protein_id="EDL22720.1"
FT                   /translation="MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYP
FT                   RGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPG
FT                   VGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYL
FT                   DMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSL
FT                   APTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTG
FT                   PGGRRGGGSGEAGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYL
FT                   LPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVV
FT                   LDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAM
FT                   DLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAV
FT                   VDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKG
FT                   GKGLSEKENSE"
FT   assembly_gap    1211231..1211737
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    1234160..1235427
FT                   /estimated_length=1268
FT                   /gap_type="unknown"
FT   assembly_gap    1244493..1244512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1256464..1258559
FT                   /estimated_length=2096
FT                   /gap_type="unknown"
FT   assembly_gap    1267042..1285144
FT                   /estimated_length=18103
FT                   /gap_type="unknown"
FT   gene            1289369..1290270
FT                   /locus_tag="mCG_147786"
FT                   /note="gene_id=mCG147786.0"
FT   mRNA            join(1289369..1289844,1289947..1290270)
FT                   /locus_tag="mCG_147786"
FT                   /product="mCG147786"
FT                   /note="gene_id=mCG147786.0 transcript_id=mCT188049.0
FT                   created on 13-JAN-2004"
FT   CDS             join(1289682..1289844,1289947..1290137)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147786"
FT                   /product="mCG147786"
FT                   /note="gene_id=mCG147786.0 transcript_id=mCT188049.0
FT                   protein_id=mCP109096.0"
FT                   /protein_id="EDL22721.1"
FT                   /translation="MAKTESRCGSGFVTLFFFFFFFCLPWTLAGGMRPGSRKQKISSER
FT                   RKSAAPDTAGAPSSSGISNERPRLTSVFQMKTSVHLQDTENLQLLGQRLLRTHLPWRTN
FT                   TAQHLPSVCLERS"
FT   gene            complement(1294737..1301369)
FT                   /gene="2310044H10Rik"
FT                   /locus_tag="mCG_8748"
FT                   /note="gene_id=mCG8748.2"
FT   mRNA            complement(join(1294737..1295827,1296812..1296905,
FT                   1297001..1297182,1297411..1297515,1298047..1298156,
FT                   1299665..1299737,1301113..1301369))
FT                   /gene="2310044H10Rik"
FT                   /locus_tag="mCG_8748"
FT                   /product="RIKEN cDNA 2310044H10, transcript variant
FT                   mCT7226"
FT                   /note="gene_id=mCG8748.2 transcript_id=mCT7226.2 created on
FT                   03-JUN-2002"
FT   mRNA            complement(join(1294820..1296106,1296812..1296905,
FT                   1297001..1297182,1297411..1297515,1298047..1298156,
FT                   1299665..1299737,1301113..1301369))
FT                   /gene="2310044H10Rik"
FT                   /locus_tag="mCG_8748"
FT                   /product="RIKEN cDNA 2310044H10, transcript variant
FT                   mCT135916"
FT                   /note="gene_id=mCG8748.2 transcript_id=mCT135916.0 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(1295729..1295827,1296812..1296905,
FT                   1297001..1297182,1297411..1297515,1298047..1298156,
FT                   1299665..1299737,1301113..1301256))
FT                   /codon_start=1
FT                   /gene="2310044H10Rik"
FT                   /locus_tag="mCG_8748"
FT                   /product="RIKEN cDNA 2310044H10, isoform CRA_b"
FT                   /note="gene_id=mCG8748.2 transcript_id=mCT7226.2
FT                   protein_id=mCP1990.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0X1KG67"
FT                   /db_xref="InterPro:IPR029615"
FT                   /db_xref="MGI:MGI:1916933"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0X1KG67"
FT                   /protein_id="EDL22723.1"
FT                   /translation="MALGFSQRSRMVAAGAGVTRLLVLLLMVAAAPSRARGSGCRVGAS
FT                   ARGTGADGREAEGCGTVALLLEHSFELGDGANFQKRGLLLWNQQDGTLSATQRQLSEEE
FT                   RGRLRDVAAVNGLYRVRVPRRPGTLDGSEAGGHVSSFVPACSLVESHLSDQLTLHVDVA
FT                   GNVVGLSVVVYPGGCRGSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIERLEMEQAQK
FT                   AKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDAGGQGGGGGGGSSR"
FT   CDS             complement(join(1296020..1296106,1296812..1296905,
FT                   1297001..1297182,1297411..1297515,1298047..1298156,
FT                   1299665..1299737,1301113..1301256))
FT                   /codon_start=1
FT                   /gene="2310044H10Rik"
FT                   /locus_tag="mCG_8748"
FT                   /product="RIKEN cDNA 2310044H10, isoform CRA_a"
FT                   /note="gene_id=mCG8748.2 transcript_id=mCT135916.0
FT                   protein_id=mCP63496.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR029615"
FT                   /db_xref="MGI:MGI:1916933"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0X1KG66"
FT                   /protein_id="EDL22722.1"
FT                   /translation="MALGFSQRSRMVAAGAGVTRLLVLLLMVAAAPSRARGSGCRVGAS
FT                   ARGTGADGREAEGCGTVALLLEHSFELGDGANFQKRGLLLWNQQDGTLSATQRQLSEEE
FT                   RGRLRDVAAVNGLYRVRVPRRPGTLDGSEAGGHVSSFVPACSLVESHLSDQLTLHVDVA
FT                   GNVVGLSVVVYPGGCRGSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIERLEMEQAQK
FT                   AKNPQEQKSFFAKYWHLILGGAVLLTALRPAAPGPAPAPTEA"
FT   gene            1301449..1306343
FT                   /locus_tag="mCG_8756"
FT                   /note="gene_id=mCG8756.2"
FT   mRNA            join(1301449..1301890,1302360..1302490,1305007..1305295,
FT                   1305825..1305990)
FT                   /locus_tag="mCG_8756"
FT                   /product="mCG8756, transcript variant mCT7207"
FT                   /note="gene_id=mCG8756.2 transcript_id=mCT7207.1 created on
FT                   19-MAR-2003"
FT   mRNA            join(1301529..1301921,1302360..1302490,1305007..1305295,
FT                   1306261..1306343)
FT                   /locus_tag="mCG_8756"
FT                   /product="mCG8756, transcript variant mCT181332"
FT                   /note="gene_id=mCG8756.2 transcript_id=mCT181332.0 created
FT                   on 19-MAR-2003"
FT   CDS             join(1301672..1301890,1302360..1302490,1305007..1305295,
FT                   1305825..1305881)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8756"
FT                   /product="mCG8756, isoform CRA_b"
FT                   /note="gene_id=mCG8756.2 transcript_id=mCT7207.1
FT                   protein_id=mCP1985.2 isoform=CRA_b"
FT                   /protein_id="EDL22725.1"
FT                   /translation="MGPAMRRPLPRMRPRSEFMYLASWDGCSRFAPADRPLAPAYAPCR
FT                   PGRLQRHLLSGEFDQLRDFPIFESNFVQVTRFGEVANKVTMGVAASSPALELPDLLLLA
FT                   GPDKENGHLQLLGLFPLQFVQLFVHDESRQQLKVKFRTGRAFYLQLRSPPETLDCEFGR
FT                   WVRLLYRLRFHSPTCAVPFTHEDTAPEEEEEEEEEEEEEEVKEGQLQPPEFQATEARLD
FT                   PQVSELWGL"
FT   CDS             join(1302396..1302490,1305007..1305295,1306261..1306272)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8756"
FT                   /product="mCG8756, isoform CRA_a"
FT                   /note="gene_id=mCG8756.2 transcript_id=mCT181332.0
FT                   protein_id=mCP104254.0 isoform=CRA_a"
FT                   /protein_id="EDL22724.1"
FT                   /translation="MGVAASSPALELPDLLLLAGPDKENGHLQLLGLFPLQFVQLFVHD
FT                   ESRQQLKVKFRTGRAFYLQLRSPPETLDCEFGRWVRLLYRLRFHSPTCAVPFTHEDTAP
FT                   EEEEEEEEEEEEEEVKEGQLQPPEGII"
FT   gene            complement(1306556..>1329733)
FT                   /gene="Mybpc2"
FT                   /locus_tag="mCG_134543"
FT                   /note="gene_id=mCG134543.2"
FT   mRNA            complement(join(1306556..1306699,1308494..1308680,
FT                   1309856..1309992,1310093..1310252,1310423..1310562,
FT                   1310909..1311104,1311665..1311753,1311892..1312059,
FT                   1313088..1313222,1313830..1314018,1314395..1314499,
FT                   1314592..1314751,1316873..1317012,1317156..1317185,
FT                   1317525..1317631,1318748..1318913,1319929..1320101,
FT                   1321006..1321111,1321223..1321347,1321463..1321595,
FT                   1321891..1322084,1325395..1325454,1325801..1325849,
FT                   1326737..1326865,1327057..1327205,1327398..1327484,
FT                   1327908..1327985,1329648..>1329733))
FT                   /gene="Mybpc2"
FT                   /locus_tag="mCG_134543"
FT                   /product="myosin binding protein C, fast-type, transcript
FT                   variant mCT191808"
FT                   /note="gene_id=mCG134543.2 transcript_id=mCT191808.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(1306570..1306699,1308494..1308680,
FT                   1309856..1309992,1310093..1310252,1310423..1310562,
FT                   1310909..1311104,1311665..1311753,1311892..1312059,
FT                   1313088..1313222,1313830..1314018,1314395..1314499,
FT                   1314592..1314751,1316873..1317012,1317156..1317185,
FT                   1317525..1317631,1318748..1318913,1319929..1320101,
FT                   1321006..1321111,1321223..1321347,1321463..1321595,
FT                   1321891..1322084,1325395..1325454,1325801..1325849,
FT                   1326737..1326865,1327013..1327205,1327398..1327484,
FT                   1327908..1327985,1329648..1329693))
FT                   /gene="Mybpc2"
FT                   /locus_tag="mCG_134543"
FT                   /product="myosin binding protein C, fast-type, transcript
FT                   variant mCT135931"
FT                   /note="gene_id=mCG134543.2 transcript_id=mCT135931.2
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(1306689..1306699,1308494..1308680,
FT                   1309856..1309992,1310093..1310252,1310423..1310562,
FT                   1310909..1311104,1311665..1311753,1311892..1312059,
FT                   1313088..1313222,1313830..1314018,1314395..1314499,
FT                   1314592..1314751,1316873..1317012,1317156..1317185,
FT                   1317525..1317631,1318748..1318913,1319929..1320101,
FT                   1321006..1321111,1321223..1321347,1321463..1321595,
FT                   1321891..1322084,1325395..1325454,1325801..1325849,
FT                   1326737..>1326824))
FT                   /codon_start=1
FT                   /gene="Mybpc2"
FT                   /locus_tag="mCG_134543"
FT                   /product="myosin binding protein C, fast-type, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG134543.2 transcript_id=mCT191808.0
FT                   protein_id=mCP112760.0 isoform=CRA_b"
FT                   /protein_id="EDL22727.1"
FT                   /translation="GDQRGLTDLENQSTRMSCREDGRYNVDVEAPRQDSSGQSLESFKR
FT                   SGDGKSEDAGELDFSGLLKKREVVEEEKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIA
FT                   FQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLVVEISDPDLPLKW
FT                   FKNGQEIKPSSKYVFENVGKKRILTINKCTLADDAAYEVAVQDEKCFTELFVKEPPVLI
FT                   VTPLEDQQVFVGDRVEMSVEVSEEGAQVMWMKDGVEMTREDSYKARYRFKKDGKRHILI
FT                   YSDVAQEDGGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKAAEQAVFKCEVSDEK
FT                   VTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNF
FT                   LEIKVEYVPKQEPPKIHLDCSGKTSDNSIVVVAGNKLRLDVAITGEPPPTATWLRGDEV
FT                   FTATEGRTHIEQRPDCSSFVIESAERSDEGRYTIKVTNPVGEDVASIFLRVVDVPDPPE
FT                   AVRVTSVGEDWAILVWEPPKYDGGQPVTGYLMERKKKGSQRWMKINFEVFTDTTYESTK
FT                   MIEGVLYEMRVFAVNAIGVSQPSMNTKPFMPIAPTSAPQHLTVEDVTDTTTTLKWRPPD
FT                   RIGAGGIDGYLVEYCLEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRS
FT                   EPATLLQPVTIREIVEQPKIRLPRHLRQTYIRKVGEALNLVIPFQGKPRPQVVWTKGGA
FT                   PLDTSRVNVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPAEN
FT                   VMVKEVWGTNALVEWQPPKDDGNSEITGYFVQKADKKTMEWFNVYEHNRHTSCTVSDLI
FT                   VGNEYYFRIFSENICGLSDSPGVSKNTARILKTGITLKPLEYKEHDFRTAPKFLTPLMD
FT                   RVVVAGYTAALNCAVRGHPKPKVVWMKNKMEIHEDPKFLITNYQGILTLNIRRPSPFDA
FT                   GTYSCRAFNELGEALAECKLDVRVPQ"
FT   CDS             complement(join(1306689..1306699,1308494..1308680,
FT                   1309856..1309992,1310093..1310252,1310423..1310562,
FT                   1310909..1311104,1311665..1311753,1311892..1312059,
FT                   1313088..1313222,1313830..1314018,1314395..1314499,
FT                   1314592..1314751,1316873..1317012,1317156..1317185,
FT                   1317525..1317631,1318748..1318913,1319929..1320101,
FT                   1321006..1321111,1321223..1321347,1321463..1321595,
FT                   1321891..1322084,1325395..1325454,1325801..1325849,
FT                   1326737..1326779))
FT                   /codon_start=1
FT                   /gene="Mybpc2"
FT                   /locus_tag="mCG_134543"
FT                   /product="myosin binding protein C, fast-type, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG134543.2 transcript_id=mCT135931.2
FT                   protein_id=mCP63547.2 isoform=CRA_a"
FT                   /protein_id="EDL22726.1"
FT                   /translation="MSCREDGRYNVDVEAPRQDSSGQSLESFKRSGDGKSEDAGELDFS
FT                   GLLKKREVVEEEKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKRL
FT                   KKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLVVEISDPDLPLKWFKNGQEIKPSSKYVF
FT                   ENVGKKRILTINKCTLADDAAYEVAVQDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRV
FT                   EMSVEVSEEGAQVMWMKDGVEMTREDSYKARYRFKKDGKRHILIYSDVAQEDGGRYQVI
FT                   TNGGQCEAELIVEEKQLEVLQDIADLTVKAAEQAVFKCEVSDEKVTGKWYKNGVEVRPS
FT                   KRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPK
FT                   IHLDCSGKTSDNSIVVVAGNKLRLDVAITGEPPPTATWLRGDEVFTATEGRTHIEQRPD
FT                   CSSFVIESAERSDEGRYTIKVTNPVGEDVASIFLRVVDVPDPPEAVRVTSVGEDWAILV
FT                   WEPPKYDGGQPVTGYLMERKKKGSQRWMKINFEVFTDTTYESTKMIEGVLYEMRVFAVN
FT                   AIGVSQPSMNTKPFMPIAPTSAPQHLTVEDVTDTTTTLKWRPPDRIGAGGIDGYLVEYC
FT                   LEGSEEWVPANKEPVERCGFTVKDLPTGARILFRVVGVNIAGRSEPATLLQPVTIREIV
FT                   EQPKIRLPRHLRQTYIRKVGEALNLVIPFQGKPRPQVVWTKGGAPLDTSRVNVRTSDFD
FT                   TVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPAENVMVKEVWGTNALVEW
FT                   QPPKDDGNSEITGYFVQKADKKTMEWFNVYEHNRHTSCTVSDLIVGNEYYFRIFSENIC
FT                   GLSDSPGVSKNTARILKTGITLKPLEYKEHDFRTAPKFLTPLMDRVVVAGYTAALNCAV
FT                   RGHPKPKVVWMKNKMEIHEDPKFLITNYQGILTLNIRRPSPFDAGTYSCRAFNELGEAL
FT                   AECKLDVRVPQ"
FT   assembly_gap    1315558..1315577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1331918..1333333)
FT                   /locus_tag="mCG_147775"
FT                   /note="gene_id=mCG147775.0"
FT   mRNA            complement(1331918..1333333)
FT                   /locus_tag="mCG_147775"
FT                   /product="mCG147775"
FT                   /note="gene_id=mCG147775.0 transcript_id=mCT188038.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1333035..1333274)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147775"
FT                   /product="mCG147775"
FT                   /note="gene_id=mCG147775.0 transcript_id=mCT188038.0
FT                   protein_id=mCP109085.0"
FT                   /protein_id="EDL22728.1"
FT                   /translation="MRECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLA
FT                   RALRNYAKTGEIRKVKRKLTYQFDSALLPASRHV"
FT   gene            complement(1337825..1353881)
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /note="gene_id=mCG8750.3"
FT   mRNA            complement(join(1337825..1337936,1338280..1338377,
FT                   1338449..1338501,1338760..1338873,1338961..1339093,
FT                   1339461..1339563,1339640..1339792,1340091..1340266,
FT                   1340773..1340910,1341005..1341100,1342682..1342829,
FT                   1343066..1343179,1343401..1343517,1343678..1343766,
FT                   1343847..1344038,1344128..1344238,1344436..1344576,
FT                   1345599..1345703,1345918..1346084,1346349..1346478,
FT                   1346564..1346645,1346728..1346896,1346973..1347098,
FT                   1347178..1347324,1347839..1347952,1348315..1348510,
FT                   1353820..1353881))
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, transcript variant mCT185512"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185512.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(1337826..1337970,1338280..1338377,
FT                   1338449..1338501,1338760..1338873,1338961..1339093,
FT                   1339461..1339563,1339640..1339792,1340091..1340266,
FT                   1340773..1340910,1341005..1341100,1342682..1342829,
FT                   1343066..1343179,1343401..1343517,1343678..1343766,
FT                   1343847..1344038,1344128..1344238,1344436..1344576,
FT                   1345599..1345703,1345918..1346084,1346349..1346478,
FT                   1346564..1346645,1346728..1346896,1346973..1347098,
FT                   1347178..1347324,1347839..1347952,1348315..1348510,
FT                   1353686..1353797))
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, transcript variant mCT185508"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185508.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(1337826..1337970,1338280..1338377,
FT                   1338449..1338501,1338760..1338873,1338961..>1339262))
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, transcript variant mCT185511"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185511.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(1337842..1337970,1338280..1338377,
FT                   1338449..1338501,1338760..1338873,1338961..1339093,
FT                   1339461..1339563,1339640..1339792,1340091..1340266,
FT                   1340773..1340910,1341005..1341100,1342682..1342829,
FT                   1343066..1343179,1343401..1343517,1343678..1343766,
FT                   1343847..1344038,1344128..1344238,1344436..1344576,
FT                   1345599..1345703,1345918..1346084,1346349..1346478,
FT                   1346564..1346645,1346728..1346896,1346973..1347098,
FT                   1347178..1347324,1347839..1347952,1348315..1348510,
FT                   1353820..1353878))
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, transcript variant mCT7212"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT7212.3 created on
FT                   10-JUN-2003"
FT   CDS             complement(join(1337843..1337936,1338280..1338377,
FT                   1338449..1338501,1338760..1338873,1338961..1339093,
FT                   1339461..1339563,1339640..1339792,1340091..1340266,
FT                   1340773..1340910,1341005..1341100,1342682..1342829,
FT                   1343066..1343179,1343401..1343517,1343678..1343766,
FT                   1343847..1344038,1344128..1344238,1344436..1344576,
FT                   1345599..1345703,1345918..1346084,1346349..1346478,
FT                   1346564..1346645,1346728..1346896,1346973..1347098,
FT                   1347178..1347324,1347839..1347952,1348315..1348510))
FT                   /codon_start=1
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, isoform CRA_d"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185512.0
FT                   protein_id=mCP106769.0 isoform=CRA_d"
FT                   /protein_id="EDL22732.1"
FT                   /translation="MDCKRRQGPGPGVPPKRARGHLWDEDEPSPSQFEANLALLEEIEA
FT                   ENRLQEAEEELQLPPEGTVGGQFSTADIDPRWRRPTLRALDPSTEPLIFQQLEIDHYVG
FT                   SAPPLPEGPLPSRNSVPILRAFGVTDEGFSVCCHIQGFAPYFYTPAPPGFGAEHLSELQ
FT                   QELNAAISRDQRGGKELSGPAVLAIELCSRESMFGYHGHGPSPFLRITLALPRLMAPAR
FT                   RLLEQGVRVPGLGTPSFAPYEANVDFEIRFMVDADIVGCNWLELPAGKYVRRAEKKATL
FT                   CQLEVDVLWSDVISHPPEGQWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGL
FT                   RWGEPEPFLRLALTLRPCAPILGAKVQSYEREEDLLQAWADFILAMDPDVITGYNIQNF
FT                   DLPYLISRAQALKVDRFPFLGRVTGLRSNIRDSSFQSRQVGRRDSKVISMVGRVQMDML
FT                   QVLLREHKLRSYTLNAVSFHFLGEQKEDVQHSIITDLQNGNEQTRRRLAVYCLKDAFLP
FT                   LRLLERLMVLVNNVEMARVTGVPLGYLLTRGQQVKVVSQLLRQAMRQGLLMPVVKTEGG
FT                   EDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLKPDEF
FT                   IKTPTGDEFVKSSVRKGLLPQILENLLSARKRAKAELAQETDPLRRQVLDGRQLALKVS
FT                   ANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVESKYTVENGYDANAKVVYGD
FT                   TDSVMCRFGVSSVAEAMSLGREAANWVSSHFPSPIRLEFEKVYFPYLLISKKRYAGLLF
FT                   SSRSDAHDKMDCKGLEAVRRDNCPLVANLVTSSLRRILVDRDPDGAVAHAKDVISDLLC
FT                   NRIDISQLVITKELTRAAADYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIIGAAKG
FT                   VAAYMKSEDPLFVLEHSLPIDTQYYLEQQLAKPLLRIFEPILGEGRAESVLLRGDHTRC
FT                   KTVLTSKVGGLLAFTKRRNCCIGCRSVIDHQGAVCKFCQPRESELYQKEVSHLNALEER
FT                   FSRLWTQCQRCQGSLHEDVICTRCARTWKTRNGCCSALDRPALRPGDLTRDKE"
FT   CDS             complement(join(1337865..1337970,1338280..1338377,
FT                   1338449..1338501,1338760..1338873,1338961..1339093,
FT                   1339461..1339563,1339640..1339792,1340091..1340266,
FT                   1340773..1340910,1341005..1341100,1342682..1342829,
FT                   1343066..1343179,1343401..1343517,1343678..1343766,
FT                   1343847..1344038,1344128..1344238,1344436..1344576,
FT                   1345599..1345703,1345918..1346084,1346349..1346478,
FT                   1346564..1346645,1346728..1346896,1346973..1347098,
FT                   1347178..1347324,1347839..1347952,1348315..1348510,
FT                   1353686..1353751))
FT                   /codon_start=1
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185508.0
FT                   protein_id=mCP106766.0 isoform=CRA_a"
FT                   /protein_id="EDL22729.1"
FT                   /translation="MSAAGGRIEQCKGQIPWSLGPGMDCKRRQGPGPGVPPKRARGHLW
FT                   DEDEPSPSQFEANLALLEEIEAENRLQEAEEELQLPPEGTVGGQFSTADIDPRWRRPTL
FT                   RALDPSTEPLIFQQLEIDHYVGSAPPLPEGPLPSRNSVPILRAFGVTDEGFSVCCHIQG
FT                   FAPYFYTPAPPGFGAEHLSELQQELNAAISRDQRGGKELSGPAVLAIELCSRESMFGYH
FT                   GHGPSPFLRITLALPRLMAPARRLLEQGVRVPGLGTPSFAPYEANVDFEIRFMVDADIV
FT                   GCNWLELPAGKYVRRAEKKATLCQLEVDVLWSDVISHPPEGQWQRIAPLRVLSFDIECA
FT                   GRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEREEDLLQ
FT                   AWADFILAMDPDVITGYNIQNFDLPYLISRAQALKVDRFPFLGRVTGLRSNIRDSSFQS
FT                   RQVGRRDSKVISMVGRVQMDMLQVLLREHKLRSYTLNAVSFHFLGEQKEDVQHSIITDL
FT                   QNGNEQTRRRLAVYCLKDAFLPLRLLERLMVLVNNVEMARVTGVPLGYLLTRGQQVKVV
FT                   SQLLRQAMRQGLLMPVVKTEGGEDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHN
FT                   LCYTTLLRPGAAQKLGLKPDEFIKTPTGDEFVKSSVRKGLLPQILENLLSARKRAKAEL
FT                   AQETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQ
FT                   LVESKYTVENGYDANAKVVYGDTDSVMCRFGVSSVAEAMSLGREAANWVSSHFPSPIRL
FT                   EFEKVYFPYLLISKKRYAGLLFSSRSDAHDKMDCKGLEAVRRDNCPLVANLVTSSLRRI
FT                   LVDRDPDGAVAHAKDVISDLLCNRIDISQLVITKELTRAAADYAGKQAHVELAERMRKR
FT                   DPGSAPSLGDRVPYVIIGAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQLAKPLLRI
FT                   FEPILGEGRAESVLLRGDHTRCKTVLTSKVGGLLAFTKRRNCCIGCRSVIDHQGAVCKF
FT                   CQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVRK
FT                   DLEDQERLLQRFGPPGPEAW"
FT   CDS             complement(join(1337865..1337970,1338280..1338377,
FT                   1338449..1338501,1338760..1338873,1338961..1339093,
FT                   1339461..1339563,1339640..1339792,1340091..1340266,
FT                   1340773..1340910,1341005..1341100,1342682..1342829,
FT                   1343066..1343179,1343401..1343517,1343678..1343766,
FT                   1343847..1344038,1344128..1344238,1344436..1344576,
FT                   1345599..1345703,1345918..1346084,1346349..1346478,
FT                   1346564..1346645,1346728..1346896,1346973..1347098,
FT                   1347178..1347324,1347839..1347952,1348315..1348510))
FT                   /codon_start=1
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, isoform CRA_e"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT7212.3
FT                   protein_id=mCP1981.1 isoform=CRA_e"
FT                   /protein_id="EDL22733.1"
FT                   /translation="MDCKRRQGPGPGVPPKRARGHLWDEDEPSPSQFEANLALLEEIEA
FT                   ENRLQEAEEELQLPPEGTVGGQFSTADIDPRWRRPTLRALDPSTEPLIFQQLEIDHYVG
FT                   SAPPLPEGPLPSRNSVPILRAFGVTDEGFSVCCHIQGFAPYFYTPAPPGFGAEHLSELQ
FT                   QELNAAISRDQRGGKELSGPAVLAIELCSRESMFGYHGHGPSPFLRITLALPRLMAPAR
FT                   RLLEQGVRVPGLGTPSFAPYEANVDFEIRFMVDADIVGCNWLELPAGKYVRRAEKKATL
FT                   CQLEVDVLWSDVISHPPEGQWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGL
FT                   RWGEPEPFLRLALTLRPCAPILGAKVQSYEREEDLLQAWADFILAMDPDVITGYNIQNF
FT                   DLPYLISRAQALKVDRFPFLGRVTGLRSNIRDSSFQSRQVGRRDSKVISMVGRVQMDML
FT                   QVLLREHKLRSYTLNAVSFHFLGEQKEDVQHSIITDLQNGNEQTRRRLAVYCLKDAFLP
FT                   LRLLERLMVLVNNVEMARVTGVPLGYLLTRGQQVKVVSQLLRQAMRQGLLMPVVKTEGG
FT                   EDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLKPDEF
FT                   IKTPTGDEFVKSSVRKGLLPQILENLLSARKRAKAELAQETDPLRRQVLDGRQLALKVS
FT                   ANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVESKYTVENGYDANAKVVYGD
FT                   TDSVMCRFGVSSVAEAMSLGREAANWVSSHFPSPIRLEFEKVYFPYLLISKKRYAGLLF
FT                   SSRSDAHDKMDCKGLEAVRRDNCPLVANLVTSSLRRILVDRDPDGAVAHAKDVISDLLC
FT                   NRIDISQLVITKELTRAAADYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIIGAAKG
FT                   VAAYMKSEDPLFVLEHSLPIDTQYYLEQQLAKPLLRIFEPILGEGRAESVLLRGDHTRC
FT                   KTVLTSKVGGLLAFTKRRNCCIGCRSVIDHQGAVCKFCQPRESELYQKEVSHLNALEER
FT                   FSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVRKDLEDQERLLQRFGPPGPEAW"
FT   CDS             complement(join(1337865..1337970,1338280..1338377,
FT                   1338449..1338501,1338760..1338873,1338961..>1339144))
FT                   /codon_start=1
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, isoform CRA_c"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185511.0
FT                   protein_id=mCP106768.0 isoform=CRA_c"
FT                   /protein_id="EDL22731.1"
FT                   /translation="PLAHAPLQPLVTLACPQDPLFVLEHSLPIDTQYYLEQQLAKPLLR
FT                   IFEPILGEGRAESVLLRGDHTRCKTVLTSKVGGLLAFTKRRNCCIGCRSVIDHQGAVCK
FT                   FCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVR
FT                   KDLEDQERLLQRFGPPGPEAW"
FT   mRNA            complement(join(1339145..1339563,1339640..1339792,
FT                   1340091..1340266,1340773..1340910,1341005..1341100,
FT                   1342682..1342829,1343066..1343179,1343401..1343517,
FT                   1343678..1343766,1343847..1344038,1344128..1344238,
FT                   1344436..1344576,1345599..1345703,1345918..1346084,
FT                   1346349..1346478,1346564..1346645,1346728..1346896,
FT                   1346973..1347098,1347178..1347324,1347839..1347952,
FT                   1348315..1348510,1353820..1353881))
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, transcript variant mCT185509"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185509.0 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(1339380..1339563,1339640..1339792,
FT                   1340091..1340266,1340773..1340910,1341005..1341100,
FT                   1342682..1342829,1343066..1343179,1343401..1343517,
FT                   1343678..1343766,1343847..1344038,1344128..1344238,
FT                   1344436..1344576,1345599..1345703,1345918..1346084,
FT                   1346349..1346478,1346564..1346645,1346728..1346896,
FT                   1346973..1347098,1347178..1347324,1347839..1347952,
FT                   1348315..1348510))
FT                   /codon_start=1
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, isoform CRA_f"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185509.0
FT                   protein_id=mCP106767.0 isoform=CRA_f"
FT                   /protein_id="EDL22734.1"
FT                   /translation="MDCKRRQGPGPGVPPKRARGHLWDEDEPSPSQFEANLALLEEIEA
FT                   ENRLQEAEEELQLPPEGTVGGQFSTADIDPRWRRPTLRALDPSTEPLIFQQLEIDHYVG
FT                   SAPPLPEGPLPSRNSVPILRAFGVTDEGFSVCCHIQGFAPYFYTPAPPGFGAEHLSELQ
FT                   QELNAAISRDQRGGKELSGPAVLAIELCSRESMFGYHGHGPSPFLRITLALPRLMAPAR
FT                   RLLEQGVRVPGLGTPSFAPYEANVDFEIRFMVDADIVGCNWLELPAGKYVRRAEKKATL
FT                   CQLEVDVLWSDVISHPPEGQWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGL
FT                   RWGEPEPFLRLALTLRPCAPILGAKVQSYEREEDLLQAWADFILAMDPDVITGYNIQNF
FT                   DLPYLISRAQALKVDRFPFLGRVTGLRSNIRDSSFQSRQVGRRDSKVISMVGRVQMDML
FT                   QVLLREHKLRSYTLNAVSFHFLGEQKEDVQHSIITDLQNGNEQTRRRLAVYCLKDAFLP
FT                   LRLLERLMVLVNNVEMARVTGVPLGYLLTRGQQVKVVSQLLRQAMRQGLLMPVVKTEGG
FT                   EDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLKPDEF
FT                   IKTPTGDEFVKSSVRKGLLPQILENLLSARKRAKAELAQETDPLRRQVLDGRQLALKVS
FT                   ANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVESKYTVENGYDANAKVVYGD
FT                   TDSVMCRFGVSSVAEAMSLGREAANWVSSHFPSPIRLEFEKVYFPYLLISKKRYAGLLF
FT                   SSRSDAHDKMDCKGLEAVRRDNCPLVANLVTSSLRRILVDRDPDGAVAHAKDVISDLLC
FT                   NRIDISQLVITKELTRAAADYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIIGAAKG
FT                   VAAYMKSEVRPTWAGPLPEFHFCFPGAAMPLGHT"
FT   mRNA            complement(join(1340122..1340910,1341005..1341100,
FT                   1342682..1342829,1343066..1343179,1343401..1343517,
FT                   1343678..1343766,1343847..1344038,1344128..1344238,
FT                   1344436..1344576,1345599..1345703,1345918..1346084,
FT                   1346349..1346478,1346564..1346645,1346728..1346896,
FT                   1346973..1347098,1347178..1347324,1347839..1347952,
FT                   1348315..1348510,1353820..1353878))
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, transcript variant mCT185510"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185510.0 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(1340701..1340910,1341005..1341100,
FT                   1342682..1342829,1343066..1343179,1343401..1343517,
FT                   1343678..1343766,1343847..1344038,1344128..1344238,
FT                   1344436..1344576,1345599..1345703,1345918..1346084,
FT                   1346349..1346478,1346564..1346645,1346728..1346896,
FT                   1346973..1347098,1347178..1347324,1347839..1347952,
FT                   1348315..1348510))
FT                   /codon_start=1
FT                   /gene="Pold1"
FT                   /locus_tag="mCG_8750"
FT                   /product="polymerase (DNA directed), delta 1, catalytic
FT                   subunit, isoform CRA_b"
FT                   /note="gene_id=mCG8750.3 transcript_id=mCT185510.0
FT                   protein_id=mCP106770.0 isoform=CRA_b"
FT                   /protein_id="EDL22730.1"
FT                   /translation="MDCKRRQGPGPGVPPKRARGHLWDEDEPSPSQFEANLALLEEIEA
FT                   ENRLQEAEEELQLPPEGTVGGQFSTADIDPRWRRPTLRALDPSTEPLIFQQLEIDHYVG
FT                   SAPPLPEGPLPSRNSVPILRAFGVTDEGFSVCCHIQGFAPYFYTPAPPGFGAEHLSELQ
FT                   QELNAAISRDQRGGKELSGPAVLAIELCSRESMFGYHGHGPSPFLRITLALPRLMAPAR
FT                   RLLEQGVRVPGLGTPSFAPYEANVDFEIRFMVDADIVGCNWLELPAGKYVRRAEKKATL
FT                   CQLEVDVLWSDVISHPPEGQWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGL
FT                   RWGEPEPFLRLALTLRPCAPILGAKVQSYEREEDLLQAWADFILAMDPDVITGYNIQNF
FT                   DLPYLISRAQALKVDRFPFLGRVTGLRSNIRDSSFQSRQVGRRDSKVISMVGRVQMDML
FT                   QVLLREHKLRSYTLNAVSFHFLGEQKEDVQHSIITDLQNGNEQTRRRLAVYCLKDAFLP
FT                   LRLLERLMVLVNNVEMARVTGVPLGYLLTRGQQVKVVSQLLRQAMRQGLLMPVVKTEGG
FT                   EDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLKPDEF
FT                   IKTPTGDEFVKSSVRKGLLPQILENLLSARKRAKAELAQETDPLRRQVLDGRQLALKVS
FT                   ANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTKQLVESKYTVENGYDANAKVVYGD
FT                   TDSVMCRFGVSSVAEAMSLGREAANWVSSHFPSPIRLEFEKVRASSVLSSVETLGVLSI
FT                   SDGLL"
FT   gene            complement(1354706..>1359013)
FT                   /gene="Nr1h2"
FT                   /locus_tag="mCG_8747"
FT                   /note="gene_id=mCG8747.2"
FT   mRNA            complement(join(1354706..1355196,1355365..1355573,
FT                   1355810..1355909,1356383..1356562,1356665..1356924,
FT                   1357020..1357301,1357572..1357685,1357762..1357819,
FT                   1358644..1358773,1358874..>1359013))
FT                   /gene="Nr1h2"
FT                   /locus_tag="mCG_8747"
FT                   /product="nuclear receptor subfamily 1, group H, member 2,
FT                   transcript variant mCT191733"
FT                   /note="gene_id=mCG8747.2 transcript_id=mCT191733.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1354714..1355196,1355365..1355573,
FT                   1355810..1355909,1356383..1356562,1356665..1356924,
FT                   1357020..1357310,1357572..1357685,1357762..1357822,
FT                   1358644..1358773,1358870..>1358988))
FT                   /gene="Nr1h2"
FT                   /locus_tag="mCG_8747"
FT                   /product="nuclear receptor subfamily 1, group H, member 2,
FT                   transcript variant mCT7215"
FT                   /note="gene_id=mCG8747.2 transcript_id=mCT7215.1 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(1355050..1355196,1355365..1355573,
FT                   1355810..1355909,1356383..1356562,1356665..1356924,
FT                   1357020..1357301,1357572..1357685,1357762..>1357807))
FT                   /codon_start=1
FT                   /gene="Nr1h2"
FT                   /locus_tag="mCG_8747"
FT                   /product="nuclear receptor subfamily 1, group H, member 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8747.2 transcript_id=mCT191733.0
FT                   protein_id=mCP112756.0 isoform=CRA_a"
FT                   /protein_id="EDL22735.1"
FT                   /translation="PTMSSPTSSLDTPVPGNGSPQPSTSATSPTIKEEGQETDPPPGSE
FT                   GSSSAYIVEPEDEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRS
FT                   VVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKRIQKQ
FT                   QQQQPPPPSEPAASSSGRPAASPGTSEASSQGSGEGEGIQLTAAQELMIQQLVAAQLQC
FT                   NKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGR
FT                   EDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEF
FT                   SRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQ
FT                   LRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE"
FT   CDS             complement(join(1355050..1355196,1355365..1355573,
FT                   1355810..1355909,1356383..1356562,1356665..1356924,
FT                   1357020..1357310,1357572..1357685,1357762..>1357807))
FT                   /codon_start=1
FT                   /gene="Nr1h2"
FT                   /locus_tag="mCG_8747"
FT                   /product="nuclear receptor subfamily 1, group H, member 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8747.2 transcript_id=mCT7215.1
FT                   protein_id=mCP1993.1 isoform=CRA_b"
FT                   /protein_id="EDL22736.1"
FT                   /translation="PTMSSPTSSLDTPVPGNGSPQPSTSATSPTIKEEGQETDPPPGSE
FT                   GSSSAYIVVILEPEDEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFF
FT                   RRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKRI
FT                   QKQQQQQPPPPSEPAASSSGRPAASPGTSEASSQGSGEGEGIQLTAAQELMIQQLVAAQ
FT                   LQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQ
FT                   LGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPI
FT                   FEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRP
FT                   QDQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE"
FT   gene            <1377306..1391649
FT                   /gene="Napsa"
FT                   /locus_tag="mCG_8745"
FT                   /note="gene_id=mCG8745.2"
FT   mRNA            join(<1377306..1377573,1386010..1386145,1386227..1386350,
FT                   1386489..1386607,1387148..1387347,1389805..1389927,
FT                   1390025..1390169,1390520..1390618,1391365..1391649)
FT                   /gene="Napsa"
FT                   /locus_tag="mCG_8745"
FT                   /product="napsin A aspartic peptidase, transcript variant
FT                   mCT7216"
FT                   /note="gene_id=mCG8745.2 transcript_id=mCT7216.2 created on
FT                   09-SEP-2002"
FT   mRNA            join(<1377306..1377573,1386010..1386145,1386227..1386350,
FT                   1386489..1386607,1387148..1387997)
FT                   /gene="Napsa"
FT                   /locus_tag="mCG_8745"
FT                   /product="napsin A aspartic peptidase, transcript variant
FT                   mCT173165"
FT                   /note="gene_id=mCG8745.2 transcript_id=mCT173165.0 created
FT                   on 09-SEP-2002"
FT   assembly_gap    1377574..1377756
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   CDS             join(<1386011..1386145,1386227..1386350,1386489..1386607,
FT                   1387148..1387347,1389805..1389927,1390025..1390169,
FT                   1390520..1390618,1391365..1391601)
FT                   /codon_start=1
FT                   /gene="Napsa"
FT                   /locus_tag="mCG_8745"
FT                   /product="napsin A aspartic peptidase, isoform CRA_a"
FT                   /note="gene_id=mCG8745.2 transcript_id=mCT7216.2
FT                   protein_id=mCP1989.2 isoform=CRA_a"
FT                   /protein_id="EDL22737.1"
FT                   /translation="VPLQRIHLGHRILNPLNGWEQLAELSRTSTSGGNPSFVPLSKFMN
FT                   TQYFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRPNG
FT                   TKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDGILGLGFPT
FT                   LAVGGVQPPLDAMVEQGLLEKPVFSFYLNRDSEGSDGGELVLGGSDPAHYVPPLTFIPV
FT                   TIPAYWQVHMESVKVGTGLSLCAQGCSAILDTGTSLITGPSEEIRALNKAIGGYPFLNG
FT                   QYFIQCSKTPTLPPVSFHLGGVWFNLTGQDYVIKILQSDVGLCLLGFQALDIPKPAGPL
FT                   WILGDVFLGPYVAVFDRGDKNVGPRVGLARAQSRATDRAERTTQAQFFKRRPG"
FT   CDS             join(<1386011..1386145,1386227..1386350,1386489..1386607,
FT                   1387148..1387405)
FT                   /codon_start=1
FT                   /gene="Napsa"
FT                   /locus_tag="mCG_8745"
FT                   /product="napsin A aspartic peptidase, isoform CRA_b"
FT                   /note="gene_id=mCG8745.2 transcript_id=mCT173165.0
FT                   protein_id=mCP96084.0 isoform=CRA_b"
FT                   /protein_id="EDL22738.1"
FT                   /translation="VPLQRIHLGHRILNPLNGWEQLAELSRTSTSGGNPSFVPLSKFMN
FT                   TQYFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRPNG
FT                   TKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDGILGLGFPT
FT                   LAVGGVQPPLDAMVEQGLLEKPVFSFYLNRYCVGITSIPGSANMAKIP"
FT   gene            <1395922..>1401366
FT                   /gene="Kcnc3"
FT                   /locus_tag="mCG_8743"
FT                   /note="gene_id=mCG8743.1"
FT   mRNA            join(<1395922..1396560,1399963..>1401366)
FT                   /gene="Kcnc3"
FT                   /locus_tag="mCG_8743"
FT                   /product="potassium voltage gated channel, Shaw-related
FT                   subfamily, member 3"
FT                   /note="gene_id=mCG8743.1 transcript_id=mCT7224.1 created on
FT                   31-MAY-2002"
FT   CDS             join(1395922..1396560,1399963..1401366)
FT                   /codon_start=1
FT                   /gene="Kcnc3"
FT                   /locus_tag="mCG_8743"
FT                   /product="potassium voltage gated channel, Shaw-related
FT                   subfamily, member 3"
FT                   /note="gene_id=mCG8743.1 transcript_id=mCT7224.1
FT                   protein_id=mCP1986.1"
FT                   /protein_id="EDL22739.1"
FT                   /translation="MGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLAGLTEPE
FT                   AAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETD
FT                   VEACCWMTYRQHRDAEEALDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGG
FT                   ELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFF
FT                   ILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVW
FT                   FTFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVR
FT                   FVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADP
FT                   DDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPV
FT                   PVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGI
FT                   SPPPPITPPSMGVNVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEV
FT                   IETNRAGEAGARTGGVGRSGGKVAGLEGMQGQGFLGSGRVGWEATADRKDKWLEGWRGG
FT                   TKSHRNRIPRTRACEHGFQPGCSQRPLVRSSRVRIFGERDSETQV"
FT   gene            complement(1410690..>1470597)
FT                   /gene="Myh14"
FT                   /locus_tag="mCG_134536"
FT                   /note="gene_id=mCG134536.1"
FT   mRNA            complement(join(1410690..1411250,1411518..1411690,
FT                   1413322..1413430,1416362..1416618,1418319..1418442,
FT                   1418526..1418614,1419177..1419305,1420229..1420390,
FT                   1420984..1421196,1426799..1427011,1428037..1428285,
FT                   1429139..1429291,1429381..1429485,1430025..1430231,
FT                   1430423..1430567,1432070..1432282,1433535..1433706,
FT                   1433832..1433955,1434327..1434464,1434923..1435129,
FT                   1435762..1435893,1436598..1436706,1437430..1437590,
FT                   1437982..1438051,1438522..1438643,1439406..1439593,
FT                   1442823..1442937,1443348..1443521,1444001..1444174,
FT                   1444294..1444446,1446118..1446236,1448521..1448616,
FT                   1457507..1457647,1459038..1459136,1460304..1460367,
FT                   1460674..1460766,1463029..1463131,1463308..1463335,
FT                   1466002..1466158,1470199..>1470591))
FT                   /gene="Myh14"
FT                   /locus_tag="mCG_134536"
FT                   /product="myosin, heavy polypeptide 14, transcript variant
FT                   mCT135924"
FT                   /note="gene_id=mCG134536.1 transcript_id=mCT135924.0
FT                   created on 31-MAY-2002"
FT   mRNA            complement(join(1410706..1411250,1411518..1411690,
FT                   1413322..1413430,1416410..1416618,1418319..1418442,
FT                   1418526..1418614,1419177..1419305,1420229..1420390,
FT                   1420984..1421196,1426799..1427011,1428037..1428285,
FT                   1429139..1429291,1429381..1429485,1430025..1430231,
FT                   1430423..1430567,1432070..1432282,1433535..1433706,
FT                   1433832..1433955,1434327..1434464,1434923..1435129,
FT                   1435762..1435893,1436598..1436706,1437430..1437590,
FT                   1437982..1438051,1438522..1438643,1439406..1439593,
FT                   1442823..1442937,1443348..1443521,1444001..1444174,
FT                   1444294..1444446,1446118..1446236,1448521..1448616,
FT                   1457507..1457647,1459038..1459136,1460304..1460367,
FT                   1460674..1460766,1463029..1463131,1463308..1463335,
FT                   1466002..1466158,1470199..>1470597))
FT                   /gene="Myh14"
FT                   /locus_tag="mCG_134536"
FT                   /product="myosin, heavy polypeptide 14, transcript variant
FT                   mCT191759"
FT                   /note="gene_id=mCG134536.1 transcript_id=mCT191759.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1411097..1411250,1411518..1411690,
FT                   1413322..1413430,1416410..1416618,1418319..1418442,
FT                   1418526..1418614,1419177..1419305,1420229..1420390,
FT                   1420984..1421196,1426799..1427011,1428037..1428285,
FT                   1429139..1429291,1429381..1429485,1430025..1430231,
FT                   1430423..1430567,1432070..1432282,1433535..1433706,
FT                   1433832..1433955,1434327..1434464,1434923..1435129,
FT                   1435762..1435893,1436598..1436706,1437430..1437590,
FT                   1437982..1438051,1438522..1438643,1439406..1439593,
FT                   1442823..1442937,1443348..1443521,1444001..1444174,
FT                   1444294..1444446,1446118..1446236,1448521..1448616,
FT                   1457507..1457647,1459038..1459136,1460304..1460367,
FT                   1460674..1460766,1463029..1463131,1463308..1463335,
FT                   1466002..1466158,1470199..>1470597))
FT                   /codon_start=1
FT                   /gene="Myh14"
FT                   /locus_tag="mCG_134536"
FT                   /product="myosin, heavy polypeptide 14, isoform CRA_b"
FT                   /note="gene_id=mCG134536.1 transcript_id=mCT191759.0
FT                   protein_id=mCP112695.0 isoform=CRA_b"
FT                   /protein_id="EDL22741.1"
FT                   /translation="QTMAAVTMSVSGRKVASRPGPVPEAAQSFLYAPRTPNVGGPGGPQ
FT                   VEWTARRMVWVPSELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSK
FT                   AEDMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGK
FT                   KRHEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKG
FT                   RKEPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDIAGYIVGANIET
FT                   YLLEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQER
FT                   ELFQETLESLRVLGLLPEEITAMLRTVSAVLQFGNIVLKKERNTDQATMPDNTAAQKLC
FT                   RLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLN
FT                   RALDRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQ
FT                   REGIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGS
FT                   HPKFQRPRNLRDQADFSVLHYAGKVDYKASEWLMKNMDPLNDNVAALLHQSTDRLTAEI
FT                   WKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCI
FT                   VPNHEKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPK
FT                   GFMDGKQACEKMIQALELDPNLYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAA
FT                   RGYLARRAFQRRQQQQSALRVMQRNCAAYLKLRNWQWWRLFIKVKPLLQVTRQDEVLQA
FT                   RAQELQKVQELQQQSAREVGELQGRVAQLEEERTRLAEQLRAEAELCSEAEETRARLAA
FT                   RKQELELVVTELEARVGEEEECSRQLQSEKKRLQQHIQELESHLEAEEGARQKLQLEKV
FT                   TTEAKMKKFEEDLLLLEDQNSKLSKERRLLEERLAEFSSQAAEEEEKVKSLNKLRLKYE
FT                   ATISDMEDRLKKEEKGRQELEKLKRRLDGESSELQEQMVEQKQRAEELLAQLGRKEDEL
FT                   QAALLRAEEEGGARAQLLKSLREAQAGLAEAQEDLEAERVARAKAEKQRRDLGEELEAL
FT                   RGELEDTLDSTNAQQELRSKREQEVTELKKALEEESRAHEVSMQELRQRHSQALVEMAE
FT                   QLEQARRGKGVWEKTRLSLEAEVSELKAELSSLQTSRQEGEQKRRRLESQLQEVQGRSS
FT                   DSERARSEAAEKLQRAQAELESVSTALSEAESKAIRLGKELSSAESQLHDTQELLQEET
FT                   RAKLALGSRVRALEAEAAGLREQMEEEVVARERAGRELQSTQAQLSEWRRRQEEEAAVL
FT                   EAGEEARRRAAREAETLTQRLAEKTEAVERLERARRRLQQELDDATVDLGQQKQLLSTL
FT                   EKKQRKFDQLLAEEKAAVLRAVEDRERIEAEGREREARALSLTRALEEEQEAREELERQ
FT                   NRALRAELEALLSSKDDVGKNVHELERARKAAEQAASDLRTQVTELEDELTAAEDAKLR
FT                   LEVTVQALKAQHERDLQGRDDAGEERRRQLAKQLRDAEVERDEERKQRALAMAARKKLE
FT                   LELEELKAQTSAAGQGKEEAVKQLKKMQVQMKELWREVEETRSSRDEMFTLSRENEKKL
FT                   KGLEAEVLRLQEELAASDRARRQAQQDRDEMAEEVASGNLSKAATLEEKRQLEGRLSQL
FT                   EEELEEEQNNSELLKDHYRKLVLQVESLTTELSAERSFSAKAESGRQQLERQIQELRAR
FT                   LGEEDAGARARQKMLIAALESKLAQAEEQLEQESRERILSGKLVRRAEKRLKEVVLQVD
FT                   EERRVADQVRDQLEKSNLRLKQLKRQLEEAEEEASRAQAGRRRLQRELEDVTESAESMN
FT                   REVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEEAEGAEPGSAPGQEPEAPPPAT
FT                   PQ"
FT   CDS             complement(join(1411097..1411250,1411518..1411690,
FT                   1413322..1413430,1416362..1416618,1418319..1418442,
FT                   1418526..1418614,1419177..1419305,1420229..1420390,
FT                   1420984..1421196,1426799..1427011,1428037..1428285,
FT                   1429139..1429291,1429381..1429485,1430025..1430231,
FT                   1430423..1430567,1432070..1432282,1433535..1433706,
FT                   1433832..1433955,1434327..1434464,1434923..1435129,
FT                   1435762..1435893,1436598..1436706,1437430..1437590,
FT                   1437982..1438051,1438522..1438643,1439406..1439593,
FT                   1442823..1442937,1443348..1443521,1444001..1444174,
FT                   1444294..1444446,1446118..1446236,1448521..1448616,
FT                   1457507..1457647,1459038..1459136,1460304..1460367,
FT                   1460674..1460766,1463029..1463131,1463308..1463335,
FT                   1466002..1466158,1470199..1470591))
FT                   /codon_start=1
FT                   /gene="Myh14"
FT                   /locus_tag="mCG_134536"
FT                   /product="myosin, heavy polypeptide 14, isoform CRA_a"
FT                   /note="gene_id=mCG134536.1 transcript_id=mCT135924.0
FT                   protein_id=mCP63619.0 isoform=CRA_a"
FT                   /protein_id="EDL22740.1"
FT                   /translation="MAAVTMSVSGRKVASRPGPVPEAAQSFLYAPRTPNVGGPGGPQVE
FT                   WTARRMVWVPSELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAE
FT                   DMAELTCLNEASVLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKR
FT                   HEVPPHVYAVTEGAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRK
FT                   EPGVPGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDIAGYIVGANIETYL
FT                   LEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQEREL
FT                   FQETLESLRVLGLLPEEITAMLRTVSAVLQFGNIVLKKERNTDQATMPDNTAAQKLCRL
FT                   LGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRA
FT                   LDRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQRE
FT                   GIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGSHP
FT                   KFQRPRNLRDQADFSVLHYAGKVDYKASEWLMKNMDPLNDNVAALLHQSTDRLTAEIWK
FT                   DVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVP
FT                   NHEKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGF
FT                   MDGKQACEKMIQALELDPNLYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARG
FT                   YLARRAFQRRQQQQSALRVMQRNCAAYLKLRNWQWWRLFIKVKPLLQVTRQDEVLQARA
FT                   QELQKVQELQQQSAREVGELQGRVAQLEEERTRLAEQLRAEAELCSEAEETRARLAARK
FT                   QELELVVTELEARVGEEEECSRQLQSEKKRLQQHIQELESHLEAEEGARQKLQLEKVTT
FT                   EAKMKKFEEDLLLLEDQNSKLSKERRLLEERLAEFSSQAAEEEEKVKSLNKLRLKYEAT
FT                   ISDMEDRLKKEEKGRQELEKLKRRLDGESSELQEQMVEQKQRAEELLAQLGRKEDELQA
FT                   ALLRAEEEGGARAQLLKSLREAQAGLAEAQEDLEAERVARAKAEKQRRDLGEELEALRG
FT                   ELEDTLDSTNAQQELRSKREQEVTELKKALEEESRAHEVSMQELRQRHSQALVEMAEQL
FT                   EQARRGKGVWEKTRLSLEAEVSELKAELSSLQTSRQEGEQKRRRLESQLQEVQGRSSDS
FT                   ERARSEAAEKLQRAQAELESVSTALSEAESKAIRLGKELSSAESQLHDTQELLQEETRA
FT                   KLALGSRVRALEAEAAGLREQMEEEVVARERAGRELQSTQAQLSEWRRRQEEEAAVLEA
FT                   GEEARRRAAREAETLTQRLAEKTEAVERLERARRRLQQELDDATVDLGQQKQLLSTLEK
FT                   KQRKFDQLLAEEKAAVLRAVEDRERIEAEGREREARALSLTRALEEEQEAREELERQNR
FT                   ALRAELEALLSSKDDVGKNVHELERARKAAEQAASDLRTQVTELEDELTAAEDAKLRLE
FT                   VTVQALKAQHERDLQGRDDAGEERRRQLAKQLRDAEVERDEERKQRALAMAARKKLELE
FT                   LEELKAQTSAAGQGKEEAVKQLKKMQVQMKELWREVEETRSSRDEMFTLSRENEKKLKG
FT                   LEAEVLRLQEELAASDRARRQAQQDRDEMAEEVASGNLSKAATLEEKRQLEGRLSQLEE
FT                   ELEEEQNNSELLKDHYRKLVLQVESLTTELSAERSFSAKAESGRQQLERQIQELRARLG
FT                   EEDAGARARQKMLIAALESKLAQAEEQLEQESRQGGSILWHGSNSVHGEERILSGKLVR
FT                   RAEKRLKEVVLQVDEERRVADQVRDQLEKSNLRLKQLKRQLEEAEEEASRAQAGRRRLQ
FT                   RELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEEAEGAEPG
FT                   SAPGQEPEAPPPATPQ"
FT   assembly_gap    1471357..1471376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1481781..1483052
FT                   /locus_tag="mCG_147777"
FT                   /note="gene_id=mCG147777.0"
FT   mRNA            join(1481781..1482178,1482569..1483052)
FT                   /locus_tag="mCG_147777"
FT                   /product="mCG147777"
FT                   /note="gene_id=mCG147777.0 transcript_id=mCT188040.0
FT                   created on 13-JAN-2004"
FT   CDS             join(1481820..1482178,1482569..1482728)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147777"
FT                   /product="mCG147777"
FT                   /note="gene_id=mCG147777.0 transcript_id=mCT188040.0
FT                   protein_id=mCP109086.0"
FT                   /db_xref="GOA:Q9D7B4"
FT                   /db_xref="InterPro:IPR015585"
FT                   /db_xref="MGI:MGI:1916828"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D7B4"
FT                   /protein_id="EDL22742.1"
FT                   /translation="MTEETETETIPSLSSTDSNSAPTLEQFLELMRHFTTDPDPNEETV
FT                   EVSADSFKMTKGGTRIRFLYARREMGLKQLSVVHTSELESREHSFLSQFVRSDGSDSGL
FT                   RIRLMFPILWHKDWERVTVALGQQVGKPSLGISEDGKQKDLLTWLPGRRQDAGHLWPHP
FT                   VHLSLWMHI"
FT   gene            1513629..1524853
FT                   /locus_tag="mCG_23136"
FT                   /note="gene_id=mCG23136.2"
FT   mRNA            join(1513629..1513819,1513905..1513979,1515084..1515188,
FT                   1520337..1520460,1524752..1524843)
FT                   /locus_tag="mCG_23136"
FT                   /product="mCG23136, transcript variant mCT185812"
FT                   /note="gene_id=mCG23136.2 transcript_id=mCT185812.0 created
FT                   on 17-JUN-2003"
FT   mRNA            join(1513632..1513819,1513905..1513979,1515084..1515170,
FT                   1515343..1515363,1517858..1517938,1520337..1520460,
FT                   1524767..1524853)
FT                   /locus_tag="mCG_23136"
FT                   /product="mCG23136, transcript variant mCT23289"
FT                   /note="gene_id=mCG23136.2 transcript_id=mCT23289.2 created
FT                   on 17-JUN-2003"
FT   mRNA            join(1513632..1513819,1513905..1513979,1515084..1515170,
FT                   1515343..1515363,1520337..1520460,1524752..1524837)
FT                   /locus_tag="mCG_23136"
FT                   /product="mCG23136, transcript variant mCT181310"
FT                   /note="gene_id=mCG23136.2 transcript_id=mCT181310.1 created
FT                   on 17-JUN-2003"
FT   CDS             join(1515164..1515188,1520337..1520460,1524752..1524794)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23136"
FT                   /product="mCG23136, isoform CRA_b"
FT                   /note="gene_id=mCG23136.2 transcript_id=mCT185812.0
FT                   protein_id=mCP107070.0 isoform=CRA_b"
FT                   /protein_id="EDL22744.1"
FT                   /translation="MKGAAAPSQDGQFRMTLKFQDDNKPRNMVLVGDLVTVGLAILTFL
FT                   VILIAACTYRQNRKLLLK"
FT   CDS             join(1515164..1515170,1515343..1515363,1517858..1517938,
FT                   1520337..1520460,1524767..1524794)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23136"
FT                   /product="mCG23136, isoform CRA_c"
FT                   /note="gene_id=mCG23136.2 transcript_id=mCT23289.2
FT                   protein_id=mCP22768.2 isoform=CRA_c"
FT                   /protein_id="EDL22745.1"
FT                   /translation="MKACDHKTCHSFKAEVLDCLYCKKTMPKCVKKKYCFEDGQFRMTL
FT                   KFQDDNKPRNMVLVGDLVTVGLAILTFLVILIAQNRKLLLK"
FT   CDS             join(1515164..1515170,1515343..1515363,1520337..1520460,
FT                   1524752..1524794)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23136"
FT                   /product="mCG23136, isoform CRA_a"
FT                   /note="gene_id=mCG23136.2 transcript_id=mCT181310.1
FT                   protein_id=mCP104232.0 isoform=CRA_a"
FT                   /protein_id="EDL22743.1"
FT                   /translation="MKACDHKTCQDGQFRMTLKFQDDNKPRNMVLVGDLVTVGLAILTF
FT                   LVILIAACTYRQNRKLLLK"
FT   gene            complement(1536498..>1553869)
FT                   /gene="Zfp473"
FT                   /locus_tag="mCG_145356"
FT                   /note="gene_id=mCG145356.0"
FT   mRNA            complement(join(1536498..1539652,1543042..1543110,
FT                   1544755..1544887,1546941..1547117,1553604..>1553869))
FT                   /gene="Zfp473"
FT                   /locus_tag="mCG_145356"
FT                   /product="zinc finger protein 473, transcript variant
FT                   mCT184780"
FT                   /note="gene_id=mCG145356.0 transcript_id=mCT184780.0
FT                   created on 05-JUN-2003"
FT   mRNA            complement(join(1536520..1539652,1543042..1543110,
FT                   1544755..1544887,1546941..1547117,1553188..>1553301))
FT                   /gene="Zfp473"
FT                   /locus_tag="mCG_145356"
FT                   /product="zinc finger protein 473, transcript variant
FT                   mCT191770"
FT                   /note="gene_id=mCG145356.0 transcript_id=mCT191770.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(1537016..1539652,1543042..1543107,
FT                   1544755..1544887,1546941..1547117,1553481..>1553559))
FT                   /gene="Zfp473"
FT                   /locus_tag="mCG_145356"
FT                   /product="zinc finger protein 473, transcript variant
FT                   mCT191771"
FT                   /note="gene_id=mCG145356.0 transcript_id=mCT191771.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1537236..1539652,1543042..1543107,
FT                   1544755..1544887,1546941..>1547039))
FT                   /codon_start=1
FT                   /gene="Zfp473"
FT                   /locus_tag="mCG_145356"
FT                   /product="zinc finger protein 473, isoform CRA_b"
FT                   /note="gene_id=mCG145356.0 transcript_id=mCT191771.0
FT                   protein_id=mCP112701.0 isoform=CRA_b"
FT                   /protein_id="EDL22748.1"
FT                   /translation="KDGRLSAALLAGTMERKEDDLKGGCWNQPAVAEEFETLKDLAMDF
FT                   TVEDWKDLESEWDQRDLFWDVTLNHYQDMFSFNTSQPSLTSQPDVREELEATSTEVPET
FT                   KSSPLQSGFVEEDFSQIMEIFSNGQLNFEACIGEDWLNSFLGDPESLPRPDISDKESPA
FT                   DHQSPESKSGLSPGPPLCTREDAVMSASPEKTLTPVILKESRSDLSQEDSVQGHEKPYK
FT                   CSECGESFSQSHHLIQHWVLHTSGEPPIWREQQRGLSQGAHFPMCPGTPASYESYTCQE
FT                   CGKRFSQNVYLQWHQKIHTGEKLCKTQSDSNLEGLSRSPSVEPGKQRLSKDTDSAKPST
FT                   IHGQDQEKPPTGESRDQENLHESQPGDRPSVLHPKPLRHQKTPTNAKCFRCKKCGETFS
FT                   GAFHLAKHQRAHAQRLYKCASCPAVFNLSKHCFQHRKSHFPSAACECQGCRKSFNWRSS
FT                   LIKHQAIHKGEKPYKCDECGKAFNHSSTLKIHQRIHSGQKPHKCSECGKAFCRRTDLTE
FT                   HQRVHSGFRPHQCPVCARTFNRPSHLVRHRLRHAEERHFGCAKCKETFIYKEQLERHNK
FT                   IHTIEGLYECKQCGEHFICRSTLNCHLSIHIRENTSEKVVGQNSQHTEKCFKNTKCRKA
FT                   PNHSRYLGQHEKIHAQVTSGECDPCGETYDQSVQPICHQSICAGVKPSECAEPEKCTRN
FT                   TSASEHHPSQREPSFKCDIYNRAFKQRAHLSKHQLIHITEKPFKCNECDRAFKQSNYLI
FT                   QHQKTHTAEKHFECSECGKTFHQRSCLSKHQKIHSGEKPFKCGDCGKAFISGAQLIRHQ
FT                   RIHTGEKPYVCQECGKTFSQSSCLTLHLRIHTGEKPYTCGTCGKAFAQRANQRKHERIH
FT                   TGEKPYACGLCGKAFGLRTHLQQHQRIHTKAKP"
FT   CDS             complement(join(1537236..1539652,1543042..1543110,
FT                   1544755..1544887,1546941..>1547039))
FT                   /codon_start=1
FT                   /gene="Zfp473"
FT                   /locus_tag="mCG_145356"
FT                   /product="zinc finger protein 473, isoform CRA_a"
FT                   /note="gene_id=mCG145356.0 transcript_id=mCT184780.0
FT                   protein_id=mCP105459.0 isoform=CRA_a"
FT                   /protein_id="EDL22746.1"
FT                   /translation="KDGRLSAALLAGTMERKEDDLKGGCWNQPAVAEEFETLKDLAMDF
FT                   TVEDWKDLESEWDQRDLFWDVTLNHYQDMFSFTDTSQPSLTSQPDVREELEATSTEVPE
FT                   TKSSPLQSGFVEEDFSQIMEIFSNGQLNFEACIGEDWLNSFLGDPESLPRPDISDKESP
FT                   ADHQSPESKSGLSPGPPLCTREDAVMSASPEKTLTPVILKESRSDLSQEDSVQGHEKPY
FT                   KCSECGESFSQSHHLIQHWVLHTSGEPPIWREQQRGLSQGAHFPMCPGTPASYESYTCQ
FT                   ECGKRFSQNVYLQWHQKIHTGEKLCKTQSDSNLEGLSRSPSVEPGKQRLSKDTDSAKPS
FT                   TIHGQDQEKPPTGESRDQENLHESQPGDRPSVLHPKPLRHQKTPTNAKCFRCKKCGETF
FT                   SGAFHLAKHQRAHAQRLYKCASCPAVFNLSKHCFQHRKSHFPSAACECQGCRKSFNWRS
FT                   SLIKHQAIHKGEKPYKCDECGKAFNHSSTLKIHQRIHSGQKPHKCSECGKAFCRRTDLT
FT                   EHQRVHSGFRPHQCPVCARTFNRPSHLVRHRLRHAEERHFGCAKCKETFIYKEQLERHN
FT                   KIHTIEGLYECKQCGEHFICRSTLNCHLSIHIRENTSEKVVGQNSQHTEKCFKNTKCRK
FT                   APNHSRYLGQHEKIHAQVTSGECDPCGETYDQSVQPICHQSICAGVKPSECAEPEKCTR
FT                   NTSASEHHPSQREPSFKCDIYNRAFKQRAHLSKHQLIHITEKPFKCNECDRAFKQSNYL
FT                   IQHQKTHTAEKHFECSECGKTFHQRSCLSKHQKIHSGEKPFKCGDCGKAFISGAQLIRH
FT                   QRIHTGEKPYVCQECGKTFSQSSCLTLHLRIHTGEKPYTCGTCGKAFAQRANQRKHERI
FT                   HTGEKPYACGLCGKAFGLRTHLQQHQRIHTKAKP"
FT   CDS             complement(join(1537236..1539652,1543042..1543110,
FT                   1544755..1544887,1546941..>1547039))
FT                   /codon_start=1
FT                   /gene="Zfp473"
FT                   /locus_tag="mCG_145356"
FT                   /product="zinc finger protein 473, isoform CRA_a"
FT                   /note="gene_id=mCG145356.0 transcript_id=mCT191770.0
FT                   protein_id=mCP112700.0 isoform=CRA_a"
FT                   /protein_id="EDL22747.1"
FT                   /translation="KDGRLSAALLAGTMERKEDDLKGGCWNQPAVAEEFETLKDLAMDF
FT                   TVEDWKDLESEWDQRDLFWDVTLNHYQDMFSFTDTSQPSLTSQPDVREELEATSTEVPE
FT                   TKSSPLQSGFVEEDFSQIMEIFSNGQLNFEACIGEDWLNSFLGDPESLPRPDISDKESP
FT                   ADHQSPESKSGLSPGPPLCTREDAVMSASPEKTLTPVILKESRSDLSQEDSVQGHEKPY
FT                   KCSECGESFSQSHHLIQHWVLHTSGEPPIWREQQRGLSQGAHFPMCPGTPASYESYTCQ
FT                   ECGKRFSQNVYLQWHQKIHTGEKLCKTQSDSNLEGLSRSPSVEPGKQRLSKDTDSAKPS
FT                   TIHGQDQEKPPTGESRDQENLHESQPGDRPSVLHPKPLRHQKTPTNAKCFRCKKCGETF
FT                   SGAFHLAKHQRAHAQRLYKCASCPAVFNLSKHCFQHRKSHFPSAACECQGCRKSFNWRS
FT                   SLIKHQAIHKGEKPYKCDECGKAFNHSSTLKIHQRIHSGQKPHKCSECGKAFCRRTDLT
FT                   EHQRVHSGFRPHQCPVCARTFNRPSHLVRHRLRHAEERHFGCAKCKETFIYKEQLERHN
FT                   KIHTIEGLYECKQCGEHFICRSTLNCHLSIHIRENTSEKVVGQNSQHTEKCFKNTKCRK
FT                   APNHSRYLGQHEKIHAQVTSGECDPCGETYDQSVQPICHQSICAGVKPSECAEPEKCTR
FT                   NTSASEHHPSQREPSFKCDIYNRAFKQRAHLSKHQLIHITEKPFKCNECDRAFKQSNYL
FT                   IQHQKTHTAEKHFECSECGKTFHQRSCLSKHQKIHSGEKPFKCGDCGKAFISGAQLIRH
FT                   QRIHTGEKPYVCQECGKTFSQSSCLTLHLRIHTGEKPYTCGTCGKAFAQRANQRKHERI
FT                   HTGEKPYACGLCGKAFGLRTHLQQHQRIHTKAKP"
FT   gene            <1557356..1582767
FT                   /gene="Vrk3"
FT                   /locus_tag="mCG_23131"
FT                   /note="gene_id=mCG23131.1"
FT   mRNA            join(<1557356..1557428,1559068..1559207,1564952..1565146,
FT                   1566130..1566194,1568243..1568309,1569377..1569461,
FT                   1570035..1570140,1572374..1572466,1573695..1573827,
FT                   1574785..1574905,1576116..1576174,1580628..1580787,
FT                   1582474..1582767)
FT                   /gene="Vrk3"
FT                   /locus_tag="mCG_23131"
FT                   /product="vaccinia related kinase 3, transcript variant
FT                   mCT23157"
FT                   /note="gene_id=mCG23131.1 transcript_id=mCT23157.1 created
FT                   on 04-JUN-2002"
FT   mRNA            join(<1557361..1557428,1559068..1559207,1562998..1563147,
FT                   1564952..1565146,1566130..1566194,1568243..1568309,
FT                   1569377..1569461,1570035..1570140,1572374..1572466,
FT                   1573695..1573827,1574785..1574905,1576116..1576174,
FT                   1580628..1580787,1582474..1582764)
FT                   /gene="Vrk3"
FT                   /locus_tag="mCG_23131"
FT                   /product="vaccinia related kinase 3, transcript variant
FT                   mCT191772"
FT                   /note="gene_id=mCG23131.1 transcript_id=mCT191772.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<1557365..1557428,1559068..1559207,1562998..1563147,
FT                   1564952..1565146,1568243..1568309,1569377..1569461,
FT                   1570035..1570140,1572374..1572466,1573695..1573827,
FT                   1574785..1574905,1576116..1576174,1582474..1582764)
FT                   /gene="Vrk3"
FT                   /locus_tag="mCG_23131"
FT                   /product="vaccinia related kinase 3, transcript variant
FT                   mCT191773"
FT                   /note="gene_id=mCG23131.1 transcript_id=mCT191773.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1557400..1557428,1559068..1559207,1562998..1563147,
FT                   1564952..1565146,1566130..1566194,1568243..1568309,
FT                   1569377..1569461,1570035..1570140,1572374..1572466,
FT                   1573695..1573827,1574785..1574905,1576116..1576174,
FT                   1580628..1580776)
FT                   /codon_start=1
FT                   /gene="Vrk3"
FT                   /locus_tag="mCG_23131"
FT                   /product="vaccinia related kinase 3, isoform CRA_a"
FT                   /note="gene_id=mCG23131.1 transcript_id=mCT191772.0
FT                   protein_id=mCP112716.0 isoform=CRA_a"
FT                   /protein_id="EDL22749.1"
FT                   /translation="SKDQTPRPQSMISFCPVCGKSVKVSFKFCPYCGKALPVEEDGGTQ
FT                   SAVTPHVSSVPGSRRDLNSSFETSPKKVKCSHTVTSLPLSRHSDCDSSGSDNTLTSPDR
FT                   ATGTRSRPLTPKGSPLSNRQSPQTLKRTRVTTSLQALATGTELTDQNGKHWTLGALQIR
FT                   DDQGILYEAEPTSAVPSESRTQKWRFSLKLDSKDGRLFNEQNFFQRVAKPLQVNKWKKQ
FT                   FLLPLLAIPTCIGFGIHQDKYRFLVFPSLGRSLQSALDDNPKHVVSERCVLQVACRLLD
FT                   ALEYLHENEYVHGNLTAENVFVNPEDLSQVTLVGYGFTYRYCPGGKHVAYKEGSRSPHD
FT                   GDLEFISMDLHKGCGPSRRSDLQTLGYCMLKWLYGSLPWTNCLPNTEKITRQKQKYLDS
FT                   PERLVGLCGRWNKASETLREYLKVVMALNYEEKPPYATLRNSLEALLQDMRVSPYDPLD
FT                   LQMVP"
FT   CDS             join(<1557400..1557428,1559068..1559207,1564952..1565146,
FT                   1566130..1566194,1568243..1568309,1569377..1569461,
FT                   1570035..1570140,1572374..1572466,1573695..1573827,
FT                   1574785..1574905,1576116..1576174,1580628..1580776)
FT                   /codon_start=1
FT                   /gene="Vrk3"
FT                   /locus_tag="mCG_23131"
FT                   /product="vaccinia related kinase 3, isoform CRA_c"
FT                   /note="gene_id=mCG23131.1 transcript_id=mCT23157.1
FT                   protein_id=mCP22775.1 isoform=CRA_c"
FT                   /protein_id="EDL22751.1"
FT                   /translation="SKDQTPRPQSMISFCPVCGKSVKVSFKFCPYCGKALPVEEDGGTQ
FT                   SAVTPHVSSVPGTRSRPLTPKGSPLSNRQSPQTLKRTRVTTSLQALATGTELTDQNGKH
FT                   WTLGALQIRDDQGILYEAEPTSAVPSESRTQKWRFSLKLDSKDGRLFNEQNFFQRVAKP
FT                   LQVNKWKKQFLLPLLAIPTCIGFGIHQDKYRFLVFPSLGRSLQSALDDNPKHVVSERCV
FT                   LQVACRLLDALEYLHENEYVHGNLTAENVFVNPEDLSQVTLVGYGFTYRYCPGGKHVAY
FT                   KEGSRSPHDGDLEFISMDLHKGCGPSRRSDLQTLGYCMLKWLYGSLPWTNCLPNTEKIT
FT                   RQKQKYLDSPERLVGLCGRWNKASETLREYLKVVMALNYEEKPPYATLRNSLEALLQDM
FT                   RVSPYDPLDLQMVP"
FT   CDS             join(<1565075..1565146,1568243..1568309,1569377..1569461,
FT                   1570035..1570140,1572374..1572466,1573695..1573827,
FT                   1574785..1574905,1576116..1576174,1582474..1582499)
FT                   /codon_start=1
FT                   /gene="Vrk3"
FT                   /locus_tag="mCG_23131"
FT                   /product="vaccinia related kinase 3, isoform CRA_b"
FT                   /note="gene_id=mCG23131.1 transcript_id=mCT191773.0
FT                   protein_id=mCP112717.0 isoform=CRA_b"
FT                   /protein_id="EDL22750.1"
FT                   /translation="QTRMGNTGPWGPCRSGMTKAFSMKDSKDGRLFNEQNFFQRVAKPL
FT                   QVNKWKKQFLLPLLAIPTCIGFGIHQDKYRFLVFPSLGRSLQSALDDNPKHVVSERCVL
FT                   QVACRLLDALEYLHENEYVHGNLTAENVFVNPEDLSQVTLVGYGFTYRYCPGGKHVAYK
FT                   EGSRSPHDGDLEFISMDLHKGCGPSRRSDLQTLGYCMLKWLYGSLPWTNCLPNTEKITR
FT                   QKQKYLDSPERLVGLCGRWNKASELPTCSLK"
FT   gene            complement(1595281..>1596041)
FT                   /locus_tag="mCG_23128"
FT                   /note="gene_id=mCG23128.1"
FT   mRNA            complement(join(1595281..1595564,1595638..1595893,
FT                   1595994..>1596041))
FT                   /locus_tag="mCG_23128"
FT                   /product="mCG23128"
FT                   /note="gene_id=mCG23128.1 transcript_id=mCT23154.1 created
FT                   on 04-JUN-2002"
FT   CDS             complement(join(1595417..1595564,1595638..1595893,
FT                   1595994..>1596039))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23128"
FT                   /product="mCG23128"
FT                   /note="gene_id=mCG23128.1 transcript_id=mCT23154.1
FT                   protein_id=mCP22708.1"
FT                   /protein_id="EDL22752.1"
FT                   /translation="PPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPP
FT                   ANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLCALLAP
FT                   DVQPLLLLGGRGSALQLLLQSLACPLPALAAGGGSQVRGLWGPRV"
FT   gene            complement(1617506..1621829)
FT                   /gene="Atf5"
FT                   /locus_tag="mCG_23130"
FT                   /note="gene_id=mCG23130.2"
FT   mRNA            complement(join(1617506..1618768,1620221..1620514,
FT                   1621634..1621829))
FT                   /gene="Atf5"
FT                   /locus_tag="mCG_23130"
FT                   /product="activating transcription factor 5, transcript
FT                   variant mCT23156"
FT                   /note="gene_id=mCG23130.2 transcript_id=mCT23156.2 created
FT                   on 28-MAY-2003"
FT   mRNA            complement(join(1617506..1618768,1620221..1620514,
FT                   1620714..1620890))
FT                   /gene="Atf5"
FT                   /locus_tag="mCG_23130"
FT                   /product="activating transcription factor 5, transcript
FT                   variant mCT182220"
FT                   /note="gene_id=mCG23130.2 transcript_id=mCT182220.0 created
FT                   on 28-MAY-2003"
FT   CDS             complement(join(1618095..1618768,1620221..1620398))
FT                   /codon_start=1
FT                   /gene="Atf5"
FT                   /locus_tag="mCG_23130"
FT                   /product="activating transcription factor 5, isoform CRA_a"
FT                   /note="gene_id=mCG23130.2 transcript_id=mCT182220.0
FT                   protein_id=mCP105116.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UJF3"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR029855"
FT                   /db_xref="MGI:MGI:2141857"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJF3"
FT                   /protein_id="EDL22753.1"
FT                   /translation="MSLLATLGLELDRALLPASGLGWLVDYGKLPLAPAPLGPYEVLGG
FT                   ALEGGLPGGGEPLAGDGFSDWMTERVDFTALLPLEAPLPPGTLPPPSPAPPDLEAMASL
FT                   LKKELEQMEDFFLDAPLLPPPSPPPPPPPAAAPSLPLPLPLPTFDLPQPPTLDTLDLLA
FT                   VYCRSEAGPGDSGLSTLPVPQQPPPLAPLPSPARPAPYPSPASTRGDRKQKKRDQNKSA
FT                   ALRYRQRKRAEGEALEGECQGLEARNRELRERAESVEREIQYVKDLLIEVYKARSQRTR
FT                   ST"
FT   CDS             complement(join(1618095..1618768,1620221..1620398))
FT                   /codon_start=1
FT                   /gene="Atf5"
FT                   /locus_tag="mCG_23130"
FT                   /product="activating transcription factor 5, isoform CRA_a"
FT                   /note="gene_id=mCG23130.2 transcript_id=mCT23156.2
FT                   protein_id=mCP22697.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UJF3"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR029855"
FT                   /db_xref="MGI:MGI:2141857"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UJF3"
FT                   /protein_id="EDL22754.1"
FT                   /translation="MSLLATLGLELDRALLPASGLGWLVDYGKLPLAPAPLGPYEVLGG
FT                   ALEGGLPGGGEPLAGDGFSDWMTERVDFTALLPLEAPLPPGTLPPPSPAPPDLEAMASL
FT                   LKKELEQMEDFFLDAPLLPPPSPPPPPPPAAAPSLPLPLPLPTFDLPQPPTLDTLDLLA
FT                   VYCRSEAGPGDSGLSTLPVPQQPPPLAPLPSPARPAPYPSPASTRGDRKQKKRDQNKSA
FT                   ALRYRQRKRAEGEALEGECQGLEARNRELRERAESVEREIQYVKDLLIEVYKARSQRTR
FT                   ST"
FT   gene            <1633713..>1635370
FT                   /locus_tag="mCG_23139"
FT                   /note="gene_id=mCG23139.1"
FT   mRNA            join(<1633713..1634448,1634752..>1635370)
FT                   /locus_tag="mCG_23139"
FT                   /product="mCG23139"
FT                   /note="gene_id=mCG23139.1 transcript_id=mCT23292.1 created
FT                   on 04-JUN-2002"
FT   CDS             join(<1633766..1634448,1634752..1635370)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23139"
FT                   /product="mCG23139"
FT                   /note="gene_id=mCG23139.1 transcript_id=mCT23292.1
FT                   protein_id=mCP22696.1"
FT                   /protein_id="EDL22755.1"
FT                   /translation="LPPEDSTTMSGFNFGGTGAPAGGFTFGTAKTATTTPATGFSFSAS
FT                   GTGTGGFNFGTPSQPAATTPSTSLFSLTTQTPTTQTPGFNFGTTPASGGTGFSLGISTP
FT                   KLSLSNAAATPATANTGSFGLGSSTLTNAISSGSTSNQGTAPTGFVFGSSTTSAPSTGS
FT                   TGFSFTSGSASQPGASGFSLGSVGSSAQPTALSGSPFTPATLVTTTAGATQPAAAAPTA
FT                   ATTSAGTAAGTATGPAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGE
FT                   KITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHADEE
FT                   REKTYKLAENIDAQLKRMAQDLKDIIEHLNMAGGPADTSDPLQQICKILNAHMDSLQWV
FT                   DQSSALLQRRVEEASRVCEGRRKEQERSLRIAFD"
FT   gene            complement(1641284..1654208)
FT                   /gene="Tbc1d17"
FT                   /locus_tag="mCG_23133"
FT                   /note="gene_id=mCG23133.2"
FT   mRNA            complement(join(1641284..1646549,1646672..1646758,
FT                   1647112..1647228,1647332..1647429,1647750..1647849,
FT                   1647945..1648045,1648124..1648240,1648561..1648655,
FT                   1649213..1649316,1649400..1649528,1650141..1650302,
FT                   1650386..1650497,1651004..1651211,1651890..1652013,
FT                   1653399..1653470,1653565..1653663,1653978..1654208))
FT                   /gene="Tbc1d17"
FT                   /locus_tag="mCG_23133"
FT                   /product="TBC1 domain family, member 17"
FT                   /note="gene_id=mCG23133.2 transcript_id=mCT23159.2 created
FT                   on 19-MAR-2003"
FT   gene            <1641416..1645937
FT                   /gene="Il4i1"
FT                   /locus_tag="mCG_23132"
FT                   /note="gene_id=mCG23132.0"
FT   mRNA            join(<1641416..1641445,1641633..1641666,1641760..1641995,
FT                   1642505..1642617,1643118..1643319,1644280..1644348,
FT                   1644453..1644589,1644712..1645937)
FT                   /gene="Il4i1"
FT                   /locus_tag="mCG_23132"
FT                   /product="interleukin 4 induced 1"
FT                   /note="gene_id=mCG23132.0 transcript_id=mCT23158.1 created
FT                   on 04-JUN-2002"
FT   CDS             join(<1641651..1641666,1641760..1641995,1642505..1642617,
FT                   1643118..1643319,1644280..1644348,1644453..1644589,
FT                   1644712..1645834)
FT                   /codon_start=1
FT                   /gene="Il4i1"
FT                   /locus_tag="mCG_23132"
FT                   /product="interleukin 4 induced 1"
FT                   /note="gene_id=mCG23132.0 transcript_id=mCT23158.1
FT                   protein_id=mCP22698.0"
FT                   /protein_id="EDL22757.1"
FT                   /translation="AMAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQL
FT                   LKVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDE
FT                   KTGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMP
FT                   EKLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLS
FT                   RPAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGAL
FT                   LLNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQE
FT                   ALRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPARGEGSLLLASYTWS
FT                   DAAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPL
FT                   YGREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMM
FT                   EHAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPE
FT                   LQGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
FT   CDS             complement(join(1646358..1646549,1646672..1646758,
FT                   1647112..1647228,1647332..1647429,1647750..1647849,
FT                   1647945..1648045,1648124..1648240,1648561..1648655,
FT                   1649213..1649316,1649400..1649528,1650141..1650302,
FT                   1650386..1650497,1651004..1651211,1651890..1652013,
FT                   1653399..1653470,1653565..1653663,1653978..1653998))
FT                   /codon_start=1
FT                   /gene="Tbc1d17"
FT                   /locus_tag="mCG_23133"
FT                   /product="TBC1 domain family, member 17"
FT                   /note="gene_id=mCG23133.2 transcript_id=mCT23159.2
FT                   protein_id=mCP22784.2"
FT                   /db_xref="GOA:Q8BYH7"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR021935"
FT                   /db_xref="MGI:MGI:2449973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BYH7"
FT                   /protein_id="EDL22756.1"
FT                   /translation="MEGSSYRVVFEKGGVYLHTSARKHQDPDSLIAGVIRVVEKDSDVF
FT                   LHWAPVEEAGDPTQILFKKDPSRGEPSTSEEEPTFDPGYEPDWAVISTVRPQPHLAEPR
FT                   KGAEPSSSRSSWAFSVSLGELKSIRRSKPGLSWAYLVLVTQAGGSLPALHFHRGGTRAL
FT                   LRVLSRYLLLASSPQDSRLYLVFPQDPSALSDSFHHLQLFDQDSSNVVSRFLQDPYSTT
FT                   FSSFSRVTNFFRGALQPHPEGASSPNLPPLPDDEPEPGFEVISCVELGQRPTVERAPPV
FT                   TEEEWNRYVGPEGRLQNVPELKNRIFSGGLSPGLRREAWKFLLGYLSWESSAEEHKAHV
FT                   RKKTDEYFRMKLQWKSVSAEQERRNSLLHGYRSLIERDVSRTDRTNKFYEGPENPGLSL
FT                   LHDILLTYCMYHFDLGYVQGMSDLLSPILFVVQNEVDAFWCFCGFMELVHGNFEESQET
FT                   MKRQLGQLLLLLRVLDQPLCDFLDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLW
FT                   TGLPGPNLHLLVACAILDMERDTLMLSGFGSNEILKHINELTMKLSVEDVLTRAEALYR
FT                   QLTACPELPHNVQEILGLAQPEEPSSPSPPVSPMPLSPTRAPLPPPLPEEVIPQPDSSL
FT                   EILPEDEDGA"
FT   gene            <1654243..1660544
FT                   /gene="Akt1s1"
FT                   /locus_tag="mCG_23129"
FT                   /note="gene_id=mCG23129.2"
FT   mRNA            join(<1654243..1654477,1657698..1658086,1658907..1658984,
FT                   1659105..1659235,1659719..1660543)
FT                   /gene="Akt1s1"
FT                   /locus_tag="mCG_23129"
FT                   /product="AKT1 substrate 1 (proline-rich), transcript
FT                   variant mCT23155"
FT                   /note="gene_id=mCG23129.2 transcript_id=mCT23155.1 created
FT                   on 19-MAR-2003"
FT   CDS             join(<1654245..1654477,1657698..1658086,1658907..1658984,
FT                   1659105..1659235,1659719..1659862)
FT                   /codon_start=1
FT                   /gene="Akt1s1"
FT                   /locus_tag="mCG_23129"
FT                   /product="AKT1 substrate 1 (proline-rich), isoform CRA_b"
FT                   /note="gene_id=mCG23129.2 transcript_id=mCT23155.1
FT                   protein_id=mCP22724.1 isoform=CRA_b"
FT                   /protein_id="EDL22759.1"
FT                   /translation="PRSKQVGGPMLAAQLVIARERLLGPLHILYWHRSQYCAVFLEDKP
FT                   ERLGGSHVNAGHYHLFAGHDGGVLEKRNGERKRARMASGRPEELWEAVVGAAERFRART
FT                   GTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIAQAHRAATATRPPGPPPA
FT                   PQPPSPAPSPPPRPALAREDEEEDEDEPTETETSGERLGGSDNGGLFMMDEDATLQDLP
FT                   PFCESDPESTDACPQPPATALPTQQYAKSLPVSVPVWAFKEKRTEARSSDEENGPPSSP
FT                   DLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY"
FT   mRNA            join(1654469..1655135,1657698..1658086,1658907..1659235,
FT                   1659719..1660544)
FT                   /gene="Akt1s1"
FT                   /locus_tag="mCG_23129"
FT                   /product="AKT1 substrate 1 (proline-rich), transcript
FT                   variant mCT181306"
FT                   /note="gene_id=mCG23129.2 transcript_id=mCT181306.0 created
FT                   on 19-MAR-2003"
FT   CDS             join(1655065..1655135,1657698..1658086,1658907..1659013)
FT                   /codon_start=1
FT                   /gene="Akt1s1"
FT                   /locus_tag="mCG_23129"
FT                   /product="AKT1 substrate 1 (proline-rich), isoform CRA_a"
FT                   /note="gene_id=mCG23129.2 transcript_id=mCT181306.0
FT                   protein_id=mCP104228.0 isoform=CRA_a"
FT                   /protein_id="EDL22758.1"
FT                   /translation="MTQEAAMPFEGGDGAWPAMLATGTARMASGRPEELWEAVVGAAER
FT                   FRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIAQAHRAATATRPP
FT                   GPPPAPQPPSPAPSPPPRPALAREDEEEDEDEPTETETSGERLGGSDNGGLFMMDEDAT
FT                   LQDLPPFCESDPESTDGEDPGLSKP"
FT   gene            1662283..1668070
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /note="gene_id=mCG23134.3"
FT   mRNA            join(1662283..1662435,1662528..1662687,1663289..1663335,
FT                   1663579..1663875,1664848..1664927,1665013..1665070,
FT                   1665220..1665327,1665503..1665574,1666006..1666054,
FT                   1666132..1666202,1666290..1666382,1666461..1666557,
FT                   1666643..1666704,1666792..1666901,1667337..1667424,
FT                   1667509..1667570,1667644..1667795)
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, transcript
FT                   variant mCT181308"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT181308.0 created
FT                   on 19-MAR-2003"
FT   mRNA            join(<1662472..1662687,1663289..1663875,1664848..1664927,
FT                   1665013..1665070,1665503..1665574,1666006..1666054,
FT                   1666132..1666202,1666290..1666382,1666461..1666557,
FT                   1666643..1666704,1666792..1666901,1667337..1667424,
FT                   1667509..1667570,1667644..1667800)
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, transcript
FT                   variant mCT191775"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT191775.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1662473..1662687,1663579..1663875,1664848..1665070,
FT                   1666132..1666202,1666290..1666382,1666461..1666557,
FT                   1666643..1666704)
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, transcript
FT                   variant mCT181307"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT181307.0 created
FT                   on 19-MAR-2003"
FT   mRNA            join(<1662475..1662687,1663289..1663335,1663579..1663875,
FT                   1664848..1664927,1665013..1665070,1665220..1665327,
FT                   1665503..1665574,1666006..1666054,1666132..1666202,
FT                   1666290..1666382,1666461..1666557,1666643..1666704,
FT                   1666792..1666901,1667337..1667424,1667509..1667570,
FT                   1667644..1668070)
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, transcript
FT                   variant mCT191776"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT191776.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1662510..1662687,1663289..1663335,1663579..1663875,
FT                   1664848..1664927,1665013..1665070,1665220..1665327,
FT                   1665503..1665574,1666006..1666054,1666132..1666202,
FT                   1666290..1666382,1666461..1666557,1666643..1666704,
FT                   1666792..1666901,1667337..1667424,1667509..1667570,
FT                   1667644..1667767)
FT                   /codon_start=1
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT191776.0
FT                   protein_id=mCP112719.0 isoform=CRA_d"
FT                   /protein_id="EDL22763.1"
FT                   /translation="FCSPSQHPRMSQLGSRGRLWLQSPTGGPPPIFLPSDGQALVLGRG
FT                   PLTQVTDRKCSRNQVELIADPESRTVAVKQLGVNPSTVGVQELKPGLSGSLSLGDVLYL
FT                   VNGLYPLTLRWEELSTSGSQPDAPPDTPGDPEEGEDTEPQKKRVRKSSLGWESLKKLLV
FT                   FTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKLV
FT                   IFTNQMGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVATHAGLNRKPVSGMWDHLQEQA
FT                   NEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATPEEFFLKWP
FT                   AARFELPAFDPRTISSAGPLYLPESSSLLSPNPEVVVAVGFPGAGKSTFIQEHLVSAGY
FT                   VHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNF
FT                   CATIEQARHNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILEIPFRLQEHL
FT                   DPALQRLYRQFSEG"
FT   mRNA            join(1662537..1662687,1663289..1663335,1663579..1663875,
FT                   1665013..1665070,1665220..1665327,1665503..1665574,
FT                   1666006..1666054,1666132..1666202,1666290..1666382,
FT                   1666461..1666557,1666643..1666704,1666792..1666901,
FT                   1667337..1667424,1667509..1667570,1667644..1667795)
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, transcript
FT                   variant mCT23160"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT23160.1 created
FT                   on 19-MAR-2003"
FT   CDS             join(1662537..1662687,1663289..1663335,1663579..1663875,
FT                   1664848..1664927,1665013..1665070,1665220..1665327,
FT                   1665503..1665574,1666006..1666054,1666132..1666202,
FT                   1666290..1666382,1666461..1666557,1666643..1666704,
FT                   1666792..1666901,1667337..1667424,1667509..1667570,
FT                   1667644..1667767)
FT                   /codon_start=1
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT181308.0
FT                   protein_id=mCP104230.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8N7"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR006550"
FT                   /db_xref="InterPro:IPR006551"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1891698"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8N7"
FT                   /protein_id="EDL22761.1"
FT                   /translation="MSQLGSRGRLWLQSPTGGPPPIFLPSDGQALVLGRGPLTQVTDRK
FT                   CSRNQVELIADPESRTVAVKQLGVNPSTVGVQELKPGLSGSLSLGDVLYLVNGLYPLTL
FT                   RWEELSTSGSQPDAPPDTPGDPEEGEDTEPQKKRVRKSSLGWESLKKLLVFTASGVKPQ
FT                   GKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKLVIFTNQMGIG
FT                   RGKLPAEVFKGKVEAVLEKLGVPFQVLVATHAGLNRKPVSGMWDHLQEQANEGIPISVE
FT                   DSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATPEEFFLKWPAARFELPAF
FT                   DPRTISSAGPLYLPESSSLLSPNPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLG
FT                   SWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARH
FT                   NNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILEIPFRLQEHLDPALQRLYR
FT                   QFSEG"
FT   CDS             join(<1663561..1663875,1664848..1664927,1665013..1665070,
FT                   1665503..1665574,1666006..1666054,1666132..1666202,
FT                   1666290..1666382,1666461..1666557,1666643..1666704,
FT                   1666792..1666901,1667337..1667424,1667509..1667570,
FT                   1667644..1667767)
FT                   /codon_start=1
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT191775.0
FT                   protein_id=mCP112718.0 isoform=CRA_c"
FT                   /protein_id="EDL22762.1"
FT                   /translation="LLLCLQLGVNPSTVGVQELKPGLSGSLSLGDVLYLVNGLYPLTLR
FT                   WEELSTSGSQPDAPPDTPGDPEEGEDTEPQKKRVRKSSLGWESLKKLLVFTASGVKPQG
FT                   KVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKVLVATHAGLNRK
FT                   PVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGL
FT                   PFATPEEFFLKWPAARFELPAFDPRTISSAGPLYLPESSSLLSPNPEVVVAVGFPGAGK
FT                   STFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQC
FT                   AKDAGVPCRCFNFCATIEQARHNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFL
FT                   EILEIPFRLQEHLDPALQRLYRQFSEG"
FT   CDS             join(1664940..1665070,1666132..1666202,1666290..1666300)
FT                   /codon_start=1
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT181307.0
FT                   protein_id=mCP104229.0 isoform=CRA_a"
FT                   /protein_id="EDL22760.1"
FT                   /translation="MGGGWAGCPEFFRSQVTCYFPSTLGFCTQRFQRSSRSWLLKATRC
FT                   SRAPSQLGTGEEKKGFLLCRPPVRP"
FT   CDS             join(1665241..1665327,1665503..1665574,1666006..1666054,
FT                   1666132..1666202,1666290..1666382,1666461..1666557,
FT                   1666643..1666704,1666792..1666901,1667337..1667424,
FT                   1667509..1667570,1667644..1667767)
FT                   /codon_start=1
FT                   /gene="Pnkp"
FT                   /locus_tag="mCG_23134"
FT                   /product="polynucleotide kinase 3'-phosphatase, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG23134.3 transcript_id=mCT23160.1
FT                   protein_id=mCP22752.1 isoform=CRA_e"
FT                   /protein_id="EDL22764.1"
FT                   /translation="MGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVATHAGLNRKPVSG
FT                   MWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFAT
FT                   PEEFFLKWPAARFELPAFDPRTISSAGPLYLPESSSLLSPNPEVVVAVGFPGAGKSTFI
FT                   QEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDA
FT                   GVPCRCFNFCATIEQARHNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILE
FT                   IPFRLQEHLDPALQRLYRQFSEG"
FT   gene            complement(1668210..>1674940)
FT                   /gene="Ptov1"
FT                   /locus_tag="mCG_23135"
FT                   /note="gene_id=mCG23135.2"
FT   mRNA            complement(join(1668210..1668339,1668524..1668589,
FT                   1668680..1668877,1669528..1669632,1669757..1669814,
FT                   1669907..1669980,1670058..1670147,1670617..1670772,
FT                   1671955..1672062,1672205..1672262,1672338..1672420,
FT                   1672520..1672657,1674503..1674842))
FT                   /gene="Ptov1"
FT                   /locus_tag="mCG_23135"
FT                   /product="prostate tumor over expressed gene 1, transcript
FT                   variant mCT23161"
FT                   /note="gene_id=mCG23135.2 transcript_id=mCT23161.2 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1668213..1668339,1668524..1668589,
FT                   1668680..1668877,1669528..1669632,1669757..1669814,
FT                   1669907..1669980,1670058..1670147,1670617..1670772,
FT                   1671955..1672062,1672205..1672262,1672338..1672420,
FT                   1672520..1672657,1674017..1674209))
FT                   /gene="Ptov1"
FT                   /locus_tag="mCG_23135"
FT                   /product="prostate tumor over expressed gene 1, transcript
FT                   variant mCT181309"
FT                   /note="gene_id=mCG23135.2 transcript_id=mCT181309.0 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1668214..1668589,1668680..1668877,
FT                   1669528..1669632,1669757..1669814,1669907..1669980,
FT                   1670058..1670147,1670617..1670772,1671955..1672062,
FT                   1672205..1672262,1672338..1672420,1672520..1672657,
FT                   1674503..>1674940))
FT                   /gene="Ptov1"
FT                   /locus_tag="mCG_23135"
FT                   /product="prostate tumor over expressed gene 1, transcript
FT                   variant mCT191778"
FT                   /note="gene_id=mCG23135.2 transcript_id=mCT191778.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1668578..1668589,1668680..1668877,
FT                   1669528..1669632,1669757..1669814,1669907..1669980,
FT                   1670058..1670147,1670617..1670772,1671955..1672062,
FT                   1672205..1672262,1672338..1672420,1672520..1672657,
FT                   1674503..>1674940))
FT                   /codon_start=1
FT                   /gene="Ptov1"
FT                   /locus_tag="mCG_23135"
FT                   /product="prostate tumor over expressed gene 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23135.2 transcript_id=mCT191778.0
FT                   protein_id=mCP112720.0 isoform=CRA_b"
FT                   /protein_id="EDL22766.1"
FT                   /translation="PAPPLPGVGPGSPSSSTLVGASPPPPHLPPASRWLAPGSPVRCSG
FT                   SAAATPQRRVPRRGPAPLLPEAARPRLSVGGPAAPREAHGLPPAMVRPRRAPHRSGAGG
FT                   PLGGRGRPPRPLVVRAVRSRSWPGGPRGPQPPRIRARSAPPMEGARVFGALGPIGPSSP
FT                   GLTLGGLAVNEHRLSNKLLAWSGVLEWQEKRRPFSDSTAKLKRTLPCQAYVNQGENLET
FT                   DQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLF
FT                   PHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNAIRQVITTRKQAVGPGGVHSGPVQ
FT                   IVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTDQWPRRLFMQLIPQQ
FT                   LLTTLVPLFRNSRLVQFHFTKDMETLKSLCRIMDNGFAGCVHFSYKASCEVRVLMLLYS
FT                   SEKKIFIGLIPHDQSNFVNGIRRVIANQQQVLQRSLEQEQQQRGMGG"
FT   CDS             complement(join(1668578..1668589,1668680..1668877,
FT                   1669528..1669632,1669757..1669814,1669907..1669980,
FT                   1670058..1670147,1670617..1670772,1671955..1672062,
FT                   1672205..1672262,1672338..1672420,1672520..1672657,
FT                   1674503..1674673))
FT                   /codon_start=1
FT                   /gene="Ptov1"
FT                   /locus_tag="mCG_23135"
FT                   /product="prostate tumor over expressed gene 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23135.2 transcript_id=mCT23161.2
FT                   protein_id=mCP22688.2 isoform=CRA_c"
FT                   /protein_id="EDL22767.1"
FT                   /translation="MVRPRRAPHRSGAGGPLGGRGRPPRPLVVRAVRSRSWPGGPRGPQ
FT                   PPRIRARSAPPMEGARVFGALGPIGPSSPGLTLGGLAVNEHRLSNKLLAWSGVLEWQEK
FT                   RRPFSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLA
FT                   QFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQ
FT                   SGFVNAIRQVITTRKQAVGPGGVHSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWL
FT                   PSHVYVNQGEILRTDQWPRRLFMQLIPQQLLTTLVPLFRNSRLVQFHFTKDMETLKSLC
FT                   RIMDNGFAGCVHFSYKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVIANQQQ
FT                   VLQRSLEQEQQQRGMGG"
FT   CDS             complement(join(1668578..1668589,1668680..1668877,
FT                   1669528..1669632,1669757..1669814,1669907..1669980,
FT                   1670058..1670147,1670617..1670772,1671955..1672062,
FT                   1672205..1672231))
FT                   /codon_start=1
FT                   /gene="Ptov1"
FT                   /locus_tag="mCG_23135"
FT                   /product="prostate tumor over expressed gene 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23135.2 transcript_id=mCT181309.0
FT                   protein_id=mCP104231.0 isoform=CRA_a"
FT                   /protein_id="EDL22765.1"
FT                   /translation="MQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGF
FT                   AGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNAIRQVITTRKQAVGPGGV
FT                   HSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTDQWPRRLFM
FT                   QLIPQQLLTTLVPLFRNSRLVQFHFTKDMETLKSLCRIMDNGFAGCVHFSYKASCEVRV
FT                   LMLLYSSEKKIFIGLIPHDQSNFVNGIRRVIANQQQVLQRSLEQEQQQRGMGG"
FT   gene            complement(1684485..1697547)
FT                   /gene="Med25"
FT                   /locus_tag="mCG_23137"
FT                   /note="gene_id=mCG23137.1"
FT   mRNA            complement(join(1684485..1684616,1685029..1685206,
FT                   1685354..1685572,1685669..1685740,1686025..1686213,
FT                   1687861..1687968,1688070..1688127,1688201..1688286,
FT                   1689221..1689349,1689665..1689858,1689935..1690022,
FT                   1690182..1690312,1690441..1690603,1690886..1691006,
FT                   1691274..1691372,1696920..1697044,1697236..1697281,
FT                   1697368..1697547))
FT                   /gene="Med25"
FT                   /locus_tag="mCG_23137"
FT                   /product="mediator of RNA polymerase II transcription,
FT                   subunit 25 homolog (yeast), transcript variant mCT23290"
FT                   /note="gene_id=mCG23137.1 transcript_id=mCT23290.2 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(1684493..1685206,1685354..1685572,
FT                   1685669..1685740,1686025..1686213,1687861..1687968,
FT                   1688070..1688127,1688201..1688286,1689221..1689349,
FT                   1689665..1689858,1689935..1690022,1690182..1690312,
FT                   1690441..1690603,1690886..1691006,1691274..1691372,
FT                   1696920..1697044,1697236..1697281,1697368..>1697505))
FT                   /gene="Med25"
FT                   /locus_tag="mCG_23137"
FT                   /product="mediator of RNA polymerase II transcription,
FT                   subunit 25 homolog (yeast), transcript variant mCT191779"
FT                   /note="gene_id=mCG23137.1 transcript_id=mCT191779.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1684519..1684616,1685029..1685206,
FT                   1685354..1685572,1685669..1685740,1686025..1686213,
FT                   1687861..1687968,1688070..1688127,1688201..1688286,
FT                   1689221..1689349,1689665..1689858,1689935..1690022,
FT                   1690182..1690312,1690441..1690603,1690886..1691006,
FT                   1691274..1691372,1696920..1697044,1697236..1697281,
FT                   1697368..1697501))
FT                   /codon_start=1
FT                   /gene="Med25"
FT                   /locus_tag="mCG_23137"
FT                   /product="mediator of RNA polymerase II transcription,
FT                   subunit 25 homolog (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG23137.1 transcript_id=mCT23290.2
FT                   protein_id=mCP22695.2 isoform=CRA_b"
FT                   /protein_id="EDL22769.1"
FT                   /translation="MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEELRKHYLLPAIE
FT                   YFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFM
FT                   GGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSG
FT                   CTTESLVQKIGERGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQQPADVSQDPRHMVL
FT                   VRGLVLPVGGSSTSGSLQTKQAVPLPPAPASAATLSAAPPQALPPVPPQYQVPGNLSAA
FT                   QVAAQNAVEAAKSQKAGLGPRFSPINPLQQAAPGVGPPFSQAPAPPLAPVPPGAPKPPP
FT                   ASQPSLVSTVAPGPVLAAPAQPGAPSLAGTVTPGGVNGPSAAQLGGPALGGQQSVSNKL
FT                   LAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLL
FT                   TTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSS
FT                   KKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGMGAQQAPPVLGPILEEQAR
FT                   PPQNLLQLRAPQPQPQGAVGASAATGQPQPQGATQAPTGAPQGPPGAAPGPPPSGPILR
FT                   PQNPGANPQLRSLLLNPAPPQTGVPPPQASLHHLQPPGAPTLLPPHQSMGQPQLGPQLL
FT                   HPPPAQSWPTQLPQRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI"
FT   CDS             complement(join(1684940..1685206,1685354..1685572,
FT                   1685669..1685740,1686025..1686213,1687861..1687968,
FT                   1688070..1688127,1688201..1688286,1689221..1689349,
FT                   1689665..1689858,1689935..1690022,1690182..1690312,
FT                   1690441..1690603,1690886..1691006,1691274..1691372,
FT                   1696920..1697044,1697236..1697281,1697368..>1697504))
FT                   /codon_start=1
FT                   /gene="Med25"
FT                   /locus_tag="mCG_23137"
FT                   /product="mediator of RNA polymerase II transcription,
FT                   subunit 25 homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG23137.1 transcript_id=mCT191779.0
FT                   protein_id=mCP112721.0 isoform=CRA_a"
FT                   /protein_id="EDL22768.1"
FT                   /translation="GMVPGSEGPARAGGLVADVVFVIEGTANLGPYFEELRKHYLLPAI
FT                   EYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKF
FT                   MGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYS
FT                   GCTTESLVQKIGERGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQQPADVSQDPRHMV
FT                   LVRGLVLPVGGSSTSGSLQTKQAVPLPPAPASAATLSAAPPQALPPVPPQYQVPGNLSA
FT                   AQVAAQNAVEAAKSQKAGLGPRFSPINPLQQAAPGVGPPFSQAPAPPLAPVPPGAPKPP
FT                   PASQPSLVSTVAPGPVLAAPAQPGAPSLAGTVTPGGVNGPSAAQLGGPALGGQQSVSNK
FT                   LLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQL
FT                   LTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYS
FT                   SKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGMGAQQAPPVLGPILEEQA
FT                   RPPQNLLQLRAPQPQPQGAVGASAATGQPQPQGATQAPTGAPQGPPGAAPGPPPSGPIL
FT                   RPQNPGANPQLRSLLLNPAPPQTGVPPPQASLHHLQPPGAPTLLPPHQSMGQPQLGPQL
FT                   LHPPPAQSWPTQLPQRAPLPGKGAPGEDRGLEWESLKPLVRTLLPKGLP"
FT   gene            1701230..1705761
FT                   /locus_tag="mCG_23127"
FT                   /note="gene_id=mCG23127.2"
FT   mRNA            join(1701230..1701500,1701685..1701806,1702053..1702137,
FT                   1702399..1702467,1702658..1702762,1703641..1703838,
FT                   1703914..1704009,1704123..1704229,1704312..1704376,
FT                   1704450..1704524,1705271..1705750)
FT                   /locus_tag="mCG_23127"
FT                   /product="mCG23127, transcript variant mCT23153"
FT                   /note="gene_id=mCG23127.2 transcript_id=mCT23153.2 created
FT                   on 07-NOV-2002"
FT   mRNA            join(<1701231..1701500,1701685..1701806,1702053..1702137,
FT                   1702399..1702467,1702658..1703838,1703914..1704009,
FT                   1704123..1704524,1705271..1705761)
FT                   /locus_tag="mCG_23127"
FT                   /product="mCG23127, transcript variant mCT191740"
FT                   /note="gene_id=mCG23127.2 transcript_id=mCT191740.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1701339..1701500,1701685..1701806,1702053..1702137,
FT                   1702399..1702467,1702658..1702780)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23127"
FT                   /product="mCG23127, isoform CRA_a"
FT                   /note="gene_id=mCG23127.2 transcript_id=mCT191740.0
FT                   protein_id=mCP112715.0 isoform=CRA_a"
FT                   /protein_id="EDL22770.1"
FT                   /translation="IHTESLQGGDLSGAGFQMGDEGPGSPVHLLCLAASSGVPLFCRSS
FT                   SGGAPSRQQLPFSVIGSLNGVHMFGQNLDVQLNSARTEDTTVVWKNFHDSITLIVLSSE
FT                   EGTSELRLERMLHMVFGAMVLIVGLEELTNIRNVERLKKELRASYCLIDSFLGNSELIG
FT                   DLTQCVDCVIPPEGSAMQVLGQL"
FT   CDS             join(1701390..1701500,1701685..1701806,1702053..1702137,
FT                   1702399..1702467,1702658..1702762,1703641..1703838,
FT                   1703914..1704009,1704123..1704229,1704312..1704376,
FT                   1704450..1704524,1705271..1705485)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23127"
FT                   /product="mCG23127, isoform CRA_b"
FT                   /note="gene_id=mCG23127.2 transcript_id=mCT23153.2
FT                   protein_id=mCP22693.2 isoform=CRA_b"
FT                   /protein_id="EDL22771.1"
FT                   /translation="MGDEGPGSPVHLLCLAASSGVPLFCRSSSGGAPSRQQLPFSVIGS
FT                   LNGVHMFGQNLDVQLNSARTEDTTVVWKNFHDSITLIVLSSEEGTSELRLERMLHMVFG
FT                   AMVLIVGLEELTNIRNVERLKKELRASYCLIDSFLGNSELIGDLTQCVDCVIPPEGSAM
FT                   QETLSGFAEATGTAFVSLLVSGRVVAATEGWWRLGMPEAVLLPWLVGSLPPQAARDYPV
FT                   YLPHGSPTVPHRLLTLTLLRGLELCLLCGPRPPLGQLDPQLMERWWQPLLEPLRACLPL
FT                   GPRALPEGFPLHSDILGLLLLHLELRRCLFTVEPSKDKEPSPEQRRRLLRNFYTLVATT
FT                   HFPPEPGPAEKQEDTVYPAQTPRACYLVLGPGMGWQLVAVQLGLRLLLLLLSPHTPTHG
FT                   LRSLATRTLQALTPLL"
FT   gene            complement(1705519..>1734581)
FT                   /gene="Ap2a1"
FT                   /locus_tag="mCG_23157"
FT                   /note="gene_id=mCG23157.1"
FT   mRNA            complement(join(1705519..1705953,1706125..1706259,
FT                   1706375..1706444,1706522..1706638,1706729..1706850,
FT                   1707885..1707976,1708112..1708194,1708282..1708338,
FT                   1708600..1708665,1708879..1709039,1709127..1709294,
FT                   1709375..1709606,1709791..1709888,1710823..1711005,
FT                   1711209..1711346,1711449..1711617,1711972..1712122,
FT                   1712862..1712970,1714358..1714459,1714837..1714966,
FT                   1720951..1721144,1721273..1721415,1721512..1721580,
FT                   1734388..>1734581))
FT                   /gene="Ap2a1"
FT                   /locus_tag="mCG_23157"
FT                   /product="adaptor protein complex AP-2, alpha 1 subunit"
FT                   /note="gene_id=mCG23157.1 transcript_id=mCT23310.1 created
FT                   on 04-JUN-2002"
FT   CDS             complement(join(1705876..1705953,1706125..1706259,
FT                   1706375..1706444,1706522..1706638,1706729..1706850,
FT                   1707885..1707976,1708112..1708194,1708282..1708338,
FT                   1708600..1708665,1708879..1709039,1709127..1709294,
FT                   1709375..1709606,1709791..1709888,1710823..1711005,
FT                   1711209..1711346,1711449..1711617,1711972..1712122,
FT                   1712862..1712970,1714358..1714459,1714837..1714966,
FT                   1720951..1721144,1721273..1721415,1721512..1721580,
FT                   1734388..>1734565))
FT                   /codon_start=1
FT                   /gene="Ap2a1"
FT                   /locus_tag="mCG_23157"
FT                   /product="adaptor protein complex AP-2, alpha 1 subunit"
FT                   /note="gene_id=mCG23157.1 transcript_id=mCT23310.1
FT                   protein_id=mCP22700.1"
FT                   /protein_id="EDL22772.1"
FT                   /translation="PALPRPAPRRRLGSFPPGAASQPRARSARLGAEPSAIMPAVSKGD
FT                   GMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFL
FT                   LGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPT
FT                   FMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASPDLVPM
FT                   GEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCISLAVSRLSRIVSSASTDL
FT                   QDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKVQHS
FT                   NAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEFS
FT                   HEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAIR
FT                   EEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
FT                   KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRA
FT                   LLLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATV
FT                   LEEMPPFPERESSILAKLKRKKGPGAASALDDSRRDTSSNDINGGVEPTPSTVSTPSPS
FT                   ADLLGLRAAPPPAAPPAPVGGNLLVDVFSDGPTAQPSLGPTPEEAFLSELEPPAPESPM
FT                   ALLADPAPAADPGPEDIGPPIPEADELLNKFVCKNSGVLFENQLLQIGVKSEFRQNLGR
FT                   MYLFYGNKTSVQFQNFLPTVVHPGDLQTHLAVQTKRVAAQVDGGAQVQQVLNIECLRDF
FT                   LTPPLLSVRFRYGGTAQSLTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPLQEAQKIF
FT                   KANHPMDAEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQ
FT                   MYRLTLRTSKEPVSRHLCELLAQQF"
FT   assembly_gap    1738636..1738708
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   gene            <1748478..1764577
FT                   /gene="Stk22s1"
FT                   /locus_tag="mCG_23153"
FT                   /note="gene_id=mCG23153.1"
FT   mRNA            join(<1748478..1748671,1749000..1749222,1757319..1757414,
FT                   1757579..1757662,1758376..1758486,1759086..1759372,
FT                   1760290..1760484,1760857..1761030,1762996..1763131,
FT                   1764141..1764265,1764400..1764577)
FT                   /gene="Stk22s1"
FT                   /locus_tag="mCG_23153"
FT                   /product="serine/threonine kinase 22 substrate 1"
FT                   /note="gene_id=mCG23153.1 transcript_id=mCT23306.1 created
FT                   on 04-JUN-2002"
FT   CDS             join(<1748478..1748671,1749000..1749222,1757319..1757414,
FT                   1757579..1757662,1758376..1758486,1759086..1759372,
FT                   1760290..1760484,1760857..1761030,1762996..1763131,
FT                   1764141..1764265,1764400..1764556)
FT                   /codon_start=1
FT                   /gene="Stk22s1"
FT                   /locus_tag="mCG_23153"
FT                   /product="serine/threonine kinase 22 substrate 1"
FT                   /note="gene_id=mCG23153.1 transcript_id=mCT23306.1
FT                   protein_id=mCP22778.0"
FT                   /protein_id="EDL22773.1"
FT                   /translation="PWEQAPRTMASVVVKTIWQSKEIHEAGDPPAGVESRAQLVPEAPG
FT                   GVTSPAKGITKKKKAVSFHGVEPRMSHEPMHWCLNLKRSSACTNVSLLNLAAVEPDSSG
FT                   TDSTTEDSGPLALPGPPASPTTPWAPEDPDITELLSGVNSGLVRAKDSITSLKEKTTRV
FT                   NQHVQTLQSECSVLSENLERRRQEAEELEGYCSQLKGPRPDVLTQENCRKVTRSVEDAE
FT                   IKTNVLKQNSALLEEKLRYLQQQLQDETPRRQEAELQELEQKLEAGLSRHGLSPATPIQ
FT                   GCSGPPGSPEEPPRQRGLSSSGWGMAVRTGEGPSLSEQELQKVSTGLEELRREVSSLAA
FT                   RWHQEEGAVQEALRLLGGLGGRLDGFLGQWERAQREQAQSARGLQELRGRADELCTMVE
FT                   RSAVSVASLRSELEALGPVKPILEELGRQLQNSRRGADHVLNLDRSAQGPCARCASQGQ
FT                   QLSTESLQQLLERALTPLVDEVKQKGLAPACPSCQRLHKKILELERQALAKHVRAEALS
FT                   STLRLAQDEAVRAKNLLLTDKMKPEEKVATLDYMHLKMCSLHDQLSHLPLEGSTGAMGG
FT                   GSNGGAPPKRGSPGSEQ"
FT   assembly_gap    1753499..1753518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1765917..1781292)
FT                   /gene="Cpt1c"
FT                   /locus_tag="mCG_142452"
FT                   /note="gene_id=mCG142452.0"
FT   mRNA            complement(join(1765917..1766219,1766388..1766480,
FT                   1766594..1766707,1767302..1767454,1768063..1768194,
FT                   1768690..1768854,1769287..1769403,1770445..1770550,
FT                   1771624..1771806,1771911..1772106,1773165..1773249,
FT                   1773336..1773443,1773591..1773665,1776910..1777047,
FT                   1777123..1777224,1777741..1777912,1779528..1779667,
FT                   1780245..1780398,1781113..1781292))
FT                   /gene="Cpt1c"
FT                   /locus_tag="mCG_142452"
FT                   /product="carnitine palmitoyltransferase 1c"
FT                   /note="gene_id=mCG142452.0 transcript_id=mCT180491.0
FT                   created on 11-FEB-2003"
FT   CDS             complement(join(1766043..1766219,1766388..1766480,
FT                   1766594..1766707,1767302..1767454,1768063..1768194,
FT                   1768690..1768854,1769287..1769403,1770445..1770550,
FT                   1771624..1771806,1771911..1772106,1773165..1773249,
FT                   1773336..1773443,1773591..1773665,1776910..1777047,
FT                   1777123..1777224,1777741..1777912,1779528..1779667,
FT                   1780245..1780385))
FT                   /codon_start=1
FT                   /gene="Cpt1c"
FT                   /locus_tag="mCG_142452"
FT                   /product="carnitine palmitoyltransferase 1c"
FT                   /note="gene_id=mCG142452.0 transcript_id=mCT180491.0
FT                   protein_id=mCP103413.0"
FT                   /protein_id="EDL22774.1"
FT                   /translation="MAEAHQASSLLSSLSSDGAEVELSSPVWQEIYLCALRSWKRHLWR
FT                   VWNDFLAGVVPATPLSWLFLFSTIQLACLLQLDPSLGLMEKIKELLPDWGGQHHQLQGF
FT                   LSAAVFASCLWGALIFTLHVALRLLLSHHGWLLEPHGAMSSPTKTWLALVRIFSGRHPR
FT                   LFSFQRALPRQPVPSAQETVRKYLESVRPVLGDDAFDRATALANDFLRLHAPRLQLYLQ
FT                   LKSWCTSNYVSDWWEEFVYLRSRGSLINSTYYMMDFLYVTPTPLQAARAGNAVHTLLLY
FT                   RHLLNRQEISPTLLMGMRPLCSAQYERMFNTTRIPGVEKDHLRHLQDSRHVAVFHRGRF
FT                   FRVGTHSPNGLLSPRALEQQFQDILDDPSPACPLEEHLAALTAAPRSMWAQVRESVKTH
FT                   AATALEAVEGAAFFVSLDSEPAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVF
FT                   SNGKLGLSVEHSWADCPVSGHLWEFTLATECFQLGYATDGHCKGHPDPTLPQPQRLQWD
FT                   LPEQIQPSISLALRGAKTLSGNIDCHVFPFSHFGKSFIKCCHVSSDSFIQLVLQLAHFR
FT                   DRGQFCLTYESAMTRLFLEGRTETVRSCTREACQFVRAMDNKETDQHCLALFRVAVDKH
FT                   QALLKAAMSGQGIDRHLFALYIMSRLLHMQSPFLTQVQSQQWLLSTSQVPVQQTHLIDV
FT                   HNYPDYVSSGGGFGPAHDHGYGISYIFMGENAITFHISSKKSSTETDSHRLGQHIENAL
FT                   LDVASLFRVGQHFKRQFRGENSDYRYNFLSCKTVDPNTPTSSTNL"
FT   gene            <1776932..1780821
FT                   /locus_tag="mCG_146229"
FT                   /note="gene_id=mCG146229.0"
FT   mRNA            join(<1776932..1777294,1779563..1779672,1780217..1780289,
FT                   1780593..1780821)
FT                   /locus_tag="mCG_146229"
FT                   /product="mCG146229"
FT                   /note="gene_id=mCG146229.0 transcript_id=mCT186332.0
FT                   created on 14-JUL-2003"
FT   CDS             <1776947..1777285
FT                   /codon_start=1
FT                   /locus_tag="mCG_146229"
FT                   /product="mCG146229"
FT                   /note="gene_id=mCG146229.0 transcript_id=mCT186332.0
FT                   protein_id=mCP107395.0"
FT                   /protein_id="EDL22775.1"
FT                   /translation="SCSRGACNLRKSFASAVARSKASSPSTGRTDSRYYRQTRTGASAS
FT                   RRLPETTPLQGTPTFRTVSCAEGTGCRGSARWKLKSLGCLPEKILTNACGTEERTQLEQ
FT                   GRGRTKMI"
FT   gene            complement(1783262..1792987)
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /note="gene_id=mCG23155.3"
FT   mRNA            complement(join(1783262..1783489,1784010..1784131,
FT                   1784633..1784780,1785975..1786027,1788089..1788152,
FT                   1788240..1788395,1789988..1790089,1792778..>1792834))
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /product="protein arginine N-methyltransferase 1,
FT                   transcript variant mCT191780"
FT                   /note="gene_id=mCG23155.3 transcript_id=mCT191780.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1783264..1783489,1784010..1784131,
FT                   1784633..1784783,1785177..1785292,1785385..1785472,
FT                   1785885..1786027,1788089..1788152,1788240..1788395,
FT                   1789988..1790089,1790582..1790635,1792778..1792987))
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /product="protein arginine N-methyltransferase 1,
FT                   transcript variant mCT23308"
FT                   /note="gene_id=mCG23155.3 transcript_id=mCT23308.1 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1783267..1783489,1784010..1784131,
FT                   1784633..1784783,1785177..1785292,1785385..1785472,
FT                   1785885..1786027,1788089..1788152,1788240..1788395,
FT                   1789988..1790089,1792778..>1792829))
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /product="protein arginine N-methyltransferase 1,
FT                   transcript variant mCT191781"
FT                   /note="gene_id=mCG23155.3 transcript_id=mCT191781.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1783270..1783489,1784010..1784131,
FT                   1784633..1784783,1785177..1785292,1785385..1785472,
FT                   1785885..1786027,1788089..1788152,1788240..1788395,
FT                   1789988..1790089,1790273..1790377,1790578..1790635,
FT                   1792778..1792851))
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /product="protein arginine N-methyltransferase 1,
FT                   transcript variant mCT181314"
FT                   /note="gene_id=mCG23155.3 transcript_id=mCT181314.0 created
FT                   on 20-MAR-2003"
FT   CDS             complement(join(1783406..1783489,1784010..1784131,
FT                   1784633..1784780,1785975..1786027,1788089..1788152,
FT                   1788240..1788395,1789988..1790089,1792778..>1792834))
FT                   /codon_start=1
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /product="protein arginine N-methyltransferase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23155.3 transcript_id=mCT191780.0
FT                   protein_id=mCP112728.0 isoform=CRA_b"
FT                   /protein_id="EDL22777.1"
FT                   /translation="GRRTRVKMAAAEAANCIMEVSCGQAESSEKPNAEDMTSKDYYFDS
FT                   YAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVI
FT                   GIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIYTVKVEDLTFTSPFCL
FT                   QVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIF
FT                   GTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR"
FT   CDS             complement(join(1783406..1783489,1784010..1784131,
FT                   1784633..1784783,1785177..1785292,1785385..1785472,
FT                   1785885..1786027,1788089..1788152,1788240..1788395,
FT                   1789988..1790089,1792778..>1792828))
FT                   /codon_start=1
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /product="protein arginine N-methyltransferase 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23155.3 transcript_id=mCT191781.0
FT                   protein_id=mCP112729.0 isoform=CRA_c"
FT                   /protein_id="EDL22778.1"
FT                   /translation="RTRVKMAAAEAANCIMEVSCGQAESSEKPNAEDMTSKDYYFDSYA
FT                   HFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGI
FT                   ECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNT
FT                   VLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEP
FT                   LVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTR
FT                   CHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDL
FT                   DFKGQLCELSCSTDYRMR"
FT   CDS             complement(join(1783406..1783489,1784010..1784131,
FT                   1784633..1784783,1785177..1785292,1785385..1785472,
FT                   1785885..1786027,1788089..1788152,1788240..1788395,
FT                   1789988..1790089,1790582..1790635,1792778..1792813))
FT                   /codon_start=1
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /product="protein arginine N-methyltransferase 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG23155.3 transcript_id=mCT23308.1
FT                   protein_id=mCP22785.1 isoform=CRA_d"
FT                   /protein_id="EDL22779.1"
FT                   /translation="MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAE
FT                   DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCM
FT                   FAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEW
FT                   MGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGF
FT                   DMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYV
FT                   HALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPN
FT                   AKNNRDLDFTIDLDFKGQLCELSCSTDYRMR"
FT   CDS             complement(join(1783406..1783489,1784010..1784131,
FT                   1784633..1784783,1785177..1785292,1785385..1785472,
FT                   1785885..1786027,1788089..1788152,1788240..1788395,
FT                   1789988..1790089,1790273..1790275))
FT                   /codon_start=1
FT                   /gene="Prmt1"
FT                   /locus_tag="mCG_23155"
FT                   /product="protein arginine N-methyltransferase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23155.3 transcript_id=mCT181314.0
FT                   protein_id=mCP104236.0 isoform=CRA_a"
FT                   /protein_id="EDL22776.1"
FT                   /translation="MVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTL
FT                   TYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKAN
FT                   KLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIF
FT                   PDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACL
FT                   IKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYT
FT                   HWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYR
FT                   MR"
FT   gene            complement(1797232..>1805208)
FT                   /gene="Bcl2l12"
FT                   /locus_tag="mCG_23151"
FT                   /note="gene_id=mCG23151.2"
FT   mRNA            complement(join(1797232..1797950,1799240..1799527,
FT                   1800676..1800767,1800859..1800945,1803040..1803182,
FT                   1803374..1803488,1803959..1804139,1805121..1805208))
FT                   /gene="Bcl2l12"
FT                   /locus_tag="mCG_23151"
FT                   /product="BCL2-like 12 (proline rich), transcript variant
FT                   mCT23305"
FT                   /note="gene_id=mCG23151.2 transcript_id=mCT23305.2 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1797719..1797950,1799240..1799527,
FT                   1800307..1800767,1800859..1800945,1803040..1803182,
FT                   1803374..1803488,1803959..1804139,1805121..>1805208))
FT                   /gene="Bcl2l12"
FT                   /locus_tag="mCG_23151"
FT                   /product="BCL2-like 12 (proline rich), transcript variant
FT                   mCT191777"
FT                   /note="gene_id=mCG23151.2 transcript_id=mCT191777.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1797900..1797950,1799240..1799527,
FT                   1800676..1800767,1800859..1800945,1803040..1803182,
FT                   1803374..1803480))
FT                   /codon_start=1
FT                   /gene="Bcl2l12"
FT                   /locus_tag="mCG_23151"
FT                   /product="BCL2-like 12 (proline rich), isoform CRA_b"
FT                   /note="gene_id=mCG23151.2 transcript_id=mCT23305.2
FT                   protein_id=mCP22770.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D3J3"
FT                   /db_xref="MGI:MGI:1922986"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3J3"
FT                   /protein_id="EDL22781.1"
FT                   /translation="MAGSEELGLREDTLKVLTAFLKRGEVAGSPVPTPPRSPAQEETTD
FT                   FLSRLRRCLPCPLGRGAPPTESSRPHFLPLRPCYGSEPGPASSEFYALVAQRLEQLVQE
FT                   QLKSPPSSEFQGPPPTEKEALLRRLVALLEEEAEVINQKLASDPALHRKLARLSAGSFA
FT                   RLVELFSSRESSSSPNCSSPSLPCPGPPPPSPDPLARLALAMELSRRVAGLGGPLANLS
FT                   VEHVHSFLPWVQAHGGWAGILASSPVDLNLPLD"
FT   CDS             complement(join(1800541..1800767,1800859..1800945,
FT                   1803040..1803182,1803374..1803488,1803959..>1804034))
FT                   /codon_start=1
FT                   /gene="Bcl2l12"
FT                   /locus_tag="mCG_23151"
FT                   /product="BCL2-like 12 (proline rich), isoform CRA_a"
FT                   /note="gene_id=mCG23151.2 transcript_id=mCT191777.0
FT                   protein_id=mCP112727.0 isoform=CRA_a"
FT                   /protein_id="EDL22780.1"
FT                   /translation="TSEVKVCRNCEKACTPVRRGHNREPGTPMAGSEELGLREDTLKVL
FT                   TAFLKRGEVAGSPVPTPPRSPAQEETTDFLSRLRRCLPCPLGRGAPPTESSRPHFLPLR
FT                   PCYGSEPGPASSEFYALVAQRLEQLVQEQLKSPPSSEFQGPPPTEKEALLRRLVALLEE
FT                   EAEVINQKVTSLYSTLWRGQLWNRGQTLALLCFDAGCGSRAPVNIRASSQEP"
FT   gene            1804170..1808906
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /note="gene_id=mCG23141.3"
FT   mRNA            join(1804170..1804404,1805201..1805373,1806397..1806568,
FT                   1806659..1806729,1806877..1807051,1807150..1807527,
FT                   1808178..1808293,1808669..1808894)
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, transcript
FT                   variant mCT23294"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT23294.0 created
FT                   on 20-MAR-2003"
FT   mRNA            join(<1804176..1804562,1805201..1805373,1806397..1806568,
FT                   1806659..1806729,1806877..1807527,1808178..1808293,
FT                   1808669..1808894)
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, transcript
FT                   variant mCT191738"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT191738.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1804181..1804404,1805201..1805240,1808258..1808293,
FT                   1808669..1808895)
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, transcript
FT                   variant mCT181312"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT181312.0 created
FT                   on 20-MAR-2003"
FT   mRNA            join(<1804185..1804404,1805201..1805373,1806397..1806568,
FT                   1806659..1806729,1806877..1807527,1808178..1808293,
FT                   1808669..1808906)
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, transcript
FT                   variant mCT191739"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT191739.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1804445..1804562,1805201..1805373,1806397..1806568,
FT                   1806659..1806729,1806877..1807051,1807150..1807527,
FT                   1808178..1808293,1808669..1808894)
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, transcript
FT                   variant mCT181311"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT181311.0 created
FT                   on 20-MAR-2003"
FT   CDS             join(1805209..1805373,1806397..1806568,1806659..1806729,
FT                   1806877..1807051,1807150..1807527,1808178..1808293,
FT                   1808669..1808851)
FT                   /codon_start=1
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, isoform CRA_a"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT181311.0
FT                   protein_id=mCP104233.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U9K6"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017855"
FT                   /db_xref="InterPro:IPR019471"
FT                   /db_xref="InterPro:IPR019817"
FT                   /db_xref="MGI:MGI:1859179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U9K6"
FT                   /protein_id="EDL22782.1"
FT                   /translation="METPKPRILPWLVSQLDLGQLEGVAWLDESRTRFRIPWKHGLRQD
FT                   AQMADFGIFQAWAEASGAYTPGKDKPDVSTWKRNFRSALNRKEVLRLAADNSKDPYDPH
FT                   KVYEFVTPGARDFVHLGASPDTNGKSSLPHSQENLPKLFDGLILGPLKDEGSSDLAIVS
FT                   DPSQQLPSPNVNNFLNPAPQENPLKQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRL
FT                   VGSTADMTLPWQPVTLPDPEGFLTDKLVKEYVGQVLKGLGNGLALWQAGQCLWAQRLGH
FT                   SHAFWALGEELLPDSGRGPDGEVHKDKDGAVFDLRPFVADLIAFMEGSGHSPRYTLWFC
FT                   MGEMWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQ
FT                   YKAYLQDLVEDMDFQATGNI"
FT   CDS             join(1805209..1805373,1806397..1806568,1806659..1806729,
FT                   1806877..1807051,1807150..1807527,1808178..1808293,
FT                   1808669..1808851)
FT                   /codon_start=1
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, isoform CRA_a"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT23294.0
FT                   protein_id=mCP22692.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U9K6"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017855"
FT                   /db_xref="InterPro:IPR019471"
FT                   /db_xref="InterPro:IPR019817"
FT                   /db_xref="MGI:MGI:1859179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U9K6"
FT                   /protein_id="EDL22786.1"
FT                   /translation="METPKPRILPWLVSQLDLGQLEGVAWLDESRTRFRIPWKHGLRQD
FT                   AQMADFGIFQAWAEASGAYTPGKDKPDVSTWKRNFRSALNRKEVLRLAADNSKDPYDPH
FT                   KVYEFVTPGARDFVHLGASPDTNGKSSLPHSQENLPKLFDGLILGPLKDEGSSDLAIVS
FT                   DPSQQLPSPNVNNFLNPAPQENPLKQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRL
FT                   VGSTADMTLPWQPVTLPDPEGFLTDKLVKEYVGQVLKGLGNGLALWQAGQCLWAQRLGH
FT                   SHAFWALGEELLPDSGRGPDGEVHKDKDGAVFDLRPFVADLIAFMEGSGHSPRYTLWFC
FT                   MGEMWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQ
FT                   YKAYLQDLVEDMDFQATGNI"
FT   CDS             join(<1807056..1807527,1808178..1808293,1808669..1808851)
FT                   /codon_start=1
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, isoform CRA_c"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT191738.0
FT                   protein_id=mCP112722.0 isoform=CRA_c"
FT                   /protein_id="EDL22784.1"
FT                   /translation="VPAVAWEGLRQGQRSLPCSSPFLPSHSTGGSEWEFEVTAFYRGRQ
FT                   VFQQTLFCPGGLRLVGSTADMTLPWQPVTLPDPEGFLTDKLVKEYVGQVLKGLGNGLAL
FT                   WQAGQCLWAQRLGHSHAFWALGEELLPDSGRGPDGEVHKDKDGAVFDLRPFVADLIAFM
FT                   EGSGHSPRYTLWFCMGEMWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKTVDL
FT                   HISNSQPISLTSDQYKAYLQDLVEDMDFQATGNI"
FT   CDS             join(<1807056..1807527,1808178..1808293,1808669..1808851)
FT                   /codon_start=1
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, isoform CRA_c"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT191739.0
FT                   protein_id=mCP112723.0 isoform=CRA_c"
FT                   /protein_id="EDL22785.1"
FT                   /translation="VPAVAWEGLRQGQRSLPCSSPFLPSHSTGGSEWEFEVTAFYRGRQ
FT                   VFQQTLFCPGGLRLVGSTADMTLPWQPVTLPDPEGFLTDKLVKEYVGQVLKGLGNGLAL
FT                   WQAGQCLWAQRLGHSHAFWALGEELLPDSGRGPDGEVHKDKDGAVFDLRPFVADLIAFM
FT                   EGSGHSPRYTLWFCMGEMWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKTVDL
FT                   HISNSQPISLTSDQYKAYLQDLVEDMDFQATGNI"
FT   CDS             join(1808285..1808293,1808669..1808851)
FT                   /codon_start=1
FT                   /gene="Irf3"
FT                   /locus_tag="mCG_23141"
FT                   /product="interferon regulatory factor 3, isoform CRA_b"
FT                   /note="gene_id=mCG23141.3 transcript_id=mCT181312.0
FT                   protein_id=mCP104234.0 isoform=CRA_b"
FT                   /protein_id="EDL22783.1"
FT                   /translation="MVKVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQYK
FT                   AYLQDLVEDMDFQATGNI"
FT   gene            complement(1809454..>1820899)
FT                   /gene="AI480556"
FT                   /locus_tag="mCG_145368"
FT                   /note="gene_id=mCG145368.0"
FT   mRNA            complement(join(1809454..1809877,1810003..1810131,
FT                   1811911..1812129,1812347..1812429,1812812..1815478,
FT                   1818618..1818733,1818820..1818920,1819193..1819290,
FT                   1819712..1819769,1819975..1820088,1820700..>1820899))
FT                   /gene="AI480556"
FT                   /locus_tag="mCG_145368"
FT                   /product="expressed sequence AI480556"
FT                   /note="gene_id=mCG145368.0 transcript_id=mCT184792.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1809686..1809877,1810003..1810131,
FT                   1811911..1812129,1812347..1812429,1812812..1815478,
FT                   1818618..1818733,1818820..1818920,1819193..1819290,
FT                   1819712..1819769,1819975..>1820088))
FT                   /codon_start=1
FT                   /gene="AI480556"
FT                   /locus_tag="mCG_145368"
FT                   /product="expressed sequence AI480556"
FT                   /note="gene_id=mCG145368.0 transcript_id=mCT184792.0
FT                   protein_id=mCP105465.0"
FT                   /protein_id="EDL22787.1"
FT                   /translation="VTMEEEDESRGKTEESGEDRGDGPPDRDPALSPSAFILRAIQQAV
FT                   GSSLQGDLPNDKDGARCRGLRWRRCCRSPRSEPRSQESGAADTATVLDTAADSFLVELV
FT                   SILDPPDTWVPSRLDLQPGESEDMLELVAEVRIGDRDPMPLPVPSLFPRLRAWRTGKTV
FT                   SPQSHASRPACSRHLTLGTGDGGPAPPPAPSSASSSPSPSPSSSSPSPPPPPPPPPPPA
FT                   LPAPRFDIYDPFHPTDEAYSPPPAPEQKYDPFEPTGSNPSSSAGTPSPEEEEEEEEEEE
FT                   EEGLSQSISRISETLAGIYDDNSLSQDFPDDDSPRREPPPPQTLGAPGTPPQADSTRAE
FT                   GAPRRRVFVLGPEAEACHEGKVSVEVVTAGAPALSLPPLPPTDPEIEEGEIVQPEEEPR
FT                   VAVSLFRAARPRQPPASVATLASVAAPAAPPASAPRAPEGDDFLSLHADSDGEGALQVD
FT                   LGEPPAPPAADARWGGLDLRRKILTQRRERYRQRSASPGPPPARKKARRERQRSGDPAP
FT                   PDSPSWEAKKHRSRERKLGSHSTARRRSRSRSRRRSRSRSADRRRGGHRSRSREKRRRR
FT                   RRSASPPPAASSSSSSRRERHRGKRREGGKKKKKRSRSRAEKRSGDLEKLPASVPPSGS
FT                   DRDSRRRGAVPPSIQDLTDHDLFAIKRTITVGRPDKAEPRAPSPAPAVSPKREVLYDSE
FT                   GLSADERGGKSDKDRRRSGAASSSSSSREKGSRRKALDGDRGRDRDRSSKKTRPPKDST
FT                   PGSGPLPKAPPSSGSSSSSSSCSSRKVKLQSKVAVLIREGVSSTTPAKDSSSSGLGSIG
FT                   VKFSRDRESRSPFLKPDERAPAEVAKVAPGSNKPKKTKAKAKAGAKKAKGTKGKTKPSK
FT                   TRKKVRSGGSSTASGGPGSLKKSKADSCSQAASAKGTEETSWSGEERTTKAPSTPPPKV
FT                   APPPPALTPDSQTVDSSCKTPEVSFLPEEASEDTGVRVGAEEEEEEEEEEEEEEEQQPA
FT                   TTTATSTAAAAPSTAPSAGSTAGDSGAEDGPAARISQLPTLPPPMPWNLPAGVDCTTSG
FT                   VLALTALLFKMEEANLASRAKAQELIQATNQILSHRKPSSTLGVTPAPVPTSLGLPPGP
FT                   SSYLLPGSLPIGGCGSTPPTPTGLAPASDKREGSSSSEGRGDTDKYLKKLHTQERAVEE
FT                   VKLAIKPYYQKKDITKEEYKDILRKAVHKICHSKSGEINPVKVSNLVRAYVQRYRYFRK
FT                   HGRKPGDPPGPPRPPKEPGPPDKGGPGLPLPPL"
FT   gene            <1824503..1828138
FT                   /gene="Rras"
FT                   /locus_tag="mCG_134528"
FT                   /note="gene_id=mCG134528.0"
FT   mRNA            join(<1824503..1824664,1826594..1826681,1826797..1826899,
FT                   1826984..1827092,1827581..1827699,1827774..1828138)
FT                   /gene="Rras"
FT                   /locus_tag="mCG_134528"
FT                   /product="Harvey rat sarcoma oncogene, subgroup R"
FT                   /note="gene_id=mCG134528.0 transcript_id=mCT135915.0
FT                   created on 04-JUN-2002"
FT   CDS             join(<1824503..1824664,1826594..1826681,1826797..1826899,
FT                   1826984..1827092,1827581..1827699,1827774..1827858)
FT                   /codon_start=1
FT                   /gene="Rras"
FT                   /locus_tag="mCG_134528"
FT                   /product="Harvey rat sarcoma oncogene, subgroup R"
FT                   /note="gene_id=mCG134528.0 transcript_id=mCT135915.0
FT                   protein_id=mCP63495.0"
FT                   /protein_id="EDL22788.1"
FT                   /translation="GGDMSSGAASGTGRGRPRGGGPGPRDPPPGETHKLVVVGGGGVGK
FT                   SALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAG
FT                   NGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPIVLVGNKADLENQRQVLRSEASSF
FT                   SASHHMTYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL"
FT   assembly_gap    1830705..1830724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1834586..>1854051)
FT                   /locus_tag="mCG_145367"
FT                   /note="gene_id=mCG145367.0"
FT   mRNA            complement(join(1834586..1835500,1835635..1835730,
FT                   1835814..1835960,1837453..1837550,1837843..1837968,
FT                   1840597..1841084,1841461..1841594,1841731..1841847,
FT                   1850422..1850858,1852799..1853465,1853915..>1854051))
FT                   /locus_tag="mCG_145367"
FT                   /product="mCG145367"
FT                   /note="gene_id=mCG145367.0 transcript_id=mCT184791.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1835354..1835500,1835635..1835730,
FT                   1835814..1835960,1837453..1837550,1837843..1837968,
FT                   1840597..1841084,1841461..1841594,1841731..1841847,
FT                   1850422..1850858,1852799..1853465,1853915..>1854049))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145367"
FT                   /product="mCG145367"
FT                   /note="gene_id=mCG145367.0 transcript_id=mCT184791.0
FT                   protein_id=mCP105470.0"
FT                   /protein_id="EDL22789.1"
FT                   /translation="EGPAMAGPASITTDGAKKPRGRGRGRGRKAEEMGGTRLEPLKPLK
FT                   IKLSVPKAGEGLGAPSNDVISGVDHNSLDSNLTREKIEAKIKEVEEKQPEMKSGFMASF
FT                   LDFLKSGKRHPPLYQAGLTPPLSPPKSVPASVPTRGLQPPPPTVPTVPHPAPSGPFGLG
FT                   GALEAAESEGLGLGCPSPCKRLDEELKRNLETLPSFSSDEEDSVAKNRDLQESISSAIS
FT                   ALDDPPLTGPKDTSTPEEPPLDTGPTASGPPPLPSLPSSNSSGTPEPPLLEEKPPPTPP
FT                   PAPTPQPAPPPPPPPPPVPALPSPTPLVTPVASSPPPPPPPPPPPPALPSPPPPPPPAP
FT                   TTVPPVAPPEEPPAPSPEDPEPPDARPLHLAKKQETAAVCGETDEEAGESGGEGIFRER
FT                   DEFVIRAEDIPSLKLALQTGREPPPIWRVQKALLQKFTPEIKDGQRQFCATSNYLGYFG
FT                   DAKNRYQRLYVKFLENVNKKDYVRVCARKPWHRPPLPVRRSGQTKGPTPVGGNSAPPSK
FT                   VQAPPPKPETPEKMTSEKPPEPAPEPAVPEPPAPEKPSPPRPVEKEKEKEKEKEKEKER
FT                   VTRPLRSERATSGRQMRTDRSLATGQSTTSRLPKARPSKVKAEPPPKKRKKWLKEAVGN
FT                   ASAGDGPGGSSSDSESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEMLVSTALDPDMI
FT                   QALEDTHDELYLPPMRKIDGLLNEHKKKVLKRLSLSPALQDALHTFPQLQVEQTGEGSP
FT                   EEGAVRLRPAGEPYNRKTLSKLKRSVVRAQEFKVELEKSGYYTLYHSLHHYKYHTFLRC
FT                   RDQTLAIEGGAEDLGQEEVVQQCMRNQPWLEQLFDSFSDLLAQAQAHSRCG"
FT   gene            complement(1860671..>1869500)
FT                   /gene="Prrg2"
FT                   /locus_tag="mCG_23156"
FT                   /note="gene_id=mCG23156.2"
FT   mRNA            complement(join(1860671..1861212,1861603..1861731,
FT                   1863820..1863961,1867049..1867088,1867282..1867463,
FT                   1867818..1867969,1868665..1868728,1869455..1869499))
FT                   /gene="Prrg2"
FT                   /locus_tag="mCG_23156"
FT                   /product="proline-rich Gla (G-carboxyglutamic acid)
FT                   polypeptide 2, transcript variant mCT23309"
FT                   /note="gene_id=mCG23156.2 transcript_id=mCT23309.1 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1860695..1861279,1861603..1861731,
FT                   1863820..1863961,1867049..1867088,1867282..1867463,
FT                   1867818..1867969,1868665..1868728,1869455..>1869500))
FT                   /gene="Prrg2"
FT                   /locus_tag="mCG_23156"
FT                   /product="proline-rich Gla (G-carboxyglutamic acid)
FT                   polypeptide 2, transcript variant mCT191782"
FT                   /note="gene_id=mCG23156.2 transcript_id=mCT191782.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1861041..1861212,1861603..1861731,
FT                   1863820..1863961,1867049..1867088,1867282..1867463,
FT                   1867818..1867902))
FT                   /codon_start=1
FT                   /gene="Prrg2"
FT                   /locus_tag="mCG_23156"
FT                   /product="proline-rich Gla (G-carboxyglutamic acid)
FT                   polypeptide 2, isoform CRA_c"
FT                   /note="gene_id=mCG23156.2 transcript_id=mCT23309.1
FT                   protein_id=mCP22689.1 isoform=CRA_c"
FT                   /protein_id="EDL22792.1"
FT                   /translation="MRGRPSLLLVYMGLATCLDTSPHREQNQVLDIFLDAPEAQSFLVG
FT                   RRRFPRANHWDLELLTPGNLERECLEERCSWEEAREYFEDNTLTERFWESYTYNGKGGR
FT                   GRVDVAGLAVGLTSGILLIVLAGLGAFWYLHYRRRRLRGQESCLQETGLIIPLSPQTPQ
FT                   SPPLPPGLPTYEQALAASGVHDAPPPPYSSGFRKSPASSTTGLQCVRGGVRVVGPEVYH
FT                   DTRVSAGHAYTHVPDHPVAELVPPALQ"
FT   mRNA            complement(join(1861044..1861279,1861603..1861731,
FT                   1867049..1867088,1867818..1867969,1868665..1868783))
FT                   /gene="Prrg2"
FT                   /locus_tag="mCG_23156"
FT                   /product="proline-rich Gla (G-carboxyglutamic acid)
FT                   polypeptide 2, transcript variant mCT181315"
FT                   /note="gene_id=mCG23156.2 transcript_id=mCT181315.0 created
FT                   on 20-MAR-2003"
FT   CDS             complement(join(1861261..1861279,1861603..1861731,
FT                   1863820..1863961,1867049..1867088,1867282..1867463,
FT                   1867818..1867969,1868665..>1868696))
FT                   /codon_start=1
FT                   /gene="Prrg2"
FT                   /locus_tag="mCG_23156"
FT                   /product="proline-rich Gla (G-carboxyglutamic acid)
FT                   polypeptide 2, isoform CRA_b"
FT                   /note="gene_id=mCG23156.2 transcript_id=mCT191782.0
FT                   protein_id=mCP112730.0 isoform=CRA_b"
FT                   /protein_id="EDL22791.1"
FT                   /translation="RREAELPALARVRAGSPGLLTPLQHLSSGSPHSMRGRPSLLLVYM
FT                   GLATCLDTSPHREQNQVLDIFLDAPEAQSFLVGRRRFPRANHWDLELLTPGNLERECLE
FT                   ERCSWEEAREYFEDNTLTERFWESYTYNGKGGRGRVDVAGLAVGLTSGILLIVLAGLGA
FT                   FWYLHYRRRRLRGQESCLQETGLIIPLSPQTPQSPPLPPGLPTYEQALAASGVHDAPPP
FT                   PYSSLRRPH"
FT   CDS             complement(join(1861261..1861279,1861603..1861731,
FT                   1867049..1867088,1867818..1867902))
FT                   /codon_start=1
FT                   /gene="Prrg2"
FT                   /locus_tag="mCG_23156"
FT                   /product="proline-rich Gla (G-carboxyglutamic acid)
FT                   polypeptide 2, isoform CRA_a"
FT                   /note="gene_id=mCG23156.2 transcript_id=mCT181315.0
FT                   protein_id=mCP104237.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1929596"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GRY0"
FT                   /protein_id="EDL22790.1"
FT                   /translation="MRGRPSLLLVYMGLATCLDTSPHREQNQGALLGKLYVQWQGRTGL
FT                   IIPLSPQTPQSPPLPPGLPTYEQALAASGVHDAPPPPYSSLRRPH"
FT   gene            1869557..1884888
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /note="gene_id=mCG23145.2"
FT   mRNA            join(1869557..1869608,1880552..1880626,1881044..1881149,
FT                   1881668..1881749,1883131..1883290,1883372..1883490,
FT                   1883689..1883801,1883883..1883991,1884372..1884888)
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /product="nitric oxide synthase interacting protein,
FT                   transcript variant mCT181313"
FT                   /note="gene_id=mCG23145.2 transcript_id=mCT181313.0 created
FT                   on 20-MAR-2003"
FT   mRNA            join(1869569..1869608,1880552..1880626,1881044..1881149,
FT                   1881668..1881749,1883131..1883290,1883372..1883490,
FT                   1883614..1883801,1883883..1883991,1884372..1884888)
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /product="nitric oxide synthase interacting protein,
FT                   transcript variant mCT23297"
FT                   /note="gene_id=mCG23145.2 transcript_id=mCT23297.1 created
FT                   on 20-MAR-2003"
FT   mRNA            join(<1869579..1869608,1880552..1880626,1881044..1881149,
FT                   1881668..1881749,1883131..1883290,1883883..1883991,
FT                   1884372..1884888)
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /product="nitric oxide synthase interacting protein,
FT                   transcript variant mCT191742"
FT                   /note="gene_id=mCG23145.2 transcript_id=mCT191742.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<1869580..1869608,1880552..1880626,1881044..1881149,
FT                   1881668..1881743,1883131..1883290,1883372..1883490,
FT                   1883614..1883801,1883883..>1883922)
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /product="nitric oxide synthase interacting protein,
FT                   transcript variant mCT191741"
FT                   /note="gene_id=mCG23145.2 transcript_id=mCT191741.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1869608..1869608,1880552..1880626,1881044..1881149,
FT                   1881668..1881743,1883131..1883290,1883372..1883490,
FT                   1883614..1883801,1883883..>1883922)
FT                   /codon_start=1
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /product="nitric oxide synthase interacting protein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23145.2 transcript_id=mCT191741.0
FT                   protein_id=mCP112724.0 isoform=CRA_b"
FT                   /protein_id="EDL22794.1"
FT                   /translation="DRMTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDF
FT                   DCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQAYEKQRGARREEQKELQR
FT                   AAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTEGEQPGPSVGPVGKDKDKALPSFW
FT                   IPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTSVRFTQLDDSVDRVGLITRSERYV
FT                   CAVTRDSLSNATPCAVLRPSGAVVTLECVEKLI"
FT   CDS             join(<1869608..1869608,1880552..1880626,1881044..1881149,
FT                   1881668..1881749,1883131..1883290,1883883..1883920)
FT                   /codon_start=1
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /product="nitric oxide synthase interacting protein,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG23145.2 transcript_id=mCT191742.0
FT                   protein_id=mCP112725.0 isoform=CRA_c"
FT                   /protein_id="EDL22795.1"
FT                   /translation="DRMTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDF
FT                   DCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKEL
FT                   QRAAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTVGLWSPWSVLRN"
FT   CDS             join(1880557..1880626,1881044..1881149,1881668..1881749,
FT                   1883131..1883290,1883372..1883490,1883614..1883801,
FT                   1883883..1883991,1884372..1884443)
FT                   /codon_start=1
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /product="nitric oxide synthase interacting protein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG23145.2 transcript_id=mCT23297.1
FT                   protein_id=mCP22709.1 isoform=CRA_d"
FT                   /protein_id="EDL22796.1"
FT                   /translation="MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDC
FT                   CCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQR
FT                   AAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTEGEQPGPSVGPVGKDKDKALPSFW
FT                   IPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTSVRFTQLDDSVDRVGLITRSERYV
FT                   CAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVNGDTLTERDIIVLQRGGT
FT                   GFAGSGVKLQAEMSRPVMQA"
FT   CDS             join(1880557..1880626,1881044..1881149,1881668..1881749,
FT                   1883131..1883290,1883372..1883490,1883689..1883801,
FT                   1883883..1883991,1884372..1884443)
FT                   /codon_start=1
FT                   /gene="Nosip"
FT                   /locus_tag="mCG_23145"
FT                   /product="nitric oxide synthase interacting protein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23145.2 transcript_id=mCT181313.0
FT                   protein_id=mCP104235.0 isoform=CRA_a"
FT                   /protein_id="EDL22793.1"
FT                   /translation="MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDC
FT                   CCLSLQPCHDPVVTPDGYLYEREAILEYILHQKREIARQVKAYEKQRGARREEQKELQR
FT                   AAAQDQVRGFLEKEAAIVSRPLNPFMPKAATLPNTEGEQPGPSVGPVGKDKDKALPSFW
FT                   IPSLTPEAKATKLEKPLDDSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVT
FT                   LECVEKLIRKDMVDPVNGDTLTERDIIVLQRGGTGFAGSGVKLQAEMSRPVMQA"
FT   gene            complement(1889992..>1899244)
FT                   /gene="Rcn3"
FT                   /locus_tag="mCG_145359"
FT                   /note="gene_id=mCG145359.0"
FT   mRNA            complement(join(1889992..1890442,1890645..1890844,
FT                   1891983..1892043,1893752..1893924,1895585..1895787,
FT                   1898531..1898778,1899186..>1899244))
FT                   /gene="Rcn3"
FT                   /locus_tag="mCG_145359"
FT                   /product="reticulocalbin 3, EF-hand calcium binding domain,
FT                   transcript variant mCT184783"
FT                   /note="gene_id=mCG145359.0 transcript_id=mCT184783.0
FT                   created on 05-JUN-2003"
FT   mRNA            complement(join(1889994..1890442,1890645..1890844,
FT                   1891983..1892043,1893752..1893924,1895585..1895787,
FT                   1898531..1898778,1899195..>1899242))
FT                   /gene="Rcn3"
FT                   /locus_tag="mCG_145359"
FT                   /product="reticulocalbin 3, EF-hand calcium binding domain,
FT                   transcript variant mCT191774"
FT                   /note="gene_id=mCG145359.0 transcript_id=mCT191774.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1890335..1890442,1890645..1890844,
FT                   1891983..1892043,1893752..1893924,1895585..1895787,
FT                   1898531..1898778,1899195..>1899212))
FT                   /codon_start=1
FT                   /gene="Rcn3"
FT                   /locus_tag="mCG_145359"
FT                   /product="reticulocalbin 3, EF-hand calcium binding domain,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG145359.0 transcript_id=mCT191774.0
FT                   protein_id=mCP112702.0 isoform=CRA_b"
FT                   /protein_id="EDL22798.1"
FT                   /translation="GANSGREPMMWRWSFLLLLLLLRHWALGKPSPDAGPHGQDRVHHG
FT                   TPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGW
FT                   VSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDV
FT                   EDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDK
FT                   NKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGQLDGSEVGYWVLPP
FT                   SQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL"
FT   CDS             complement(join(1890335..1890442,1890645..1890844,
FT                   1891983..1892043,1893752..1893924,1895585..1895787,
FT                   1898531..1898778,1899186..>1899212))
FT                   /codon_start=1
FT                   /gene="Rcn3"
FT                   /locus_tag="mCG_145359"
FT                   /product="reticulocalbin 3, EF-hand calcium binding domain,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG145359.0 transcript_id=mCT184783.0
FT                   protein_id=mCP105462.0 isoform=CRA_a"
FT                   /protein_id="EDL22797.1"
FT                   /translation="GANSGRVTEEPMMWRWSFLLLLLLLRHWALGKPSPDAGPHGQDRV
FT                   HHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDS
FT                   DGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEF
FT                   HDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLED
FT                   LDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGQLDGSEVGYWV
FT                   LPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL"
FT   gene            complement(1900153..1911500)
FT                   /gene="Fcgrt"
FT                   /locus_tag="mCG_23147"
FT                   /note="gene_id=mCG23147.2"
FT   mRNA            complement(join(1900153..1900444,1900871..1900987,
FT                   1902247..1902516,1909605..1909880,1910109..1910366,
FT                   1910698..1910968,1911335..1911500))
FT                   /gene="Fcgrt"
FT                   /locus_tag="mCG_23147"
FT                   /product="Fc receptor, IgG, alpha chain transporter,
FT                   transcript variant mCT23300"
FT                   /note="gene_id=mCG23147.2 transcript_id=mCT23300.2 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(1900153..1900444,1900871..1900987,
FT                   1902247..1902516,1909605..1909880,1910097..1910366,
FT                   1910698..1910968,1911335..>1911440))
FT                   /gene="Fcgrt"
FT                   /locus_tag="mCG_23147"
FT                   /product="Fc receptor, IgG, alpha chain transporter,
FT                   transcript variant mCT191743"
FT                   /note="gene_id=mCG23147.2 transcript_id=mCT191743.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1900335..1900444,1900871..1900987,
FT                   1902247..1902516,1909605..1909880,1910097..1910366,
FT                   1910698..>1910926))
FT                   /codon_start=1
FT                   /gene="Fcgrt"
FT                   /locus_tag="mCG_23147"
FT                   /product="Fc receptor, IgG, alpha chain transporter,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23147.2 transcript_id=mCT191743.0
FT                   protein_id=mCP112726.0 isoform=CRA_a"
FT                   /protein_id="EDL22799.1"
FT                   /translation="KFTEEHSCLSSWTGSPSHHPASWSTKSPQGPCEESTRRGPEESRV
FT                   PSTPGHPVGMGMPLPWALSLLLVLLPQTWGSETRPPLMYHLTAVSNPSTGLPSFWATGW
FT                   LGPQQYLTYNSLRQEADPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLEKILNG
FT                   QKRGTYTLQGLLGCELASDNSSVPTAVFALNGEEFMKFNPRIGNWTGEWPETEIVANLW
FT                   MKQPDAARKESEFLLNSCPERLLGHLERGRRNLEWKEPPSMRLKARPGNSGSSVLTCAA
FT                   FSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGL
FT                   AQPLTVDLDSSARSSVPVVGIVLGLLLVVVAIAGGVLLWGRMRSGLPAPWLSLSGDDSG
FT                   DLLPGGNLPPEAEPQGANAFPATS"
FT   CDS             complement(join(1900335..1900444,1900871..1900987,
FT                   1902247..1902516,1909605..1909880,1910109..1910366,
FT                   1910698..1910764))
FT                   /codon_start=1
FT                   /gene="Fcgrt"
FT                   /locus_tag="mCG_23147"
FT                   /product="Fc receptor, IgG, alpha chain transporter,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23147.2 transcript_id=mCT23300.2
FT                   protein_id=mCP22716.2 isoform=CRA_b"
FT                   /protein_id="EDL22800.1"
FT                   /translation="MGMPLPWALSLLLVLLPQTWGSETRPPLMYHLTAVSNPSTGLPSF
FT                   WATGWLGPQQYLTYNSLRQEADPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLE
FT                   KILNGTYTLQGLLGCELASDNSSVPTAVFALNGEEFMKFNPRIGNWTGEWPETEIVANL
FT                   WMKQPDAARKESEFLLNSCPERLLGHLERGRRNLEWKEPPSMRLKARPGNSGSSVLTCA
FT                   AFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEG
FT                   LAQPLTVDLDSSARSSVPVVGIVLGLLLVVVAIAGGVLLWGRMRSGLPAPWLSLSGDDS
FT                   GDLLPGGNLPPEAEPQGANAFPATS"
FT   assembly_gap    1905502..1905521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1917802..1917821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1930404..1932793)
FT                   /locus_tag="mCG_23457"
FT                   /note="gene_id=mCG23457.1"
FT   mRNA            complement(join(1930404..1930586,1930857..1930986,
FT                   1931191..1931266,1931447..1931578,1932325..1932793))
FT                   /locus_tag="mCG_23457"
FT                   /product="mCG23457"
FT                   /note="gene_id=mCG23457.1 transcript_id=mCT23350.2 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(1930463..1930586,1930857..1930986,
FT                   1931191..1931266,1931447..1931578,1932325..1932339))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23457"
FT                   /product="mCG23457"
FT                   /note="gene_id=mCG23457.1 transcript_id=mCT23350.2
FT                   protein_id=mCP22726.1"
FT                   /db_xref="GOA:Q3UC02"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR028333"
FT                   /db_xref="InterPro:IPR032440"
FT                   /db_xref="MGI:MGI:1351329"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UC02"
FT                   /protein_id="EDL22801.1"
FT                   /translation="MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFK
FT                   TPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEK
FT                   RHKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF"
FT   gene            complement(1933594..1936760)
FT                   /locus_tag="mCG_23455"
FT                   /note="gene_id=mCG23455.1"
FT   mRNA            complement(join(1933594..1934060,1934143..1934265,
FT                   1934506..1934565,1934737..1934822,1935019..1935120,
FT                   1935237..1935302,1935524..1935596,1936728..1936760))
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, transcript variant mCT23348"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT23348.1 created
FT                   on 08-APR-2003"
FT   mRNA            complement(join(1933594..1934060,1934143..1934265,
FT                   1934506..1934565,1934737..1934822,1935019..1935120,
FT                   1935237..1935302,1935524..1935596,1936570..1936719))
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, transcript variant mCT181842"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT181842.0 created
FT                   on 08-APR-2003"
FT   mRNA            complement(join(1933950..1934060,1934143..1934281,
FT                   1934506..1934565,1934737..1934822,1935019..1935120,
FT                   1935237..1935302,1935524..1935596,1936728..>1936748))
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, transcript variant mCT191751"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT191751.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1933974..1934060,1934143..1934265,
FT                   1934506..1934565,1934737..1934822,1935019..1935120,
FT                   1935237..1935302,1935524..1935596,1936728..1936742))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, isoform CRA_e"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT23348.1
FT                   protein_id=mCP22734.1 isoform=CRA_e"
FT                   /db_xref="GOA:Q5M9M0"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="MGI:MGI:1351455"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M9M0"
FT                   /protein_id="EDL22806.1"
FT                   /translation="MAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISG
FT                   NFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKV
FT                   LDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEK
FT                   AKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTNGLLV"
FT   CDS             complement(join(1933974..1934060,1934143..1934265,
FT                   1934506..1934565,1934737..1934822,1935019..1935091))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, isoform CRA_a"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT181842.0
FT                   protein_id=mCP104764.0 isoform=CRA_a"
FT                   /protein_id="EDL22802.1"
FT                   /translation="MNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLKVLD
FT                   GIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAK
FT                   MHYRKKKQILRLRKQAEKNVEKKICKFTEVLKTNGLLV"
FT   mRNA            complement(join(<1933990..1934060,1934143..1934265,
FT                   1934506..1934565,1934737..1934822,1935019..1935115,
FT                   1935237..1935302,1935524..1935596,1936570..>1936613))
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, transcript variant mCT191753"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT191753.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<1933990..1934060,1934143..1934265,
FT                   1934506..1934565,1934737..1934822,1935019..1935115,
FT                   1935237..1935302,1935524..1935596,1936570..>1936613))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, isoform CRA_d"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT191753.0
FT                   protein_id=mCP112752.0 isoform=CRA_d"
FT                   /protein_id="EDL22805.1"
FT                   /translation="ARGLCNGRNKPRLPRFWYWMAEAIFLAAWRPLWPSRYFWAGRWWS
FT                   YAVKASTFLETSTETSYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQ
FT                   AALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTAT
FT                   LEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTEVLKT"
FT   mRNA            complement(join(<1934144..1934265,1934506..1934565,
FT                   1934737..1934822,1935019..1935115,1935237..1935302,
FT                   1935524..1935596,1936728..>1936751))
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, transcript variant mCT191752"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT191752.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<1934144..1934265,1934506..1934565,
FT                   1934737..1934822,1935019..1935115,1935237..1935302,
FT                   1935524..1935596,1936728..>1936750))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, isoform CRA_c"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT191752.0
FT                   protein_id=mCP112751.0 isoform=CRA_c"
FT                   /protein_id="EDL22804.1"
FT                   /translation="CRRWRRGRFWYWMAEAIFLAAWRPLWPSRYFWAGRWWSYAVKAST
FT                   FLETSTETSYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERLK
FT                   VLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKE
FT                   KAKMHYRKKKQI"
FT   CDS             complement(join(1934237..1934281,1934506..1934565,
FT                   1934737..1934822,1935019..1935120,1935237..1935302,
FT                   1935524..1935596,1936728..>1936748))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23455"
FT                   /product="mCG23455, isoform CRA_b"
FT                   /note="gene_id=mCG23455.1 transcript_id=mCT191751.0
FT                   protein_id=mCP112750.0 isoform=CRA_b"
FT                   /protein_id="EDL22803.1"
FT                   /translation="PKMAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINI
FT                   SGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALERL
FT                   KVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKPCASAVCLPGASGA"
FT   gene            complement(1939214..>1944458)
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /note="gene_id=mCG23444.3"
FT   mRNA            complement(join(1939214..1939594,1940097..1940165,
FT                   1940256..1940440,1941451..1941529,1941926..1942054,
FT                   1942401..1942544,1943150..1943203,1943690..1943803,
FT                   1944044..1944151))
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, transcript
FT                   variant mCT181319"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT181319.0 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1939217..1939459,1940097..1940165,
FT                   1940256..1940440,1941910..1942054,1942401..1942544,
FT                   1943150..1943203,1943690..1943803,1944044..1944110,
FT                   1944405..>1944458))
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, transcript
FT                   variant mCT191792"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT191792.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1939217..1939459,1940256..1940440,
FT                   1941926..1942054,1942401..1942544,1943150..1943203,
FT                   1943690..1943803,1944044..1944110,1944405..1944443))
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, transcript
FT                   variant mCT181318"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT181318.0 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1939217..1939459,1940097..1940165,
FT                   1940256..1942054,1942401..1942544,1943150..1943203,
FT                   1943690..1943803,1944044..>1944103))
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, transcript
FT                   variant mCT191793"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT191793.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1939223..1939393,1940028..1940231,
FT                   1941801..1942054,1942401..1942538,1943146..1943203,
FT                   1943690..1943803,1944044..1944110,1944405..1944458))
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, transcript
FT                   variant mCT181320"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT181320.0 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1939423..1939594,1939695..1939768,
FT                   1940097..1940165,1940256..1940440,1941910..1942054,
FT                   1942401..1942544,1943150..1943203,1943690..1943803,
FT                   1944044..1944110,1944405..1944458))
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, transcript
FT                   variant mCT23311"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT23311.2 created
FT                   on 20-MAR-2003"
FT   mRNA            complement(join(1939442..1939594,1940097..1940165,
FT                   1940256..1940440,1941910..1942054,1942401..1942544,
FT                   1943150..1943203,1943690..1943803,1944044..>1944311))
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, transcript
FT                   variant mCT191791"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT191791.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1940142..1940165,1940256..1940440,
FT                   1941910..1942054,1942401..1942544,1943150..1943203,
FT                   1943690..1943803,1944044..>1944253))
FT                   /codon_start=1
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, isoform CRA_d"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT191791.0
FT                   protein_id=mCP112746.0 isoform=CRA_d"
FT                   /protein_id="EDL22810.1"
FT                   /translation="GSCRKPGGAGGGNAPTSRAAGRGGGVQGWVGKGLQGMSPRPALLS
FT                   LPRTCHRHEGSPAEMTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVK
FT                   FRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNT
FT                   EIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQP
FT                   DSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGEL
FT                   HPGVPLPSHP"
FT   CDS             complement(join(1940142..1940165,1940256..1940440,
FT                   1941451..1941529,1941926..1942054,1942401..1942544,
FT                   1943150..1943203,1943690..1943803,1944044..1944145))
FT                   /codon_start=1
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, isoform CRA_b"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT181319.0
FT                   protein_id=mCP104241.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A1B0GSN6"
FT                   /db_xref="InterPro:IPR004213"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:95560"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GSN6"
FT                   /protein_id="EDL22808.1"
FT                   /translation="MSPRPALLSLPRTCHRHEGSPAEMTVLAPAWSPNSSLLLLLLLLS
FT                   PCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQ
FT                   RWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLL
FT                   ALKPCIGKACQNFSRCLEGLIMQARLTLNSKQSSCLSVLSAGITDSSTLLPPRSPIALE
FT                   ATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP"
FT   CDS             complement(join(1940142..1940165,1940256..1940440,
FT                   1941910..1942054,1942401..1942544,1943150..1943203,
FT                   1943690..1943803,1944044..>1944109))
FT                   /codon_start=1
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, isoform CRA_e"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT191792.0
FT                   protein_id=mCP112747.0 isoform=CRA_e"
FT                   /protein_id="EDL22811.1"
FT                   /translation="TCHRHEGSPAEMTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFS
FT                   HSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGS
FT                   KMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQN
FT                   FSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGL
FT                   RWQRARRRGELHPGVPLPSHP"
FT   CDS             complement(join(1940142..1940165,1940256..1940440,
FT                   1941910..1942054,1942401..1942544,1943150..1943203,
FT                   1943690..1943803,1944044..1944076))
FT                   /codon_start=1
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, isoform CRA_g"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT23311.2
FT                   protein_id=mCP22741.2 isoform=CRA_g"
FT                   /db_xref="GOA:A9QW46"
FT                   /db_xref="InterPro:IPR004213"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:95560"
FT                   /db_xref="UniProtKB/TrEMBL:A9QW46"
FT                   /protein_id="EDL22813.1"
FT                   /translation="MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVK
FT                   FRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNT
FT                   EIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQP
FT                   DSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGEL
FT                   HPGVPLPSHP"
FT   CDS             complement(join(1940183..1940231,1941801..1942054,
FT                   1942401..1942463))
FT                   /codon_start=1
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, isoform CRA_c"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT181320.0
FT                   protein_id=mCP104240.0 isoform=CRA_c"
FT                   /protein_id="EDL22809.1"
FT                   /translation="MQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQL
FT                   LALKPCIGKACQNFSRCLEVQCQPGNGGPRAQHHGATRLTATALLTVCPGLLLPLVGTS
FT                   HMAAGWSGWRGMRGAGG"
FT   CDS             complement(join(1940405..1940440,1941926..1942054,
FT                   1942401..1942544,1943150..1943203,1943690..1943803,
FT                   1944044..1944076))
FT                   /codon_start=1
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, isoform CRA_a"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT181318.0
FT                   protein_id=mCP104242.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VCH4"
FT                   /db_xref="InterPro:IPR004213"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:95560"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VCH4"
FT                   /protein_id="EDL22807.1"
FT                   /translation="MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVK
FT                   FRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNT
FT                   EIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLETPPPC
FT                   CPQGVP"
FT   CDS             complement(join(1941737..1942054,1942401..1942544,
FT                   1943150..1943203,1943690..1943803,1944044..>1944103))
FT                   /codon_start=1
FT                   /gene="Flt3l"
FT                   /locus_tag="mCG_23444"
FT                   /product="FMS-like tyrosine kinase 3 ligand, isoform CRA_f"
FT                   /note="gene_id=mCG23444.3 transcript_id=mCT191793.0
FT                   protein_id=mCP112748.0 isoform=CRA_f"
FT                   /protein_id="EDL22812.1"
FT                   /translation="HRHEGSPAEMTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHS
FT                   PISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKM
FT                   QTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFS
FT                   RCLEVQCQPGNGGPRAQHHGATRLTATALLTVCPGLLLPLVGTSHMFFLPYFLSFLSSF
FT                   LKMYLYV"
FT   gene            complement(1952424..>1965355)
FT                   /gene="Aldh16a1"
FT                   /locus_tag="mCG_23453"
FT                   /note="gene_id=mCG23453.2"
FT   mRNA            complement(join(1952424..1952962,1953640..1953762,
FT                   1953973..1954158,1955373..1955574,1955727..1955894,
FT                   1956336..1956466,1956545..1956650,1956763..1956899,
FT                   1957054..1957149,1957483..1957668,1958022..1958174,
FT                   1958259..1958440,1958744..1958922,1959451..1959577,
FT                   1960501..1960603,1965216..1965347))
FT                   /gene="Aldh16a1"
FT                   /locus_tag="mCG_23453"
FT                   /product="aldehyde dehydrogenase 16 family, member A1,
FT                   transcript variant mCT23346"
FT                   /note="gene_id=mCG23453.2 transcript_id=mCT23346.1 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(1952695..1952962,1953640..1953762,
FT                   1953973..1954158,1955373..1955574,1955727..1955894,
FT                   1956336..1956466,1956545..1956650,1956763..1956899,
FT                   1957054..1957149,1957483..1957668,1958022..1958174,
FT                   1958259..1958440,1958585..1958662,1958744..1958922,
FT                   1959451..1959577,1960501..1960603,1965216..>1965355))
FT                   /gene="Aldh16a1"
FT                   /locus_tag="mCG_23453"
FT                   /product="aldehyde dehydrogenase 16 family, member A1,
FT                   transcript variant mCT191750"
FT                   /note="gene_id=mCG23453.2 transcript_id=mCT191750.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1952801..1952962,1953640..1953762,
FT                   1953973..1954158,1955373..1955574,1955727..1955894,
FT                   1956336..1956466,1956545..1956650,1956763..1956899,
FT                   1957054..1957149,1957483..1957668,1958022..1958174,
FT                   1958259..1958440,1958585..1958662,1958744..1958922,
FT                   1959451..1959577,1960501..1960603,1965216..>1965344))
FT                   /codon_start=1
FT                   /gene="Aldh16a1"
FT                   /locus_tag="mCG_23453"
FT                   /product="aldehyde dehydrogenase 16 family, member A1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23453.2 transcript_id=mCT191750.0
FT                   protein_id=mCP112749.0 isoform=CRA_a"
FT                   /protein_id="EDL22814.1"
FT                   /translation="TVQQSLAEGSGRAMAATRVQPSTREIFTTLEYGPVPESHACALAW
FT                   LDTHNRLLGHHVNGMWLKPEHRNPAPCQDPITGENLASCLQAEAEDIAAAVEAAKIAFK
FT                   AWSQLPGAARGQHLTRLAKVVQKHQRLLWTLESLVTGRAVREVRDGDVPLAQQLLQYHA
FT                   VQAHAQGDALADWQPVGVIGLILPTPFSFLDMMWRVCPALAMGCTVVALVPPAFPTPLL
FT                   LAQLAGELGSFPGILNVVCGPASLGPVLASQPGVQKVAFCGAVEEGRVLRRTLAGRGAE
FT                   LGLALGTESLLLLMDSADVDSAVEGVVDAVWSDRSLGGLRLLIQESVWDEAMRRLQARM
FT                   AQIRSGRGLDGAVDMGARGAAARDLAQSFVDEAQSQGGQVFQAGDVPSSSPFFSPALVS
FT                   GLPPAAPCAQAEVPWPVVMASPFRTVKEALALANGTPRGGSASVWSERLGQALELGYGL
FT                   QVGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDGLYEYLQPLGTPSQESFLCENINYD
FT                   TFGLAASSILPSGPETGPSPAPPYGLFVGGRFQSPGTQSSRPIQDSSGKVSSYVAEGGA
FT                   KDIRGAVEAAHQAAPGWGAQSPRARAGLLWALAAALERRKPVLTSQLERHGAAPTVAKI
FT                   EVELSVRRLQTWGTRVQDQGQTLQVTGLRGPVLRLREPLGVLAVVCPDEWPLLAFVSLL
FT                   APALAHGNAVVLVPSGACPLLALEVCQDIAPLFPAGLVSVVTGDRDHLTRCLALHQDVQ
FT                   ALWYFGSAQGSQFVEWASAGNLKSVWVNRGFPRAWDVEVQGAGQELSLHAARTKALWLP
FT                   MGD"
FT   CDS             complement(join(1952801..1952962,1953640..1953762,
FT                   1953973..1954158,1955373..1955574,1955727..1955894,
FT                   1956336..1956466,1956545..1956650,1956763..1956899,
FT                   1957054..1957149,1957483..1957668,1958022..1958174,
FT                   1958259..1958440,1958744..1958922,1959451..1959577,
FT                   1960501..1960603,1965216..1965305))
FT                   /codon_start=1
FT                   /gene="Aldh16a1"
FT                   /locus_tag="mCG_23453"
FT                   /product="aldehyde dehydrogenase 16 family, member A1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23453.2 transcript_id=mCT23346.1
FT                   protein_id=mCP22738.2 isoform=CRA_b"
FT                   /protein_id="EDL22815.1"
FT                   /translation="MAATRVQPSTREIFTTLEYGPVPESHACALAWLDTHNRLLGHHVN
FT                   GMWLKPEHRNPAPCQDPITGENLASCLQAEAEDIAAAVEAAKIAFKAWSQLPGAARGQH
FT                   LTRLAKVVQKHQRLLWTLESLVTGRAVREVRDGDVPLAQQLLQYHAVQAHAQGDALADW
FT                   QPVGCTVVALVPPAFPTPLLLAQLAGELGSFPGILNVVCGPASLGPVLASQPGVQKVAF
FT                   CGAVEEGRVLRRTLAGRGAELGLALGTESLLLLMDSADVDSAVEGVVDAVWSDRSLGGL
FT                   RLLIQESVWDEAMRRLQARMAQIRSGRGLDGAVDMGARGAAARDLAQSFVDEAQSQGGQ
FT                   VFQAGDVPSSSPFFSPALVSGLPPAAPCAQAEVPWPVVMASPFRTVKEALALANGTPRG
FT                   GSASVWSERLGQALELGYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDGLYEY
FT                   LQPLGTPSQESFLCENINYDTFGLAASSILPSGPETGPSPAPPYGLFVGGRFQSPGTQS
FT                   SRPIQDSSGKVSSYVAEGGAKDIRGAVEAAHQAAPGWGAQSPRARAGLLWALAAALERR
FT                   KPVLTSQLERHGAAPTVAKIEVELSVRRLQTWGTRVQDQGQTLQVTGLRGPVLRLREPL
FT                   GVLAVVCPDEWPLLAFVSLLAPALAHGNAVVLVPSGACPLLALEVCQDIAPLFPAGLVS
FT                   VVTGDRDHLTRCLALHQDVQALWYFGSAQGSQFVEWASAGNLKSVWVNRGFPRAWDVEV
FT                   QGAGQELSLHAARTKALWLPMGD"
FT   gene            1968449..1986966
FT                   /gene="Slc17a7"
FT                   /locus_tag="mCG_23446"
FT                   /note="gene_id=mCG23446.2"
FT   mRNA            join(1968449..1969021,1974610..1974971,1979542..1979794,
FT                   1980338..1980412,1980644..1980762,1981037..1981151,
FT                   1981228..1981315,1981487..1981573,1981674..1981816,
FT                   1982602..1982727,1982885..1983017,1983719..1983829,
FT                   1984189..1984316,1985580..1986966)
FT                   /gene="Slc17a7"
FT                   /locus_tag="mCG_23446"
FT                   /product="solute carrier family 17 (sodium-dependent
FT                   inorganic phosphate cotransporter), member 7"
FT                   /note="gene_id=mCG23446.2 transcript_id=mCT23313.2 created
FT                   on 08-NOV-2002"
FT   CDS             join(1974910..1974971,1979542..1979794,1980338..1980412,
FT                   1980644..1980762,1981037..1981151,1981228..1981315,
FT                   1981487..1981573,1981674..1981816,1982602..1982727,
FT                   1982885..1983017,1983719..1983829,1984189..1984316,
FT                   1985580..1985873)
FT                   /codon_start=1
FT                   /gene="Slc17a7"
FT                   /locus_tag="mCG_23446"
FT                   /product="solute carrier family 17 (sodium-dependent
FT                   inorganic phosphate cotransporter), member 7"
FT                   /note="gene_id=mCG23446.2 transcript_id=mCT23313.2
FT                   protein_id=mCP22730.2"
FT                   /protein_id="EDL22816.1"
FT                   /translation="MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTH
FT                   TRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVV
FT                   QTPYRSVHKQEAVTPTLGDIQGGDTEKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFIC
FT                   QKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKW
FT                   APPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVS
FT                   YESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRS
FT                   WTFYLLLISQPAYFEEVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNC
FT                   GGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGIS
FT                   NGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEP
FT                   EEMSEEKCGFVGHDQLAGSDESEMEDEAEPPGAPPAPPPSYGATHSTVQPPRPPPPVRD
FT                   Y"
FT   gene            1992011..1992667
FT                   /gene="Tifp39"
FT                   /locus_tag="mCG_142424"
FT                   /note="gene_id=mCG142424.0"
FT   mRNA            join(1992011..1992250,1992427..1992667)
FT                   /gene="Tifp39"
FT                   /locus_tag="mCG_142424"
FT                   /product="tuberoinfundibular peptide of 39 residues (TIP39)
FT                   preprohormone"
FT                   /note="gene_id=mCG142424.0 transcript_id=mCT180462.0
FT                   created on 13-FEB-2003"
FT   CDS             join(1992084..1992250,1992427..1992601)
FT                   /codon_start=1
FT                   /gene="Tifp39"
FT                   /locus_tag="mCG_142424"
FT                   /product="tuberoinfundibular peptide of 39 residues (TIP39)
FT                   preprohormone"
FT                   /note="gene_id=mCG142424.0 transcript_id=mCT180462.0
FT                   protein_id=mCP103384.0"
FT                   /db_xref="GOA:A0A1B0GR43"
FT                   /db_xref="InterPro:IPR029396"
FT                   /db_xref="MGI:MGI:2152297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GR43"
FT                   /protein_id="EDL22817.1"
FT                   /translation="MMTLRFWPLYPQVMETCQMSRSPRERLLLLLLLLLLVPWGTGPAS
FT                   GVALPLAGVFSLRAPGRAWAGLGSPLSRRSLALADDAAFRERARLLAALERRRWLDSYM
FT                   QKLLLLDAP"
FT   gene            complement(1994757..2000895)
FT                   /gene="BC050196"
FT                   /locus_tag="mCG_132522"
FT                   /note="gene_id=mCG132522.1"
FT   mRNA            complement(join(1994757..1994937,1995018..1995082,
FT                   2000170..2000229,2000466..2000522,2000779..2000895))
FT                   /gene="BC050196"
FT                   /locus_tag="mCG_132522"
FT                   /product="cDNA sequence BC050196, transcript variant
FT                   mCT175524"
FT                   /note="gene_id=mCG132522.1 transcript_id=mCT175524.0
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(1994891..1994937,1995018..1995082,
FT                   2000170..2000219))
FT                   /codon_start=1
FT                   /gene="BC050196"
FT                   /locus_tag="mCG_132522"
FT                   /product="cDNA sequence BC050196, isoform CRA_b"
FT                   /note="gene_id=mCG132522.1 transcript_id=mCT175524.0
FT                   protein_id=mCP98446.0 isoform=CRA_b"
FT                   /protein_id="EDL22819.1"
FT                   /translation="MQRVWPGPWRSTELPPRLTLPALWEPITINLPQEALVRVATLYQR
FT                   CTKPSCLW"
FT   mRNA            complement(join(1999680..1999746,2000170..2000229,
FT                   2000466..2000522,2000779..2000895))
FT                   /gene="BC050196"
FT                   /locus_tag="mCG_132522"
FT                   /product="cDNA sequence BC050196, transcript variant
FT                   mCT133877"
FT                   /note="gene_id=mCG132522.1 transcript_id=mCT133877.1
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(1999740..1999746,2000170..2000219))
FT                   /codon_start=1
FT                   /gene="BC050196"
FT                   /locus_tag="mCG_132522"
FT                   /product="cDNA sequence BC050196, isoform CRA_a"
FT                   /note="gene_id=mCG132522.1 transcript_id=mCT133877.1
FT                   protein_id=mCP63704.1 isoform=CRA_a"
FT                   /protein_id="EDL22818.1"
FT                   /translation="MQRVWPGPWRSTELPPRN"
FT   gene            complement(2018383..2022909)
FT                   /gene="Dkkl1"
FT                   /locus_tag="mCG_142480"
FT                   /note="gene_id=mCG142480.0"
FT   mRNA            complement(join(2018383..2018725,2020941..2021030,
FT                   2021159..2021299,2022229..2022398,2022584..2022909))
FT                   /gene="Dkkl1"
FT                   /locus_tag="mCG_142480"
FT                   /product="dickkopf-like 1"
FT                   /note="gene_id=mCG142480.0 transcript_id=mCT180519.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(2018417..2018725,2020941..2021030,
FT                   2021159..2021299,2022229..2022381))
FT                   /codon_start=1
FT                   /gene="Dkkl1"
FT                   /locus_tag="mCG_142480"
FT                   /product="dickkopf-like 1"
FT                   /note="gene_id=mCG142480.0 transcript_id=mCT180519.0
FT                   protein_id=mCP103441.0"
FT                   /protein_id="EDL22820.1"
FT                   /translation="MCRLRVLLLLLPLAFVSSSALPIHDVDSQQNTSGFLGLQRLLQSF
FT                   SRLFLKNDLLRDLDNFFSSPMDFRDLPRNFHQEENQEHRMGNHTLSSHLQIDKVTDNQT
FT                   GEVLISEKVEASIEPERNPEGDWKVPKVEAKEPPVPVQKVTDSLHPEPRQVAFWIMKMP
FT                   RRRTQPDVQDGGRWLIEKRHRMQAIRDGLRGGAREDSLEDGVHIPQHAKLPVRKTHFLY
FT                   ILRPSQQL"
FT   gene            <2026577..2044421
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /note="gene_id=mCG23447.3"
FT   mRNA            join(<2026577..2026656,2028037..2028274,2028905..2028969,
FT                   2029968..2030030,2031262..2031369,2031467..2031525,
FT                   2034505..2034569,2036477..2036619,2039447..2039620,
FT                   2042116..2042276,2042985..2043137,2043617..2044421)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT191803"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT191803.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2026579..2026656,2028037..2028274,2028905..2028969,
FT                   2029968..2030030,2031262..2031369,2031467..2031525,
FT                   2034505..2034569,2036477..2036619,2039447..2039620,
FT                   2042116..2042124)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_h"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT191803.0
FT                   protein_id=mCP112764.0 isoform=CRA_h"
FT                   /protein_id="EDL22828.1"
FT                   /translation="FSQTKLPATFSGSRPARPRLPCPGREAQMGDPRTGAPLDDGGGWT
FT                   GSEEGSEEGTGGSEGVGGDGSPDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKM
FT                   YGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATM
FT                   SSAQLISAPSLQAKLGPSGPQATELFQFWSGSSGPPWNVPDVKPFSQAPFSVSLTPPAS
FT                   DLPGYEPPPALSPLPPPAPSPPAWQARALGTARLQLIEFSAFVEPPDAVDSFQRHLFVH
FT                   ISQQCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWRT"
FT   mRNA            join(2026599..2026656,2028037..2028274,2028905..2028976,
FT                   2036534..2036619,2039447..2039621,2042116..2042276,
FT                   2042985..2043137,2043617..2044421)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT185399"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185399.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(2026599..2026656,2028037..2028274,2028905..2028969,
FT                   2029968..2030030,2031262..2031369,2031467..2031525,
FT                   2034505..2034569,2036477..2036619,2039447..2039621,
FT                   2042116..2042276,2042985..2043137,2043617..2044421)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT23314"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT23314.2 created
FT                   on 13-JUN-2003"
FT   mRNA            join(2026599..2026656,2028037..2028274,2028905..2028969,
FT                   2029968..2030030,2031262..2031369,2031467..2031801)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT185396"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185396.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(2026615..2026656,2028037..2028274,2028905..2028969,
FT                   2029968..2030030,2031262..2031748)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT185397"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185397.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(2026633..2026656,2028037..2028274,2028905..2029030)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT185401"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185401.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(2026646..2026698,2028037..2028183,2031467..2031525,
FT                   2034505..2034569,2036477..2036619,2039447..2039621,
FT                   2042116..2042276,2042985..2043137,2043617..2044421)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT185402"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185402.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(<2026655..2026698,2028037..2028274,2028905..2028969,
FT                   2029968..2030030,2031262..2031369,2031467..2031525,
FT                   2034505..2034569,2036477..2036619,2039447..2039620,
FT                   2042116..2042276,2042985..2043137,2043617..2044421)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT191802"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT191802.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2026657..2026698,2028037..2028274,2028905..2028969,
FT                   2029968..2030030,2031262..2031369,2031467..2031525,
FT                   2034505..2034569,2036477..2036619,2039447..2039620,
FT                   2042116..2042124)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_g"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT191802.0
FT                   protein_id=mCP112763.0 isoform=CRA_g"
FT                   /protein_id="EDL22827.1"
FT                   /translation="VGRRRRESGSCLGFAQMGDPRTGAPLDDGGGWTGSEEGSEEGTGG
FT                   SEGVGGDGSPDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIK
FT                   LRTGKTRTRKQVSSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQ
FT                   AKLGPSGPQATELFQFWSGSSGPPWNVPDVKPFSQAPFSVSLTPPASDLPGYEPPPALS
FT                   PLPPPAPSPPAWQARALGTARLQLIEFSAFVEPPDAVDSFQRHLFVHISQQCPSPGAPP
FT                   LESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWRT"
FT   mRNA            join(2027494..2027602,2028037..2028274,2028905..2028969,
FT                   2029968..2030030,2031262..2031369,2031467..2031525,
FT                   2034505..2034569,2036477..2036619,2039447..2039621,
FT                   2042116..2042276,2042985..2043137,2043617..2044421)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT185400"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185400.0 created
FT                   on 13-JUN-2003"
FT   mRNA            join(<2028032..2028169,2028905..2028969,2029968..2030030,
FT                   2031262..2031369,2031467..2031525,2034505..2034569,
FT                   2036477..2036619,2039447..2039620,2042116..2042276,
FT                   2042985..2043137,2043617..2044421)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT191804"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT191804.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2028034..2028169,2028905..2028969,2029968..2030030,
FT                   2031262..2031369,2031467..2031525,2034505..2034569,
FT                   2036477..2036619,2039447..2039620,2042116..2042124)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_i"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT191804.0
FT                   protein_id=mCP112765.0 isoform=CRA_i"
FT                   /protein_id="EDL22829.1"
FT                   /translation="QAQMGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAE
FT                   GRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATMS
FT                   SAQLISAPSLQAKLGPSGPQATELFQFWSGSSGPPWNVPDVKPFSQAPFSVSLTPPASD
FT                   LPGYEPPPALSPLPPPAPSPPAWQARALGTARLQLIEFSAFVEPPDAVDSFQRHLFVHI
FT                   SQQCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWRT"
FT   CDS             join(2028043..2028274,2028905..2028976,2036534..2036619,
FT                   2039447..2039621,2042116..2042276,2042985..2043137,
FT                   2043617..2043730)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_c"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185399.0
FT                   protein_id=mCP106660.0 isoform=CRA_c"
FT                   /protein_id="EDL22823.1"
FT                   /translation="MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVW
FT                   SPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSAWQ
FT                   ARALGTARLQLIEFSAFVEPPDAVDSFQRHLFVHISQQCPSPGAPPLESVDVRQIYDKF
FT                   PEKKGGLRELYDRGPPHAFFLVKFWADLNWGPSAEEAGSSGGGGGFYGVSSQYESRELM
FT                   TLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYM
FT                   MNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQYHIYRLVRD"
FT   CDS             join(2028043..2028274,2028905..2028969,2029968..2030030,
FT                   2031262..2031369,2031467..2031525,2034505..2034569,
FT                   2036477..2036619,2039447..2039621,2042116..2042276,
FT                   2042985..2043137,2043617..2043730)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_d"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185400.0
FT                   protein_id=mCP106656.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q3UPV9"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="InterPro:IPR016361"
FT                   /db_xref="MGI:MGI:104904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPV9"
FT                   /protein_id="EDL22824.1"
FT                   /translation="MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVW
FT                   SPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHI
FT                   QVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKLGPSGPQATELFQF
FT                   WSGSSGPPWNVPDVKPFSQAPFSVSLTPPASDLPGYEPPPALSPLPPPAPSPPAWQARA
FT                   LGTARLQLIEFSAFVEPPDAVDSFQRHLFVHISQQCPSPGAPPLESVDVRQIYDKFPEK
FT                   KGGLRELYDRGPPHAFFLVKFWADLNWGPSAEEAGSSGGGGGFYGVSSQYESRELMTLT
FT                   CSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNS
FT                   VLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQYHIYRLVRD"
FT   CDS             join(2028043..2028274,2028905..2028969,2029968..2030030,
FT                   2031262..2031369,2031467..2031525,2034505..2034569,
FT                   2036477..2036619,2039447..2039621,2042116..2042276,
FT                   2042985..2043137,2043617..2043730)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_d"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT23314.2
FT                   protein_id=mCP22703.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q3UPV9"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="InterPro:IPR016361"
FT                   /db_xref="MGI:MGI:104904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPV9"
FT                   /protein_id="EDL22830.1"
FT                   /translation="MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVW
FT                   SPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHI
FT                   QVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKLGPSGPQATELFQF
FT                   WSGSSGPPWNVPDVKPFSQAPFSVSLTPPASDLPGYEPPPALSPLPPPAPSPPAWQARA
FT                   LGTARLQLIEFSAFVEPPDAVDSFQRHLFVHISQQCPSPGAPPLESVDVRQIYDKFPEK
FT                   KGGLRELYDRGPPHAFFLVKFWADLNWGPSAEEAGSSGGGGGFYGVSSQYESRELMTLT
FT                   CSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNS
FT                   VLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQYHIYRLVRD"
FT   CDS             join(2028043..2028183,2031467..2031525,2034505..2034569,
FT                   2036477..2036619,2039447..2039621,2042116..2042276,
FT                   2042985..2043137,2043617..2043730)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_f"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185402.0
FT                   protein_id=mCP106654.0 isoform=CRA_f"
FT                   /protein_id="EDL22826.1"
FT                   /translation="MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVW
FT                   SPATELFQFWSGSSGPPWNVPDVKPFSQAPFSVSLTPPASDLPGYEPPPALSPLPPPAP
FT                   SPPAWQARALGTARLQLIEFSAFVEPPDAVDSFQRHLFVHISQQCPSPGAPPLESVDVR
FT                   QIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLNWGPSAEEAGSSGGGGGFYGVSSQY
FT                   ESRELMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQ
FT                   LPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQYHIYRLVRD"
FT   CDS             join(2028043..2028274,2028905..2028969,2029968..2030030,
FT                   2031262..2031369,2031467..2031529)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_j"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185396.0
FT                   protein_id=mCP106659.0 isoform=CRA_j"
FT                   /protein_id="EDL22831.1"
FT                   /translation="MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVW
FT                   SPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHI
FT                   QVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKLGPSGPQATELFQF
FT                   WSGSSGPPWNVPE"
FT   CDS             join(2028043..2028274,2028905..2028969,2029968..2030030,
FT                   2031262..2031474)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_a"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185397.0
FT                   protein_id=mCP106655.0 isoform=CRA_a"
FT                   /protein_id="EDL22821.1"
FT                   /translation="MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVW
FT                   SPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHI
FT                   QVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKLGPSGPQVAWVGGC
FT                   GESGMEGWGCNGHRGCLTLIRVSSLGH"
FT   CDS             join(2028043..2028274,2028905..2029020)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_e"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185401.0
FT                   protein_id=mCP106658.0 isoform=CRA_e"
FT                   /protein_id="EDL22825.1"
FT                   /translation="MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVW
FT                   SPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSGVT
FT                   LWNFGLGLGIT"
FT   mRNA            join(2033436..2033548,2034505..2034569,2036477..2036619,
FT                   2039447..2039621,2042116..2042276,2042985..2043137,
FT                   2043617..2044421)
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, transcript variant
FT                   mCT185398"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185398.0 created
FT                   on 13-JUN-2003"
FT   CDS             join(2042214..2042276,2042985..2043137,2043617..2043730)
FT                   /codon_start=1
FT                   /gene="Tead2"
FT                   /locus_tag="mCG_23447"
FT                   /product="TEA domain family member 2, isoform CRA_b"
FT                   /note="gene_id=mCG23447.3 transcript_id=mCT185398.0
FT                   protein_id=mCP106657.0 isoform=CRA_b"
FT                   /protein_id="EDL22822.1"
FT                   /translation="MTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYL
FT                   VNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQYHIY
FT                   RLVRD"
FT   gene            complement(2044439..2049908)
FT                   /gene="Cd37"
FT                   /locus_tag="mCG_23449"
FT                   /note="gene_id=mCG23449.2"
FT   mRNA            complement(join(2044439..2044780,2045486..2045569,
FT                   2046209..2046445,2046917..2047021,2047804..2047878,
FT                   2047962..2048086,2049351..2049423,2049811..2049908))
FT                   /gene="Cd37"
FT                   /locus_tag="mCG_23449"
FT                   /product="CD37 antigen, transcript variant mCT175525"
FT                   /note="gene_id=mCG23449.2 transcript_id=mCT175525.0 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(2044439..2044780,2045486..2045569,
FT                   2046209..2046445,2046917..2047021,2047804..2047878,
FT                   2047962..2048086,2049351..2049423,2049511..2049700))
FT                   /gene="Cd37"
FT                   /locus_tag="mCG_23449"
FT                   /product="CD37 antigen, transcript variant mCT23343"
FT                   /note="gene_id=mCG23449.2 transcript_id=mCT23343.1 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(2044703..2044780,2045486..2045569,
FT                   2046209..2046445,2046917..2047021,2047804..2047878,
FT                   2047962..2048086,2049351..2049423,2049811..2049870))
FT                   /codon_start=1
FT                   /gene="Cd37"
FT                   /locus_tag="mCG_23449"
FT                   /product="CD37 antigen, isoform CRA_a"
FT                   /note="gene_id=mCG23449.2 transcript_id=mCT175525.0
FT                   protein_id=mCP98447.0 isoform=CRA_a"
FT                   /protein_id="EDL22832.1"
FT                   /translation="MDTCEEPIVSLAPTYSKDPQVLGGLIFCFGTWILIDKTSFVSFVG
FT                   LSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGIL
FT                   ISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQM
FT                   LKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHI
FT                   YREGCAQSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR"
FT   CDS             complement(join(2044703..2044780,2045486..2045569,
FT                   2046209..2046445,2046917..2047021,2047804..2047878,
FT                   2047962..2048086,2049351..2049423,2049511..2049579))
FT                   /codon_start=1
FT                   /gene="Cd37"
FT                   /locus_tag="mCG_23449"
FT                   /product="CD37 antigen, isoform CRA_b"
FT                   /note="gene_id=mCG23449.2 transcript_id=mCT23343.1
FT                   protein_id=mCP22713.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FK35"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:88330"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK35"
FT                   /protein_id="EDL22833.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREGCAQSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
FT                   "
FT   gene            <2090732..2099625
FT                   /locus_tag="mCG_132498"
FT                   /note="gene_id=mCG132498.1"
FT   mRNA            join(<2090732..2090981,2091105..2091262,2091346..2091472,
FT                   2091559..2091740,2093276..2093389,2093574..2093815,
FT                   2097290..2097476,2097730..2097931,2098056..2098215,
FT                   2098540..2098705,2098920..2099625)
FT                   /locus_tag="mCG_132498"
FT                   /product="mCG132498"
FT                   /note="gene_id=mCG132498.1 transcript_id=mCT133853.1
FT                   created on 08-NOV-2002"
FT   CDS             join(2090732..2090981,2091105..2091262,2091346..2091472,
FT                   2091559..2091740,2093276..2093389,2093574..2093815,
FT                   2097290..2097476,2097730..2097931,2098056..2098215,
FT                   2098540..2098705,2098920..2099381)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132498"
FT                   /product="mCG132498"
FT                   /note="gene_id=mCG132498.1 transcript_id=mCT133853.1
FT                   protein_id=mCP63518.1"
FT                   /protein_id="EDL22834.1"
FT                   /translation="MDQSFEDFLELKNKPVEEVHTASKKSDNPTSVSRGFRTREVRVTK
FT                   IPNHFQAKKTENILILVAFSIGLGSTWRFPYLCHQNGGGSFLLMYFILLLLLGIPLMYM
FT                   EMVIGQWLRMDNIQAWKYLVPWLSGVGYSNILACVLVVLYNSALVSWSLFYLGQSFDYP
FT                   LPWQNCPLVENLSMVAGNTCLWSEPHQYFWYHTLLQASNQMEEGIEVLVLNVTLCLFAT
FT                   WIFLYVTMVTRIKISVLMMIFSILFSNVLLLCFFIRTLFLNGSVRASLWRLVTIELSIL
FT                   SSLDAWRQAGGHVLYSLGLGMGTIITFSTYQPRGENYIKWASFVAMVNLATSLLSSFVI
FT                   FLVMGFWTTTSGTMCIKRSVSNLINLIANGVLPKAAWPPGDIIHKPPLEYLAWINQLPN
FT                   NLKSQVIHQTLPCSILIQKEKIMEGPGLSYVAFSQAISLFPGSSFWAIIFFMSLAIMGL
FT                   GTMLTLLEGIVLPLQKSISTFAKHPNLVQVLVCLGGFLGSLVFSSRPGSYVVFLFDDLL
FT                   VPMVLIIIVVIQNLSLAWLYGIKRFRAEVFGQLGSLVWSPFTFLWSYVTLPTLLVLLTI
FT                   YFLNLYYSGSPYYVSWNDSMSHEVKQPYKKIPLGWVTFLSVLALLPILVYPLQHWWYLD
FT                   DPNICETLEKPLSSKKTVTVPNRVTQWPVHPMRKLTLRNQEKSKALFQSKSPPENFLHP
FT                   QTLITKKDSENYSTFSLPDATLPSQVGFSTLAIHEVSKYTGHSESFLDSQNTGKK"
FT   gene            complement(2113480..>2144952)
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /note="gene_id=mCG23173.2"
FT   mRNA            complement(join(2113480..2114540,2115457..2115562,
FT                   2115643..2115715,2115796..2115928,2116222..2116342,
FT                   2119092..2119269,2119392..2119566,2119946..2120078,
FT                   2121125..2121547,2125441..2125518,2125827..2125939,
FT                   2127621..2127766,2127852..2127981,2128882..2129016,
FT                   2129185..2129526,2130088..2130200,2132635..2132734,
FT                   2132846..2133037,2133168..2133229,2137415..2137598,
FT                   2137829..2137992,2144576..2144646,2144881..>2144937))
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 4, transcript variant mCT191783"
FT                   /note="gene_id=mCG23173.2 transcript_id=mCT191783.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2114067..2114540,2115457..2115562,
FT                   2115643..2115715,2115796..2115928,2116137..2116342,
FT                   2119092..2119269,2119392..2119566,2119946..2120078,
FT                   2121125..2121547,2125441..2125518,2125827..2125939,
FT                   2127621..2127766,2127852..2127981,2128882..2129016,
FT                   2129185..2129526,2130088..2130200,2132635..2132734,
FT                   2132846..2133037,2133168..2133229,2137415..2137598,
FT                   2137829..2137992,2138124..2138304,2138573..2138747,
FT                   2144576..2144646,2144857..2144934))
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 4, transcript variant mCT23361"
FT                   /note="gene_id=mCG23173.2 transcript_id=mCT23361.1 created
FT                   on 08-NOV-2002"
FT   mRNA            complement(join(2114206..2114540,2115457..2115562,
FT                   2115643..2115715,2115796..2115928,2116137..2116342,
FT                   2119092..2119269,2119392..2119566,2119946..2120078,
FT                   2121125..2121547,2125441..2125518,2125827..2125939,
FT                   2127621..2127766,2127852..2127981,2128882..2129016,
FT                   2129185..2129526,2130088..2130200,2132635..2132734,
FT                   2132846..2133037,2133168..2133229,2137415..2137598,
FT                   2137829..2137992,2144576..2144646,2144770..>2144850))
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 4, transcript variant mCT191784"
FT                   /note="gene_id=mCG23173.2 transcript_id=mCT191784.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2114429..2114540,2115457..2115562,
FT                   2115643..2115715,2115796..2115928,2116137..2116342,
FT                   2119092..2119269,2119392..2119566,2119946..2120078,
FT                   2121125..2121547,2125441..2125518,2125827..2125939,
FT                   2127621..2127766,2127852..2127981,2128882..2129016,
FT                   2129185..2129526,2130088..2130200,2132635..2132734,
FT                   2132846..2133037,2133168..2133229,2137415..2137598,
FT                   2137829..2137992,2138124..2138304,2138573..2138747,
FT                   2144576..2144646,2144881..>2144952))
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 4, transcript variant mCT191785"
FT                   /note="gene_id=mCG23173.2 transcript_id=mCT191785.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2114536..2114540,2115457..2115562,
FT                   2115643..2115715,2115796..2115928,2116137..2116342,
FT                   2119092..2119269,2119392..2119566,2119946..2120078,
FT                   2121125..2121547,2125441..2125518,2125827..2125939,
FT                   2127621..2127766,2127852..2127981,2128882..2129016,
FT                   2129185..2129526,2130088..2130200,2132635..2132734,
FT                   2132846..2133037,2133168..2133229,2137415..2137598,
FT                   2137829..2137992,2138124..2138304,2138573..2138747,
FT                   2144576..2144646,2144881..>2144952))
FT                   /codon_start=1
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 4, isoform CRA_c"
FT                   /note="gene_id=mCG23173.2 transcript_id=mCT191785.0
FT                   protein_id=mCP112734.0 isoform=CRA_c"
FT                   /protein_id="EDL22837.1"
FT                   /translation="SAAGGNTRSLRGCGSSMVGPEKEQSWIPKIFRKKVCTTFIVDLSD
FT                   DAGGTLCQCGQPRDAHPSVAVEDAFGAAVVTEWNSDEHTTEKPTDAYGDLDFTYSGRKH
FT                   SNFLRLSDRTDPATVYSLVTRSWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRRGLVRAA
FT                   QSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMGVAPWGVVRNRDMLINPKG
FT                   SFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGV
FT                   GGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLEDTLAPGS
FT                   GGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKELLTVYSSEDGSEEFETIVLRALV
FT                   KACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQWRSFHLEASLMDALLNDRPEFV
FT                   RLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQASHASSSKSPPVNGTVELRPP
FT                   NVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWS
FT                   DLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARLESEAEEAARRKDLAATF
FT                   ESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQ
FT                   KWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSEEEPTQKDLDFDMDSSINGAGPPG
FT                   TVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHV
FT                   LLVDFQPTKPSVSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLY
FT                   LSDTWNQCDLLALTCFLLGVGCRLTPGLFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGP
FT                   KIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRVFYRPYLQIFGQ
FT                   IPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLL
FT                   NLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHVRLLIKWLRRC
FT                   RRCRRANLPASPVFEHFRVCLSKEAERKLLTWESVHKENFLLAQARDKRDSDSERLKRT
FT                   SQKVDTALKQLGQIREYDRRLRGLEREVQHCSRVLTWMAEALSHSALLPPGAPPPPSPT
FT                   GSKD"
FT   CDS             complement(join(2114536..2114540,2115457..2115562,
FT                   2115643..2115715,2115796..2115928,2116137..2116342,
FT                   2119092..2119269,2119392..2119566,2119946..2120078,
FT                   2121125..2121547,2125441..2125518,2125827..2125939,
FT                   2127621..2127766,2127852..2127981,2128882..2129016,
FT                   2129185..2129526,2130088..2130200,2132635..2132734,
FT                   2132846..2133037,2133168..2133229,2137415..2137598,
FT                   2137829..2137992,2138124..2138304,2138573..2138747,
FT                   2144576..2144646,2144857..2144904))
FT                   /codon_start=1
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 4, isoform CRA_d"
FT                   /note="gene_id=mCG23173.2 transcript_id=mCT23361.1
FT                   protein_id=mCP22691.2 isoform=CRA_d"
FT                   /protein_id="EDL22838.1"
FT                   /translation="MVGPEKEQVSHSVGLGSWIPKIFRKKVCTTFIVDLSDDAGGTLCQ
FT                   CGQPRDAHPSVAVEDAFGAAVVTEWNSDEHTTEKPTDAYGDLDFTYSGRKHSNFLRLSD
FT                   RTDPATVYSLVTRSWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIV
FT                   TGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRW
FT                   RGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGVGGTGIDIP
FT                   VLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLEDTLAPGSGGLRRGEA
FT                   RDRIRRYFPKGDPEVLQAQVERIMTRKELLTVYSSEDGSEEFETIVLRALVKACGSSEA
FT                   SAYLDELRLAVAWNRVDIAQSELFRGDIQWRSFHLEASLMDALLNDRPEFVRLLISHGL
FT                   SLGHFLTPVRLAQLYSAVSPNSLIRNLLDQASHASSSKSPPVNGTVELRPPNVGQVLRT
FT                   LLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALL
FT                   LNRAQMAIYFWEKGSNSVASALGACLLLRVMARLESEAEEAARRKDLAATFESMSVDLF
FT                   GECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDS
FT                   TTPIWALLLAFFCPPLIYTNLIVFRKSEEEPTQKDLDFDMDSSINGAGPPGTVEPSAKV
FT                   ALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQPT
FT                   KPSVSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQC
FT                   DLLALTCFLLGVGCRLTPGLFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKM
FT                   MKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRVFYRPYLQIFGQIPQEEMDV
FT                   ALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFS
FT                   YTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHVRLLIKWLRRCRRCRRANL
FT                   PASPVFEHFRVCLSKEAERKLLTWESVHKENFLLAQARDKRDSDSERLKRTSQKVDTAL
FT                   KQLGQIREYDRRLRGLEREVQHCSRVLTWMAEALSHSALLPPGAPPPPSPTGSKD"
FT   CDS             complement(join(2114536..2114540,2115457..2115562,
FT                   2115643..2115715,2115796..2115928,2116137..2116342,
FT                   2119092..2119269,2119392..2119566,2119946..2120078,
FT                   2121125..2121547,2125441..2125518,2125827..2125939,
FT                   2127621..2127766,2127852..2127981,2128882..2129016,
FT                   2129185..2129526,2130088..2130200,2132635..2132734,
FT                   2132846..2133037,2133168..2133229,2137415..2137598,
FT                   2137829..2137992,2144576..>2144597))
FT                   /codon_start=1
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 4, isoform CRA_b"
FT                   /note="gene_id=mCG23173.2 transcript_id=mCT191784.0
FT                   protein_id=mCP112733.0 isoform=CRA_b"
FT                   /protein_id="EDL22836.1"
FT                   /translation="WTSPMMRGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMG
FT                   VAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGE
FT                   NRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSG
FT                   GAADCLVETLEDTLAPGSGGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKELLTVY
FT                   SSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQWRSF
FT                   HLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQASH
FT                   ASSSKSPPVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMD
FT                   WANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMAR
FT                   LESEAEEAARRKDLAATFESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQ
FT                   ADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSEEEPTQ
FT                   KDLDFDMDSSINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTA
FT                   FLGNVVSYLLFLLLFAHVLLVDFQPTKPSVSELLLYFWAFTLLCEELRQGLGGGWGSLA
FT                   SGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLTPGLFDLGRTVLCLDFM
FT                   IFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSL
FT                   PSILRRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANW
FT                   LVVLLLIVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAP
FT                   PLIIISHVRLLIKWLRRCRRCRRANLPASPVFEHFRVCLSKEAERKLLTWESVHKENFL
FT                   LAQARDKRDSDSERLKRTSQKVDTALKQLGQIREYDRRLRGLEREVQHCSRVLTWMAEA
FT                   LSHSALLPPGAPPPPSPTGSKD"
FT   CDS             complement(join(2115890..2115928,2116222..2116342,
FT                   2119092..2119269,2119392..2119566,2119946..2120078,
FT                   2121125..2121547,2125441..2125518,2125827..2125939,
FT                   2127621..2127766,2127852..2127981,2128882..2129016,
FT                   2129185..2129526,2130088..2130200,2132635..2132734,
FT                   2132846..2133037,2133168..2133229,2137415..2137598,
FT                   2137829..2137992,2144576..>2144597))
FT                   /codon_start=1
FT                   /gene="Trpm4"
FT                   /locus_tag="mCG_23173"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily M, member 4, isoform CRA_a"
FT                   /note="gene_id=mCG23173.2 transcript_id=mCT191783.0
FT                   protein_id=mCP112732.0 isoform=CRA_a"
FT                   /protein_id="EDL22835.1"
FT                   /translation="WTSPMMRGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMG
FT                   VAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGE
FT                   NRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSG
FT                   GAADCLVETLEDTLAPGSGGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKELLTVY
FT                   SSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQWRSF
FT                   HLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQASH
FT                   ASSSKSPPVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMD
FT                   WANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMAR
FT                   LESEAEEAARRKDLAATFESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQ
FT                   ADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSEEEPTQ
FT                   KDLDFDMDSSINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTA
FT                   FLGNVVSYLLFLLLFAHVLLVDFQPTKPSVSELLLYFWAFTLLCEELRQGLGGGWGSLA
FT                   SGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLTPGLFDLGRTVLCLDFM
FT                   IFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSL
FT                   PSILRRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANW
FT                   LVVLLLIVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAP
FT                   PLIIISHVSVSLRKQSGSC"
FT   gene            2135790..2136533
FT                   /locus_tag="mCG_132493"
FT                   /note="gene_id=mCG132493.0"
FT   mRNA            2135790..2136533
FT                   /locus_tag="mCG_132493"
FT                   /product="mCG132493"
FT                   /note="gene_id=mCG132493.0 transcript_id=mCT133848.0
FT                   created on 08-NOV-2002"
FT   CDS             2135813..2136463
FT                   /codon_start=1
FT                   /locus_tag="mCG_132493"
FT                   /product="mCG132493"
FT                   /note="gene_id=mCG132493.0 transcript_id=mCT133848.0
FT                   protein_id=mCP63494.1"
FT                   /protein_id="EDL22839.1"
FT                   /translation="MVFRRYVEVGRVAYISFGPHAGKLVAIVDVIDQNRALVDGPCTRV
FT                   RRQAMPFKCMQLTDFILKFPHSARQKYVRKAWEKADINTKWAATRWAKKIDARERKAKM
FT                   TDFDRFKVMKAKKMRNRIIKTEVKKLQRAAILKASPKKAAVAKAAIAAAAAAAAKAKVP
FT                   AKKATGPGKKAAGQKAPAQKAAGQKVAPPAKGQKGQKTPAQKAPAPKAAGKKA"
FT   assembly_gap    2139355..2139374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2146462..2150172
FT                   /gene="Hrc"
FT                   /locus_tag="mCG_23168"
FT                   /note="gene_id=mCG23168.2"
FT   mRNA            join(2146462..2148244,2148280..2148568,2148655..2148725,
FT                   2149081..2149149,2149348..2149402,2149883..2149919,
FT                   2150075..2150172)
FT                   /gene="Hrc"
FT                   /locus_tag="mCG_23168"
FT                   /product="histidine rich calcium binding protein,
FT                   transcript variant mCT23356"
FT                   /note="gene_id=mCG23168.2 transcript_id=mCT23356.3 created
FT                   on 20-MAR-2003"
FT   mRNA            join(2146484..2148568,2148655..2148725,2149081..2149149,
FT                   2149348..2149402,2149883..2149919,2150075..2150164)
FT                   /gene="Hrc"
FT                   /locus_tag="mCG_23168"
FT                   /product="histidine rich calcium binding protein,
FT                   transcript variant mCT181316"
FT                   /note="gene_id=mCG23168.2 transcript_id=mCT181316.0 created
FT                   on 20-MAR-2003"
FT   CDS             join(2146621..2148568,2148655..2148725,2149081..2149149,
FT                   2149348..2149402,2149883..2149919,2150075..2150111)
FT                   /codon_start=1
FT                   /gene="Hrc"
FT                   /locus_tag="mCG_23168"
FT                   /product="histidine rich calcium binding protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23168.2 transcript_id=mCT181316.0
FT                   protein_id=mCP104238.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8J6"
FT                   /db_xref="InterPro:IPR015666"
FT                   /db_xref="InterPro:IPR019552"
FT                   /db_xref="MGI:MGI:96226"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8J6"
FT                   /protein_id="EDL22840.1"
FT                   /translation="MGFQGPWLHTCLLWATVAILLVPPVVTQELRGAGLGLGNWNNNAG
FT                   IPGSSEDLSTEFGHHIHRGYQGEKDRGHREEGEDFSREYGHRVQDHRYPGREVGEENVS
FT                   EEVFRGHVRQLHGHREHDNEDLGDSAENHLPRQRSHSHEDEDGIVSSEYHRHVPRHAHH
FT                   GHGEEDDDDDGGEEEERVDVMEDSDDNEHQVHGHQSHSKERDELHHAHSHRHQGHSDDD
FT                   DDDGVSTEHGHQAHRYQDHEEEDDGDSDEDSHTHRVQGREDENDDEDGDSGEYRHHTQD
FT                   HQGHNEEQDDDDDDDDDDEDKEDSTEHRHQTQGHRKEEDEDESDEDDHHVSRHGRQGYE
FT                   EEEDDDDDDGDDDSTEHVHQAHRHRDHEHKDDEDDSEEDYHHVPSHGRQSHQNEEEEDE
FT                   AVSTEHWHQSPRHAHHDLGRESEEEVAVKYSHHVASHRPQGHNADREEDSLEEHMNEVP
FT                   GHHHHRASRGDDEDISTEFGHKAPSHRLQDQDERARQGHREPVQGEIAHQPLQPTGPSS
FT                   RESRKEGDHSSQEGDEDPEQRQAHSEEEKEEEEEEEEEEEEEKEGGHSLPMSQEDDEEE
FT                   EKDEKESKVDRAAVSAPLSHHRKQGEEEEEEEEEEEEEILEENLLPFTIIPNPLAGREV
FT                   AREGSSEEESREVTGQQDAQEYENYQPGSLCGYCSFCNRCTECESCHCDEENMGEHCDQ
FT                   CQHCQFCYLCPLVCDTLCTPGSYVDYFSSSLYQALADMLETPEP"
FT   CDS             join(2146621..2148244,2148280..2148314)
FT                   /codon_start=1
FT                   /gene="Hrc"
FT                   /locus_tag="mCG_23168"
FT                   /product="histidine rich calcium binding protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23168.2 transcript_id=mCT23356.3
FT                   protein_id=mCP22721.3 isoform=CRA_b"
FT                   /protein_id="EDL22841.1"
FT                   /translation="MGFQGPWLHTCLLWATVAILLVPPVVTQELRGAGLGLGNWNNNAG
FT                   IPGSSEDLSTEFGHHIHRGYQGEKDRGHREEGEDFSREYGHRVQDHRYPGREVGEENVS
FT                   EEVFRGHVRQLHGHREHDNEDLGDSAENHLPRQRSHSHEDEDGIVSSEYHRHVPRHAHH
FT                   GHGEEDDDDDGGEEEERVDVMEDSDDNEHQVHGHQSHSKERDELHHAHSHRHQGHSDDD
FT                   DDDGVSTEHGHQAHRYQDHEEEDDGDSDEDSHTHRVQGREDENDDEDGDSGEYRHHTQD
FT                   HQGHNEEQDDDDDDDDDDEDKEDSTEHRHQTQGHRKEEDEDESDEDDHHVSRHGRQGYE
FT                   EEEDDDDDDGDDDSTEHVHQAHRHRDHEHKDDEDDSEEDYHHVPSHGRQSHQNEEEEDE
FT                   AVSTEHWHQSPRHAHHDLGRESEEEVAVKYSHHVASHRPQGHNADREEDSLEEHMNEVP
FT                   GHHHHRASRGDDEDISTEFGHKAPSHRLQDQDERARQGHREPVQGEIAHQPLQPTGPSS
FT                   RESRKEGDHSSQEGDEDPEQRQAHRGGGGGERGGP"
FT   gene            complement(2150321..>2151966)
FT                   /gene="2410127E16Rik"
FT                   /locus_tag="mCG_144713"
FT                   /note="gene_id=mCG144713.0"
FT   mRNA            complement(join(2150321..2151211,2151383..2151454,
FT                   2151769..>2151966))
FT                   /gene="2410127E16Rik"
FT                   /locus_tag="mCG_144713"
FT                   /product="RIKEN cDNA 2410127E16"
FT                   /note="gene_id=mCG144713.0 transcript_id=mCT184137.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(2150456..>2150992)
FT                   /codon_start=1
FT                   /gene="2410127E16Rik"
FT                   /locus_tag="mCG_144713"
FT                   /product="RIKEN cDNA 2410127E16"
FT                   /note="gene_id=mCG144713.0 transcript_id=mCT184137.0
FT                   protein_id=mCP105453.0"
FT                   /protein_id="EDL22842.1"
FT                   /translation="SVSNGSQAPCTCGKGAGLPSRAACGEMPPLPFLLPSRGAQVFLLR
FT                   PLGGEGRLAATSLAPFPSPVPLSPAPLRLVASPPGHLQAGFPDPPPCLVFPGASPPPCY
FT                   GGVCAQGSGTQHCVPISPLAPGFAWENPSVNYAAGDVAGERTDNGGAPTPTRPLGSRRY
FT                   SVITGKDLLFQKLWW"
FT   assembly_gap    2177905..2177965
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            2178196..2178913
FT                   /gene="Mtag2"
FT                   /locus_tag="mCG_23170"
FT                   /note="gene_id=mCG23170.0"
FT   mRNA            2178196..2178913
FT                   /gene="Mtag2"
FT                   /locus_tag="mCG_23170"
FT                   /product="metastasis associated gene 2"
FT                   /note="gene_id=mCG23170.0 transcript_id=mCT23358.0 created
FT                   on 08-NOV-2002"
FT   CDS             2178446..2178649
FT                   /codon_start=1
FT                   /gene="Mtag2"
FT                   /locus_tag="mCG_23170"
FT                   /product="metastasis associated gene 2"
FT                   /note="gene_id=mCG23170.0 transcript_id=mCT23358.0
FT                   protein_id=mCP22722.1"
FT                   /protein_id="EDL22843.1"
FT                   /translation="MRPTNPTPTQTVARPARVPPVDGSLRPAYRGNDQAASAGFKTPAS
FT                   DSLETLPGLGLPNLLRVGGSGL"
FT   gene            complement(2178855..2181527)
FT                   /gene="Lin7b"
FT                   /locus_tag="mCG_23172"
FT                   /note="gene_id=mCG23172.1"
FT   mRNA            complement(join(2178855..2178961,2179267..2179430,
FT                   2180104..2180313,2180878..2180949,2181090..2181208,
FT                   2181485..2181527))
FT                   /gene="Lin7b"
FT                   /locus_tag="mCG_23172"
FT                   /product="lin-7 homolog B (C. elegans)"
FT                   /note="gene_id=mCG23172.1 transcript_id=mCT23359.1 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(2178940..2178961,2179267..2179430,
FT                   2180104..2180313,2180878..2180949,2181090..2181208,
FT                   2181485..2181521))
FT                   /codon_start=1
FT                   /gene="Lin7b"
FT                   /locus_tag="mCG_23172"
FT                   /product="lin-7 homolog B (C. elegans)"
FT                   /note="gene_id=mCG23172.1 transcript_id=mCT23359.1
FT                   protein_id=mCP22723.1"
FT                   /protein_id="EDL22844.1"
FT                   /translation="MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSR
FT                   FCSAIREVYEQLYDTLDITGSAEVRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLG
FT                   FNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAA
FT                   QGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHHSYTSLESRG"
FT   gene            complement(2187416..2206658)
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /note="gene_id=mCG23174.4"
FT   mRNA            complement(join(2187416..2188240,2188318..2188405,
FT                   2191679..2191780,2194766..2194847,2198204..2198266,
FT                   2198350..2198414,2203040..2203094,2203224..2203286,
FT                   2205620..2205776,2206473..2206658))
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   transcript variant mCT23362"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT23362.2 created
FT                   on 28-SEP-2004"
FT   mRNA            complement(join(2187416..2188240,2188318..2188405,
FT                   2191679..2191780,2194087..2194146,2194766..2194847,
FT                   2198204..2198266,2198350..2198414,2203040..2203094,
FT                   2203224..2203286,2205620..2205776,2206473..2206658))
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   transcript variant mCT194540"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT194540.0 created
FT                   on 28-SEP-2004"
FT   mRNA            complement(join(2187416..2188240,2188318..2188405,
FT                   2191679..2191780,2192787..2194146,2194766..2194847,
FT                   2198204..2198266,2198350..2198414,2203040..2203094,
FT                   2203224..2203286,2205620..2205776,2206473..2206658))
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   transcript variant mCT191788"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT191788.1 created
FT                   on 28-SEP-2004"
FT   mRNA            complement(join(2187416..2188240,2188318..2188405,
FT                   2191679..2194146,2194766..2194847,2198204..2198266,
FT                   2198350..2198414,2203040..2203094,2203224..2203286,
FT                   2205620..2205776,2206473..2206658))
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   transcript variant mCT191787"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT191787.1 created
FT                   on 28-SEP-2004"
FT   mRNA            complement(join(2187416..2188240,2188318..2188405,
FT                   2191679..2191780,2194766..2194847,2198204..2198266,
FT                   2198350..2198414,2203040..2203094,2203224..2203286,
FT                   2205620..2205776,2206058..2206137,2206473..2206658))
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   transcript variant mCT181317"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT181317.1 created
FT                   on 28-SEP-2004"
FT   CDS             complement(join(2187559..2188240,2188318..2188405,
FT                   2191679..2191780,2194766..2194847,2198204..2198266,
FT                   2198350..2198414,2203040..2203094,2203224..2203286,
FT                   2205620..2205766))
FT                   /codon_start=1
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT23362.2
FT                   protein_id=mCP22774.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2RS68"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="InterPro:IPR034143"
FT                   /db_xref="MGI:MGI:98341"
FT                   /db_xref="UniProtKB/TrEMBL:A2RS68"
FT                   /protein_id="EDL22845.1"
FT                   /translation="MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYI
FT                   REFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKT
FT                   LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKH
FT                   ADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDER
FT                   PGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKDERRRSRERS
FT                   KDKDRDRKRRSSRSRERARRERERKEELRGGGGGGGGGSGGGGGGDMAEPSEAGDGAPD
FT                   DGPPGELGPEGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDREHKRGERGSERGR
FT                   DEARGGGGSGQDNGLEGLGSDGRDMYMEAEGGDGYMAPENGYLMEAAPE"
FT   CDS             complement(join(2187559..2188240,2188318..2188405,
FT                   2191679..2191780,2194766..2194847,2198204..2198266,
FT                   2198350..2198414,2203040..2203094,2203224..2203286,
FT                   2205620..2205766))
FT                   /codon_start=1
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT181317.1
FT                   protein_id=mCP104239.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2RS68"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="InterPro:IPR034143"
FT                   /db_xref="MGI:MGI:98341"
FT                   /db_xref="UniProtKB/TrEMBL:A2RS68"
FT                   /protein_id="EDL22848.1"
FT                   /translation="MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYI
FT                   REFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKT
FT                   LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKH
FT                   ADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDER
FT                   PGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKDERRRSRERS
FT                   KDKDRDRKRRSSRSRERARRERERKEELRGGGGGGGGGSGGGGGGDMAEPSEAGDGAPD
FT                   DGPPGELGPEGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDREHKRGERGSERGR
FT                   DEARGGGGSGQDNGLEGLGSDGRDMYMEAEGGDGYMAPENGYLMEAAPE"
FT   CDS             complement(join(2194121..2194146,2194766..2194847,
FT                   2198204..2198266,2198350..2198414,2203040..2203094,
FT                   2203224..2203286,2205620..2205766))
FT                   /codon_start=1
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT191788.1
FT                   protein_id=mCP112736.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZWP0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="MGI:MGI:98341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWP0"
FT                   /protein_id="EDL22846.1"
FT                   /translation="MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYI
FT                   REFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKT
FT                   LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSTTQL
FT                   ACS"
FT   CDS             complement(join(2194121..2194146,2194766..2194847,
FT                   2198204..2198266,2198350..2198414,2203040..2203094,
FT                   2203224..2203286,2205620..2205766))
FT                   /codon_start=1
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT191787.1
FT                   protein_id=mCP112735.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZWP0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="MGI:MGI:98341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWP0"
FT                   /protein_id="EDL22847.1"
FT                   /translation="MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYI
FT                   REFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKT
FT                   LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSTTQL
FT                   ACS"
FT   CDS             complement(join(2194121..2194146,2194766..2194847,
FT                   2198204..2198266,2198350..2198414,2203040..2203094,
FT                   2203224..2203286,2205620..2205766))
FT                   /codon_start=1
FT                   /gene="Snrp70"
FT                   /locus_tag="mCG_23174"
FT                   /product="U1 small nuclear ribonucleoprotein polypeptide A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23174.4 transcript_id=mCT194540.0
FT                   protein_id=mCP115569.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZWP0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="MGI:MGI:98341"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWP0"
FT                   /protein_id="EDL22849.1"
FT                   /translation="MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYI
FT                   REFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKT
FT                   LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSTTQL
FT                   ACS"
FT   gene            2216927..2222349
FT                   /gene="Kcna7"
FT                   /locus_tag="mCG_132479"
FT                   /note="gene_id=mCG132479.0"
FT   mRNA            join(2216927..2217982,2219912..2222349)
FT                   /gene="Kcna7"
FT                   /locus_tag="mCG_132479"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, member 7"
FT                   /note="gene_id=mCG132479.0 transcript_id=mCT133834.0
FT                   created on 08-NOV-2002"
FT   CDS             join(2217329..2217982,2219912..2220727)
FT                   /codon_start=1
FT                   /gene="Kcna7"
FT                   /locus_tag="mCG_132479"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, member 7"
FT                   /note="gene_id=mCG132479.0 transcript_id=mCT133834.0
FT                   protein_id=mCP63608.1"
FT                   /protein_id="EDL22850.1"
FT                   /translation="MLFLPADTGHPTGVAAASGPHVRSPVARAVRAMEPRCPPPCGCCE
FT                   RLVLNVAGLRFETRARTLGRFPDTLLGDPVRRSRFYDGARREYFFDRHRPSFDAVLYYY
FT                   QSGGRLRRPAHVPLDVFLEEVSFYGLGAAALARLREDEGCAVPPERPLPRRAFARQLWL
FT                   LFEFPESSQAARVLAVVSVLVILVSIVVFCLETLPDFRDDRDDPGLAPVAAATGPFLAR
FT                   LNGSSPMPGAPPRQPFNDPFFVVETLCICWFSFELLVRLVACPSKAVFFKNVMNLIDFV
FT                   AILPYFVALGTELARQRGVGQPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRA
FT                   SMRELGLLIFFLFIGVVLFSSAVYFAEVDRVDTHFTSIPESFWWAVVTMTTVGYGDMAP
FT                   VTVGGKIVGSLCAIAGVLTISLPVPVIVSNFSYFYHRETEGEEAGMYSHVDTQPCGTLE
FT                   GKANGGLVDSEVPELLPPLWPPAGKHMVTEV"
FT   gene            2224630..2228148
FT                   /gene="Ntf5"
FT                   /locus_tag="mCG_23179"
FT                   /note="gene_id=mCG23179.2"
FT   mRNA            join(2224630..2224755,2225527..2225584,2226469..2227623)
FT                   /gene="Ntf5"
FT                   /locus_tag="mCG_23179"
FT                   /product="neurotrophin 5, transcript variant mCT23367"
FT                   /note="gene_id=mCG23179.2 transcript_id=mCT23367.1 created
FT                   on 08-NOV-2002"
FT   mRNA            join(<2224662..2224755,2225701..2225824,2226405..2228148)
FT                   /gene="Ntf5"
FT                   /locus_tag="mCG_23179"
FT                   /product="neurotrophin 5, transcript variant mCT191799"
FT                   /note="gene_id=mCG23179.2 transcript_id=mCT191799.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2225725..2225824,2226405..2227045)
FT                   /codon_start=1
FT                   /gene="Ntf5"
FT                   /locus_tag="mCG_23179"
FT                   /product="neurotrophin 5, isoform CRA_a"
FT                   /note="gene_id=mCG23179.2 transcript_id=mCT191799.0
FT                   protein_id=mCP112738.0 isoform=CRA_a"
FT                   /protein_id="EDL22851.1"
FT                   /translation="DVREETTCILQRGPTQPGGPQSQSEEVEVLLLTGVQAMLPRHSCS
FT                   LLLFLFLLPSVPMEPHPPSSTLPPFLAPEWDLLSPRVALSRGAPAGPPLLFLLEAGAYG
FT                   EPAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAA
FT                   GGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQG
FT                   RVGWRWIRIDTACVCTLLSRTGRA"
FT   CDS             2226476..2227045
FT                   /codon_start=1
FT                   /gene="Ntf5"
FT                   /locus_tag="mCG_23179"
FT                   /product="neurotrophin 5, isoform CRA_b"
FT                   /note="gene_id=mCG23179.2 transcript_id=mCT23367.1
FT                   protein_id=mCP22753.2 isoform=CRA_b"
FT                   /protein_id="EDL22852.1"
FT                   /translation="MEPHPPSSTLPPFLAPEWDLLSPRVALSRGAPAGPPLLFLLEAGA
FT                   YGEPAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVP
FT                   AAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADS
FT                   QGRVGWRWIRIDTACVCTLLSRTGRA"
FT   gene            2231914..2232838
FT                   /gene="Lhb"
FT                   /locus_tag="mCG_23164"
FT                   /note="gene_id=mCG23164.1"
FT   mRNA            join(2231914..2231937,2232185..2232352,2232506..2232838)
FT                   /gene="Lhb"
FT                   /locus_tag="mCG_23164"
FT                   /product="luteinizing hormone beta"
FT                   /note="gene_id=mCG23164.1 transcript_id=mCT23352.1 created
FT                   on 08-NOV-2002"
FT   CDS             join(2231923..2231937,2232185..2232352,2232506..2232748)
FT                   /codon_start=1
FT                   /gene="Lhb"
FT                   /locus_tag="mCG_23164"
FT                   /product="luteinizing hormone beta"
FT                   /note="gene_id=mCG23164.1 transcript_id=mCT23352.1
FT                   protein_id=mCP22694.1"
FT                   /db_xref="GOA:G3X9G6"
FT                   /db_xref="InterPro:IPR001545"
FT                   /db_xref="InterPro:IPR006208"
FT                   /db_xref="InterPro:IPR018245"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:96782"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9G6"
FT                   /protein_id="EDL22853.1"
FT                   /translation="MERLQGLLLWLLLSPSVVWASRGPLRPLCRPVNATLAAENEFCPV
FT                   CITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPV
FT                   ALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL"
FT   gene            complement(2232928..2245265)
FT                   /gene="Ruvbl2"
FT                   /locus_tag="mCG_23165"
FT                   /note="gene_id=mCG23165.0"
FT   mRNA            complement(join(2232928..2232975,2233062..2233176,
FT                   2233355..2233484,2233658..2233777,2235049..2235167,
FT                   2235253..2235347,2235652..2235775,2235921..2236014,
FT                   2236114..2236220,2239449..2239515,2239623..2239752,
FT                   2240424..2240565,2240879..2240934,2242290..2242344,
FT                   2245222..2245265))
FT                   /gene="Ruvbl2"
FT                   /locus_tag="mCG_23165"
FT                   /product="RuvB-like protein 2"
FT                   /note="gene_id=mCG23165.0 transcript_id=mCT23353.0 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(2232950..2232975,2233062..2233176,
FT                   2233355..2233484,2233658..2233777,2235049..2235167,
FT                   2235253..2235347,2235652..2235775,2235921..2236014,
FT                   2236114..2236220,2239449..2239515,2239623..2239752,
FT                   2240424..2240565,2240879..2240934,2242290..2242344,
FT                   2245222..2245233))
FT                   /codon_start=1
FT                   /gene="Ruvbl2"
FT                   /locus_tag="mCG_23165"
FT                   /product="RuvB-like protein 2"
FT                   /note="gene_id=mCG23165.0 transcript_id=mCT23353.0
FT                   protein_id=mCP22705.1"
FT                   /db_xref="GOA:Q3TXT7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1342299"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TXT7"
FT                   /protein_id="EDL22854.1"
FT                   /translation="MATVAATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQG
FT                   MVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIA
FT                   GSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTL
FT                   KTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQT
FT                   KFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVA
FT                   EWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSY
FT                   QSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSL
FT                   RYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGE
FT                   TMDTS"
FT   gene            2245808..2267593
FT                   /gene="Gys1"
FT                   /locus_tag="mCG_23167"
FT                   /note="gene_id=mCG23167.2"
FT   mRNA            join(2245808..2246140,2247502..2247683,2249071..2249262,
FT                   2250448..2250633,2250873..2251017,2253391..2253508,
FT                   2253884..2254004,2254496..2254602,2255600..2255659,
FT                   2255747..2255825,2258866..2258979,2259221..2259347,
FT                   2262531..2262626,2262719..2262882,2265790..2265870,
FT                   2266009..2267593)
FT                   /gene="Gys1"
FT                   /locus_tag="mCG_23167"
FT                   /product="glycogen synthase 1, muscle"
FT                   /note="gene_id=mCG23167.2 transcript_id=mCT23355.2 created
FT                   on 11-NOV-2002"
FT   CDS             join(2246023..2246140,2247502..2247683,2249071..2249262,
FT                   2250448..2250633,2250873..2251017,2253391..2253508,
FT                   2253884..2254004,2254496..2254602,2255600..2255659,
FT                   2255747..2255825,2258866..2258979,2259221..2259347,
FT                   2262531..2262626,2262719..2262882,2265790..2265870,
FT                   2266009..2266335)
FT                   /codon_start=1
FT                   /gene="Gys1"
FT                   /locus_tag="mCG_23167"
FT                   /product="glycogen synthase 1, muscle"
FT                   /note="gene_id=mCG23167.2 transcript_id=mCT23355.2
FT                   protein_id=mCP22715.1"
FT                   /db_xref="GOA:Q9Z1E4"
FT                   /db_xref="InterPro:IPR008631"
FT                   /db_xref="MGI:MGI:101805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1E4"
FT                   /protein_id="EDL22855.1"
FT                   /translation="MPLSRSLSVSSLPGLEDWEDEFDPENAVLFEVAWEVANKVGGIYT
FT                   VLQTKAKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFG
FT                   RWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLG
FT                   EFLAQNEEKPYVVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYN
FT                   NLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNG
FT                   LNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGAD
FT                   VFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEK
FT                   FGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILT
FT                   TIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPA
FT                   ECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQ
FT                   QSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALAKAFPDHFTYEPHEVDATQGYR
FT                   YPRPASVPPSPSLSRHSSPHQSEDEEEPRDGPLGEDSERYDEEEEAAKDRRNIRAPEWP
FT                   RRASCSSSTGGSKRSNSVDTGPSSSLSTPTEPLSPTSSLGEERN"
FT   gene            complement(2268988..2270821)
FT                   /locus_tag="mCG_23169"
FT                   /note="gene_id=mCG23169.2"
FT   mRNA            complement(join(2268988..2269269,2269521..2269646,
FT                   2270070..2270216,2270516..2270821))
FT                   /locus_tag="mCG_23169"
FT                   /product="mCG23169"
FT                   /note="gene_id=mCG23169.2 transcript_id=mCT23357.2 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(2269093..2269269,2269521..2269646,
FT                   2270070..2270216,2270516..2270617))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23169"
FT                   /product="mCG23169"
FT                   /note="gene_id=mCG23169.2 transcript_id=mCT23357.2
FT                   protein_id=mCP22728.2"
FT                   /protein_id="EDL22856.1"
FT                   /translation="MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVAL
FT                   EGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAME
FT                   KNLNQALLDLHALGSARVDPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQT
FT                   GAPQGSLGEYLFERLTLKHD"
FT   gene            complement(2272688..2277815)
FT                   /gene="Bax"
FT                   /locus_tag="mCG_23178"
FT                   /note="gene_id=mCG23178.2"
FT   mRNA            complement(join(2272688..2272952,2274383..2274487,
FT                   2276173..2276308,2276961..2277107,2277204..2277255,
FT                   2277726..2277815))
FT                   /gene="Bax"
FT                   /locus_tag="mCG_23178"
FT                   /product="Bcl2-associated X protein, transcript variant
FT                   mCT23364"
FT                   /note="gene_id=mCG23178.2 transcript_id=mCT23364.1 created
FT                   on 11-NOV-2002"
FT   mRNA            complement(join(<2272848..2272952,2274383..2274487,
FT                   2276173..2276308,2276961..2277107,2277204..>2277759))
FT                   /gene="Bax"
FT                   /locus_tag="mCG_23178"
FT                   /product="Bcl2-associated X protein, transcript variant
FT                   mCT191798"
FT                   /note="gene_id=mCG23178.2 transcript_id=mCT191798.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2272848..2272952,2274383..2274487,
FT                   2276173..2276308,2276961..2277107,2277204..2277255,
FT                   2277726..2277759))
FT                   /codon_start=1
FT                   /gene="Bax"
FT                   /locus_tag="mCG_23178"
FT                   /product="Bcl2-associated X protein, isoform CRA_b"
FT                   /note="gene_id=mCG23178.2 transcript_id=mCT23364.1
FT                   protein_id=mCP22782.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q544Z6"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="InterPro:IPR026304"
FT                   /db_xref="MGI:MGI:99702"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Z6"
FT                   /protein_id="EDL22858.1"
FT                   /translation="MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPEL
FT                   TLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGN
FT                   FNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLS
FT                   YFGTPTWQTVTIFVAGVLTASLTIWKKMG"
FT   CDS             complement(join(2272848..2272952,2274383..2274487,
FT                   2276173..2276308,2276961..2277107,2277204..>2277307))
FT                   /codon_start=1
FT                   /gene="Bax"
FT                   /locus_tag="mCG_23178"
FT                   /product="Bcl2-associated X protein, isoform CRA_a"
FT                   /note="gene_id=mCG23178.2 transcript_id=mCT191798.0
FT                   protein_id=mCP112737.0 isoform=CRA_a"
FT                   /protein_id="EDL22857.1"
FT                   /translation="LSLGPRSPGTPFLLSPPGPTSSEQIMKTGAFLLQGFIQDRAGRMA
FT                   GETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAAD
FT                   MFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGG
FT                   WEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG"
FT   gene            complement(2283835..2300247)
FT                   /gene="Dhdh"
FT                   /locus_tag="mCG_23171"
FT                   /note="gene_id=mCG23171.1"
FT   mRNA            complement(join(2283835..2286361,2286591..2286738,
FT                   2289994..2290118,2292774..2293026,2298192..2298355,
FT                   2299511..2299622,2300128..2300247))
FT                   /gene="Dhdh"
FT                   /locus_tag="mCG_23171"
FT                   /product="dihydrodiol dehydrogenase (dimeric)"
FT                   /note="gene_id=mCG23171.1 transcript_id=mCT23360.1 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(2286252..2286361,2286591..2286738,
FT                   2289994..2290118,2292774..2293026,2298192..2298355,
FT                   2299511..2299622,2300128..2300217))
FT                   /codon_start=1
FT                   /gene="Dhdh"
FT                   /locus_tag="mCG_23171"
FT                   /product="dihydrodiol dehydrogenase (dimeric)"
FT                   /note="gene_id=mCG23171.1 transcript_id=mCT23360.1
FT                   protein_id=mCP22735.2"
FT                   /protein_id="EDL22859.1"
FT                   /translation="MALRWGIVSAGLIANDFTTVLSSLPSSEHQVVAVAARDLNRAEEF
FT                   AQKFNIPKAYGSYEELAKDPNVEVAYIATQHPQHKPAVLLCLAAGKAVLCEKPMGVNAA
FT                   EVREMVAKARSQGVFLMEAIWSRFFPAMEALREVLVQGTIGDLRVARAEFGFDLSHIPR
FT                   ATDWNQAGGGLLDLGIYCVQFLSMIFGAQKPEKISAVGRIHETGVDDTVSVLLQYPGGV
FT                   HGSFTCSISSNLPNTAYVSGTKGMAQIQKLWAPTELVVNGERKEFPPPVLGKDYNFVNG
FT                   SCMLYEANHVRECLRKGLKESPVVPLAESELLAEILEEARKAIGVTFPQDKR"
FT   assembly_gap    2294265..2294284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2296671..2296690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2304339..>2321864)
FT                   /gene="Nucb1"
FT                   /locus_tag="mCG_23163"
FT                   /note="gene_id=mCG23163.2"
FT   mRNA            complement(join(2304339..2305412,2305580..2305676,
FT                   2306081..2306251,2306516..2306608,2306685..2306777,
FT                   2307018..2307076,2309862..2309952,2310187..2310372,
FT                   2311264..2311367,2313045..2313177,2314639..2314746,
FT                   2321162..2321303,2321779..>2321864))
FT                   /gene="Nucb1"
FT                   /locus_tag="mCG_23163"
FT                   /product="nucleobindin 1, transcript variant mCT191744"
FT                   /note="gene_id=mCG23163.2 transcript_id=mCT191744.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2304571..2305412,2305580..2305664,
FT                   2306081..2306251,2306516..2306608,2306685..2306777,
FT                   2307018..2307076,2309862..2309952,2310187..2310372,
FT                   2311264..2311367,2313045..2313177,2314639..2314746,
FT                   2321162..2321310))
FT                   /gene="Nucb1"
FT                   /locus_tag="mCG_23163"
FT                   /product="nucleobindin 1, transcript variant mCT23351"
FT                   /note="gene_id=mCG23163.2 transcript_id=mCT23351.1 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(2305300..2305412,2305580..2305676,
FT                   2306081..2306251,2306516..2306608,2306685..2306777,
FT                   2307018..2307076,2309862..2309952,2310187..2310372,
FT                   2311264..2311367,2313045..2313177,2314639..2314746,
FT                   2321162..2321303,2321779..>2321801))
FT                   /codon_start=1
FT                   /gene="Nucb1"
FT                   /locus_tag="mCG_23163"
FT                   /product="nucleobindin 1, isoform CRA_a"
FT                   /note="gene_id=mCG23163.2 transcript_id=mCT191744.0
FT                   protein_id=mCP112731.0 isoform=CRA_a"
FT                   /protein_id="EDL22860.1"
FT                   /translation="KTPSALERPATMPTSVPRGAPFLLLPPLLMLSAVLAVPVDRAAPP
FT                   QEDSQATETPDTGLYYHRYLQEVINVLETDGHFREKLQAANAEDIKSGKLSQELDFVSH
FT                   NVRTKLDELKRQEVSRLRMLLKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARD
FT                   LELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLQEQQRR
FT                   HREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTK
FT                   ELEKVYDPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTG
FT                   EGWKTVEMSPAYTEEELKRFEEELAAREAELNARAQRLSQETEALGRSQDRLEAQKREL
FT                   QQAVLQMEQRKQQLQEQSAPPSKPDGQLQFRADTDDAPVPAPAGDQKDVPASEKKVPEQ
FT                   PPELPQLDSQHL"
FT   CDS             complement(join(2305300..2305412,2305580..2305664,
FT                   2306081..2306251,2306516..2306608,2306685..2306777,
FT                   2307018..2307076,2309862..2309952,2310187..2310372,
FT                   2311264..2311367,2313045..2313177,2314639..2314746,
FT                   2321162..2321293))
FT                   /codon_start=1
FT                   /gene="Nucb1"
FT                   /locus_tag="mCG_23163"
FT                   /product="nucleobindin 1, isoform CRA_b"
FT                   /note="gene_id=mCG23163.2 transcript_id=mCT23351.1
FT                   protein_id=mCP22787.1 isoform=CRA_b"
FT                   /db_xref="GOA:A0A1C7CYU3"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:97388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C7CYU3"
FT                   /protein_id="EDL22861.1"
FT                   /translation="MPTSVPRGAPFLLLPPLLMLSAVLAVPVDRAAPPQEDSQATETPD
FT                   TGLYYHRYLQEVINVLETDGHFREKLQAANAEDIKSGKLSQELDFVSHNVRTKLDELKR
FT                   QEVSRLRMLLKAKMDAKQEPNLQVDHMNLLKQFEHLDPQNQHTFEARDLELLIQTATRD
FT                   LAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLQEQQRRHREHPKVNVPG
FT                   SQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNE
FT                   EDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWKTVEMSPA
FT                   YTEEELKRFEEELAAREAELNARAQRLSQETEALGRSQDRLEAQKRELQQMEQRKQQLQ
FT                   EQSAPPSKPDGQLQFRADTDDAPVPAPAGDQKDVPASEKKVPEQPPELPQLDSQHL"
FT   gene            2325177..2335066
FT                   /gene="Tulp2"
FT                   /locus_tag="mCG_23191"
FT                   /note="gene_id=mCG23191.3"
FT   mRNA            join(2325177..2325230,2325612..2325642,2326094..2326145,
FT                   2326857..2326995,2327678..2327815,2327955..2328125,
FT                   2329210..2329397,2330016..2330315,2331161..2331273,
FT                   2332174..2332288,2332377..2332475,2333278..2333449,
FT                   2333657..2333782,2333874..2334359)
FT                   /gene="Tulp2"
FT                   /locus_tag="mCG_23191"
FT                   /product="tubby-like protein 2, transcript variant
FT                   mCT23379"
FT                   /note="gene_id=mCG23191.3 transcript_id=mCT23379.1 created
FT                   on 11-NOV-2002"
FT   mRNA            join(<2325188..2325230,2325612..2325642,2326094..2326145,
FT                   2326857..2326995,2327678..2327815,2327955..2328125,
FT                   2329210..2329397,2330016..2330315,2331161..2331273,
FT                   2332174..2332288,2332377..2332475,2333278..2333449,
FT                   2333657..2333821)
FT                   /gene="Tulp2"
FT                   /locus_tag="mCG_23191"
FT                   /product="tubby-like protein 2, transcript variant
FT                   mCT191789"
FT                   /note="gene_id=mCG23191.3 transcript_id=mCT191789.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2325203..2325230,2325612..2325642,2326094..2326145,
FT                   2326857..2326995,2327678..2327815,2327955..2328125,
FT                   2329210..2329397,2330016..2330315,2331161..2331273,
FT                   2332174..2332288,2332377..2332475,2333278..2333449,
FT                   2333657..2333790)
FT                   /codon_start=1
FT                   /gene="Tulp2"
FT                   /locus_tag="mCG_23191"
FT                   /product="tubby-like protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG23191.3 transcript_id=mCT191789.0
FT                   protein_id=mCP112744.0 isoform=CRA_a"
FT                   /protein_id="EDL22862.1"
FT                   /translation="GAKRAKKWATSQENEQWKKETLEDEFSGVRLQKLEQQRQLFEKKQ
FT                   RRKRQEPLMVQANPDATLRHRRPRRGEERFQSDSSWGLGVGSPFLQENVPQAHLPSGAH
FT                   SALVTMSYVADGSGERAPLLSPRGAVYTRGNGPAVRHHLCWLPDSSDSDVEEVTMEDIP
FT                   VISRPPQTNLANLRRGWLASPGPGISQEEKEEEVGSTDARVEDKTPSPDPDPDPTVNSD
FT                   GDHGDLAPCKVEENTAQKNTETASGIGDEDREKGEVTESTETNYAPVASKVLQGDDGDA
FT                   SNHNAWNMTCPQPRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGMFPSYYL
FT                   YLEAEDGVAHFLLAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGTKFTIFD
FT                   NGVNPERSYWVPDSARIREELGVVCYETNVLGFRGPRKMTVILPGMDSRKQRMKVQPQN
FT                   DQDSILSRVQKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQIVHPDEPD
FT                   HLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLACE"
FT   mRNA            join(<2326075..2326145,2327678..2327815,2327955..2328125,
FT                   2329210..2329397,2330016..2330315,2331161..2331273,
FT                   2332174..2332288,2332377..2332475,2333278..2333449,
FT                   2333657..2333782,2334895..2335066)
FT                   /gene="Tulp2"
FT                   /locus_tag="mCG_23191"
FT                   /product="tubby-like protein 2, transcript variant
FT                   mCT191790"
FT                   /note="gene_id=mCG23191.3 transcript_id=mCT191790.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2326109..2326145,2327678..2327815,2327955..2328125,
FT                   2329210..2329397,2330016..2330315,2331161..2331273,
FT                   2332174..2332288,2332377..2332475,2333278..2333449,
FT                   2333657..2333782,2334895..2334896)
FT                   /codon_start=1
FT                   /gene="Tulp2"
FT                   /locus_tag="mCG_23191"
FT                   /product="tubby-like protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG23191.3 transcript_id=mCT191790.0
FT                   protein_id=mCP112745.0 isoform=CRA_b"
FT                   /protein_id="EDL22863.1"
FT                   /translation="ILWREAAEARTTGVGSPFLQENVPQAHLPSGAHSALVTMSYVADG
FT                   SGERAPLLSPRGAVYTRGNGPAVRHHLCWLPDSSDSDVEEVTMEDIPVISRPPQTNLAN
FT                   LRRGWLASPGPGISQEEKEEEVGSTDARVEDKTPSPDPDPDPTVNSDGDHGDLAPCKVE
FT                   ENTAQKNTETASGIGDEDREKGEVTESTETNYAPVASKVLQGDDGDASNHNAWNMTCPQ
FT                   PRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGMFPSYYLYLEAEDGVAHFL
FT                   LAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGTKFTIFDNGVNPERSYWVP
FT                   DSARIREELGVVCYETNVLGFRGPRKMTVILPGMDSRKQRMKVQPQNDQDSILSRVQKG
FT                   AGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQIVHPDEPDHLVLQFGRVAPN
FT                   IFTMDFRYPLCPLQAFAICLSSFDGKLA"
FT   CDS             join(2326905..2326995,2327678..2327815,2327955..2328125,
FT                   2329210..2329397,2330016..2330315,2331161..2331273,
FT                   2332174..2332288,2332377..2332475,2333278..2333449,
FT                   2333657..2333782,2333874..2333881)
FT                   /codon_start=1
FT                   /gene="Tulp2"
FT                   /locus_tag="mCG_23191"
FT                   /product="tubby-like protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG23191.3 transcript_id=mCT23379.1
FT                   protein_id=mCP22707.1 isoform=CRA_c"
FT                   /protein_id="EDL22864.1"
FT                   /translation="MVQANPDATLRHRRPRRGEERFQSDSSWGLGVGSPFLQENVPQAH
FT                   LPSGAHSALVTMSYVADGSGERAPLLSPRGAVYTRGNGPAVRHHLCWLPDSSDSDVEEV
FT                   TMEDIPVISRPPQTNLANLRRGWLASPGPGISQEEKEEEVGSTDARVEDKTPSPDPDPD
FT                   PTVNSDGDHGDLAPCKVEENTAQKNTETASGIGDEDREKGEVTESTETNYAPVASKVLQ
FT                   GDDGDASNHNAWNMTCPQPRIPGPRLGEDMEAYVLLPAPRDHMVQCRIVRNKHGMDKGM
FT                   FPSYYLYLEAEDGVAHFLLAGRKRKRSKTSNYLISLDPKDMSRNGSNFVGKVRSNVLGT
FT                   KFTIFDNGVNPERSYWVPDSARIREELGVVCYETNVLGFRGPRKMTVILPGMDSRKQRM
FT                   KVQPQNDQDSILSRVQKGAGHGLLLLQNKAPSWSDESGAYVLNFHGRVTRASVKNFQIV
FT                   HPDEPDHLVLQFGRVAPNIFTMDFRYPLCPLQAFAICLSSFDGKLAFF"
FT   gene            complement(2334354..2337647)
FT                   /gene="Myd116"
FT                   /locus_tag="mCG_23193"
FT                   /note="gene_id=mCG23193.0"
FT   mRNA            complement(join(2334354..2334756,2335173..2336825,
FT                   2337429..2337647))
FT                   /gene="Myd116"
FT                   /locus_tag="mCG_23193"
FT                   /product="myeloid differentiation primary response gene
FT                   116"
FT                   /note="gene_id=mCG23193.0 transcript_id=mCT23381.1 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(2334427..2334756,2335173..2336816))
FT                   /codon_start=1
FT                   /gene="Myd116"
FT                   /locus_tag="mCG_23193"
FT                   /product="myeloid differentiation primary response gene
FT                   116"
FT                   /note="gene_id=mCG23193.0 transcript_id=mCT23381.1
FT                   protein_id=mCP22755.2"
FT                   /db_xref="GOA:B2RRL7"
FT                   /db_xref="InterPro:IPR019523"
FT                   /db_xref="MGI:MGI:1927072"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRL7"
FT                   /protein_id="EDL22865.1"
FT                   /translation="MAPSPRPQHVLHWRDAHNFYLLSPLMGLLSRAWSRLRGPEVPEAW
FT                   LAKTVTGADQIEAAALLTPTPVSGNLLPHGETEESGSPEQSQAAQRLCLVEAESSPPET
FT                   WGLSNVDEYNAKPGQDDLREKEMERTAGKATLQPAGLQGADKRLGEVVAREEGVAEPAY
FT                   PTSQLEGGPAENEEDGETVKTYQASAASIAPGYKPSTPVPFLGEAEHQATEEKGTENKA
FT                   DPSNSPSSGSHSRAWEYYSREKPKQEGEAKVEAHRAGQGHPCRNAEAEEGGPETTFVCT
FT                   GNAFLKAWVYRPGEDTEEEDNSDSDSAEEDTAQTGATPHTSAFLKAWVYRPGEDTEEED
FT                   SDSDSAEEDTAQTGATPHTSAFLKAWVYRPGEDTEEENSDLDSAEEDTAQTGATPHTSA
FT                   FLKAWVYRPGEDTEEENSDLDSAEEDTAQTGATPHTSPFLKAWVYRPGEDTEDDTEEEE
FT                   DSENVAPGDSETADSSQSPCLQPQRCLPGEKTKGRGEEPPLFQVAFYLPGEKPESPWAA
FT                   PKLPLRLQRRLRLFKAPTRDQDPEIPLKARKVHFAEKVTVHFLAVWAGPAQAARRGPWE
FT                   QFARDRSRFARRIAQAEEKLGPYLTPDSRARAWARLRNPSLPQSEPRSSSEATPLTQDV
FT                   TTPSPLPSETPSPSLYLGGRRG"
FT   gene            <2337763..2365647
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /note="gene_id=mCG23183.2"
FT   mRNA            join(<2337763..2337875,2342426..2342515,2344114..2344221,
FT                   2346232..2346304,2346401..2346501,2346638..2346747,
FT                   2349560..2349776,2350102..2350381,2351825..2351872,
FT                   2352176..2352256,2352400..2352549,2355363..2355461,
FT                   2359368..2359508,2360478..2360577,2360648..2360724,
FT                   2361222..2361383,2364663..2364712,2364987..2365099,
FT                   2365183..2365646)
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 4, transcript
FT                   variant mCT23371"
FT                   /note="gene_id=mCG23183.2 transcript_id=mCT23371.2 created
FT                   on 19-DEC-2002"
FT   mRNA            join(<2337764..2337875,2342426..2342515,2344114..2344221,
FT                   2346232..2346304,2346401..2346501,2346638..2346747,
FT                   2349560..2349776,2350102..2350381,2352176..2352256,
FT                   2352400..2352549,2355363..2355461,2359368..2359508,
FT                   2360478..2360577,2360648..2360986)
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 4, transcript
FT                   variant mCT191749"
FT                   /note="gene_id=mCG23183.2 transcript_id=mCT191749.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    2339020..2339039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2340634..2340653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<2341849..2341990,2343993..2344221,2346232..2346304,
FT                   2346638..2346747,2349560..2349776,2350102..2350381,
FT                   2351825..2351872,2352176..2352256,2352400..2352549,
FT                   2355363..2355461,2359368..2359508,2359936..2360021,
FT                   2360478..2360577,2360648..2360724,2361222..2361383,
FT                   2364987..2365099,2365183..2365647)
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 4, transcript
FT                   variant mCT177782"
FT                   /note="gene_id=mCG23183.2 transcript_id=mCT177782.0 created
FT                   on 19-DEC-2002"
FT   mRNA            join(<2341849..2341990,2343993..2344221,2346232..2346304,
FT                   2346638..2346747,2349560..2349776,2350102..2350381,
FT                   2352176..2352256,2352400..2352549,2355363..2355461,
FT                   2359368..2359508,2359936..2360021,2360478..2360577,
FT                   2360648..2360724,2361222..2361383,2364987..2365099,
FT                   2365183..2365647)
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 4, transcript
FT                   variant mCT191748"
FT                   /note="gene_id=mCG23183.2 transcript_id=mCT191748.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2346696..2346747,2349560..2349776,2350102..2350381,
FT                   2352176..2352256,2352400..2352549,2355363..2355461,
FT                   2359368..2359508,2360478..2360577,2360648..2360739)
FT                   /codon_start=1
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23183.2 transcript_id=mCT191749.0
FT                   protein_id=mCP112740.0 isoform=CRA_c"
FT                   /protein_id="EDL22868.1"
FT                   /translation="EVGFEHWGGPLVRRGKIADSRGHLHVPGLGKVLGDPEDPPEVNRR
FT                   EEGRISESPEVARLSRGLGRHETHTPNSTVDLQTDTWSRRTRSPELFSPLSRPPSPLSL
FT                   PRPRSAPARRPPLSAGDISFPARPHTPLSRIDVRPPLDWGPQRQTLSRPPIPRRGPSSE
FT                   AGGGRPPRSPQPQTPEQRTQTLLTKLCGQDRLLRQLQEDLDKRQEEKEQLEAALELTRQ
FT                   QLGQATREAAASGKAWGRQRLLQDRLVNVRAALCHLAQERERVWDTYSGLEQDLGTLRE
FT                   TLEYLLHLGSPQDRACAQQQLWMVEDTLAGLGGPQKQPPHTDPKSPSPAPQGEESSERE
FT                   SLSESLELSSPQSPEVDWGHPSGGDRALSSPQSGVGSPRVSRASSPECRQPSSPLLRTK
FT                   VDHL"
FT   CDS             join(<2346696..2346747,2349560..2349776,2350102..2350381,
FT                   2352176..2352256,2352400..2352549,2355363..2355461,
FT                   2359368..2359508,2359936..2360016)
FT                   /codon_start=1
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23183.2 transcript_id=mCT191748.0
FT                   protein_id=mCP112739.0 isoform=CRA_b"
FT                   /protein_id="EDL22867.1"
FT                   /translation="EVGFEHWGGPLVRRGKIADSRGHLHVPGLGKVLGDPEDPPEVNRR
FT                   EEGRISESPEVARLSRGLGRHETHTPNSTVDLQTDTWSRRTRSPELFSPLSRPPSPLSL
FT                   PRPRSAPARRPPLSAGDISFPARPHTPLSRIDVRPPLDWGPQRQTLSRPPIPRRGPSSE
FT                   AGGGRPPRSPQPQTPEQRTQTLLTKLCGQDRLLRQLQEDLDKRQEEKEQLEAALELTRQ
FT                   QLGQATREAAASGKAWGRQRLLQDRLVNVRAALCHLAQERERVWDTYSGLEQDLGTLRE
FT                   TLEYLLHLGSPQDRACAQQQLWMVEDTLAGLGGPQKQPPHTDPKSPSPAPQGEESSERE
FT                   TLEWNLNRQTWWQVPLSAEISHQPLI"
FT   CDS             join(<2349622..2349776,2350102..2350381,2351825..2351872,
FT                   2352176..2352256,2352400..2352549,2355363..2355461,
FT                   2359368..2359508,2360478..2360577,2360648..2360724,
FT                   2361222..2361383,2364663..2364712,2364987..2365099,
FT                   2365183..2365445)
FT                   /codon_start=1
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG23183.2 transcript_id=mCT23371.2
FT                   protein_id=mCP22714.2 isoform=CRA_d"
FT                   /protein_id="EDL22869.1"
FT                   /translation="PPEVNRREEGRISESPEVARLSRGLGRHETHTPNSTVDLQTDTWS
FT                   RRTRSPELFSPLSRPPSPLSLPRPRSAPARRPPLSAGDISFPARPHTPLSRIDVRPPLD
FT                   WGPQRQTLSRPPIPRRGPSSEAGGGRPPRSPQPQTPEQRTQPGPPVDSALHQSLETDTL
FT                   LTKLCGQDRLLRQLQEDLDKRQEEKEQLEAALELTRQQLGQATREAAASGKAWGRQRLL
FT                   QDRLVNVRAALCHLAQERERVWDTYSGLEQDLGTLRETLEYLLHLGSPQDRACAQQQLW
FT                   MVEDTLAGLGGPQKQPPHTDPKSPSPAPQGEESSERESLSESLELSSPQSPEVDWGHPS
FT                   GGDRALSSPQSGVGSPRVSRASSPECRQPSSPLLRTKAPLARPRMSAQEQLERMRRNQA
FT                   CGLPLPRPTSPRLLTLGRTLSPAPRQPDMEQRPIVGAAKWLRSSGSWSSPRHSATCSPV
FT                   PGGHRERVLSLSQALATEASQWHRLMAASPGRNLDTRGDCLQPSPQPPSEELPQVTSSP
FT                   APHKATSATTGFSCQGSRRGLAPWEARWDPGKAPPALTQEEGAWPFRVTLLQSSF"
FT   CDS             join(<2349622..2349776,2350102..2350381,2351825..2351872,
FT                   2352176..2352256,2352400..2352549,2355363..2355461,
FT                   2359368..2359508,2359936..2360016)
FT                   /codon_start=1
FT                   /gene="Plekha4"
FT                   /locus_tag="mCG_23183"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23183.2 transcript_id=mCT177782.0
FT                   protein_id=mCP100704.0 isoform=CRA_a"
FT                   /protein_id="EDL22866.1"
FT                   /translation="PPEVNRREEGRISESPEVARLSRGLGRHETHTPNSTVDLQTDTWS
FT                   RRTRSPELFSPLSRPPSPLSLPRPRSAPARRPPLSAGDISFPARPHTPLSRIDVRPPLD
FT                   WGPQRQTLSRPPIPRRGPSSEAGGGRPPRSPQPQTPEQRTQPGPPVDSALHQSLETDTL
FT                   LTKLCGQDRLLRQLQEDLDKRQEEKEQLEAALELTRQQLGQATREAAASGKAWGRQRLL
FT                   QDRLVNVRAALCHLAQERERVWDTYSGLEQDLGTLRETLEYLLHLGSPQDRACAQQQLW
FT                   MVEDTLAGLGGPQKQPPHTDPKSPSPAPQGEESSERETLEWNLNRQTWWQVPLSAEISH
FT                   QPLI"
FT   assembly_gap    2350617..2351137
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   gene            2367459..2375469
FT                   /gene="Dhrs10"
FT                   /locus_tag="mCG_132521"
FT                   /note="gene_id=mCG132521.0"
FT   mRNA            join(2367459..2367512,2374108..2374175,2374273..2374369,
FT                   2374800..2375469)
FT                   /gene="Dhrs10"
FT                   /locus_tag="mCG_132521"
FT                   /product="dehydrogenase/reductase (SDR family) member 10"
FT                   /note="gene_id=mCG132521.0 transcript_id=mCT133876.0
FT                   created on 11-NOV-2002"
FT   CDS             join(2367510..2367512,2374108..2374175,2374273..2374369,
FT                   2374800..2374982)
FT                   /codon_start=1
FT                   /gene="Dhrs10"
FT                   /locus_tag="mCG_132521"
FT                   /product="dehydrogenase/reductase (SDR family) member 10"
FT                   /note="gene_id=mCG132521.0 transcript_id=mCT133876.0
FT                   protein_id=mCP63698.1"
FT                   /protein_id="EDL22870.1"
FT                   /translation="MGAVTAMTKALALDESRHGVRVNCISPGNIWTPLWEELAASTSDP
FT                   RATILEGTLAQPLGRMGQPAEVAAAAVFLASEATFCTGLELLVTGGAELGYGRKASKSS
FT                   LGEVPTLPPNVH"
FT   assembly_gap    2367683..2370525
FT                   /estimated_length=2843
FT                   /gap_type="unknown"
FT   assembly_gap    2374050..2374069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2375941..2383479)
FT                   /locus_tag="mCG_23188"
FT                   /note="gene_id=mCG23188.1"
FT   mRNA            complement(join(2375941..2376532,2379139..2379345,
FT                   2382566..2382675,2382761..2382930,2383280..2383479))
FT                   /locus_tag="mCG_23188"
FT                   /product="mCG23188, transcript variant mCT23376"
FT                   /note="gene_id=mCG23188.1 transcript_id=mCT23376.2 created
FT                   on 11-NOV-2002"
FT   mRNA            complement(join(2375948..2376532,2382566..2382675,
FT                   2382761..2382930,2383280..>2383311))
FT                   /locus_tag="mCG_23188"
FT                   /product="mCG23188, transcript variant mCT191754"
FT                   /note="gene_id=mCG23188.1 transcript_id=mCT191754.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2376196..2376532,2382566..>2382609))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23188"
FT                   /product="mCG23188, isoform CRA_a"
FT                   /note="gene_id=mCG23188.1 transcript_id=mCT191754.0
FT                   protein_id=mCP112741.0 isoform=CRA_a"
FT                   /protein_id="EDL22871.1"
FT                   /translation="RPVRWRGLQRSLINGAERTTVNAPAATNQRLPHTSALANPQRFCS
FT                   STPYLGCAEAGAPRAQPGECPEPVPPPAHPRGVLQLQTKENKCQPPPSDPHVSTLCRLT
FT                   AAATVTIALAKRAKLFSPKGQE"
FT   mRNA            complement(join(2377239..2379345,2382566..2382675,
FT                   2382761..2382930,2383280..>2383328))
FT                   /locus_tag="mCG_23188"
FT                   /product="mCG23188, transcript variant mCT191755"
FT                   /note="gene_id=mCG23188.1 transcript_id=mCT191755.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(2378544..>2379134)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23188"
FT                   /product="mCG23188, isoform CRA_b"
FT                   /note="gene_id=mCG23188.1 transcript_id=mCT191755.0
FT                   protein_id=mCP112742.0 isoform=CRA_b"
FT                   /protein_id="EDL22872.1"
FT                   /translation="ALTEVFWSGGSFIILTDRNLTGITKPGTESLRHCTHRHVLFVPRN
FT                   KILGSIPTQDPAPSHTLSPKRSWAPCLKEPKSNWSLTHTGCMPQPQLPRIHPTLYFSHY
FT                   SPPPWLPTSELPVQAPLAPHSCLPILPPARYSPVFLPKGGSIRLRAGQRNPRHRGMTPS
FT                   RKGCAPVVHPEVRPPRIRSPRAPSAGRPRTHLS"
FT   CDS             complement(join(2379172..2379345,2382566..2382598))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23188"
FT                   /product="mCG23188, isoform CRA_c"
FT                   /note="gene_id=mCG23188.1 transcript_id=mCT23376.2
FT                   protein_id=mCP22766.2 isoform=CRA_c"
FT                   /protein_id="EDL22873.1"
FT                   /translation="MERLAEVTDQWITDSQAQQWWPRTLILGLRRQRRAEFEANLVVYR
FT                   ATGQLGVCSETLPRKDKQTNEIS"
FT   gene            <2379430..2400417
FT                   /gene="Bcat2"
FT                   /locus_tag="mCG_145993"
FT                   /note="gene_id=mCG145993.0"
FT   mRNA            join(<2379430..2379705,2383584..2383658,2383947..2384150,
FT                   2394202..2394312,2394396..2394515,2394694..2394858,
FT                   2398352..2398494,2398638..2398723,2398942..2399082,
FT                   2399157..2399231,2400017..2400417)
FT                   /gene="Bcat2"
FT                   /locus_tag="mCG_145993"
FT                   /product="branched chain aminotransferase 2, mitochondrial"
FT                   /note="gene_id=mCG145993.0 transcript_id=mCT186101.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<2379658..2379705,2383584..2383658,2383947..2384150,
FT                   2394202..2394312,2394396..2394515,2394694..2394858,
FT                   2398352..2398447)
FT                   /codon_start=1
FT                   /gene="Bcat2"
FT                   /locus_tag="mCG_145993"
FT                   /product="branched chain aminotransferase 2, mitochondrial"
FT                   /note="gene_id=mCG145993.0 transcript_id=mCT186101.0
FT                   protein_id=mCP107391.0"
FT                   /protein_id="EDL22874.1"
FT                   /translation="WRHFEHEPAQSYEYLVVWARKLLPVPWLLCGSKRCVSSIFKAADL
FT                   QIQMTKEPQKKPAPSQALLFGKTFTDHMLMVEWNNKAGWGPPRIQPFQNLTLHPACSGL
FT                   HYSLQLFEGLKAYKGGDQQVRLFRPWLNMDRMLRSARRLCLPDFDKQELLECIRQLIEV
FT                   DKDWVPDGNGTSLYVRPVLIGNEPSLGVGMVTQALLYVILCPVGSYFPGDSMTPVSLLA
FT                   DPSFVRAWIGGVGDCKLGGELWTHCGCAARSPEERLRAGPLAVRARPPAH"
FT   assembly_gap    2393622..2393641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2395027..2395046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2407849..2410273
FT                   /locus_tag="mCG_132517"
FT                   /note="gene_id=mCG132517.1"
FT   mRNA            join(2407849..2407940,2408163..2408375,2410058..2410273)
FT                   /locus_tag="mCG_132517"
FT                   /product="mCG132517"
FT                   /note="gene_id=mCG132517.1 transcript_id=mCT133872.1
FT                   created on 11-NOV-2002"
FT   CDS             join(2407890..2407940,2408163..2408273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132517"
FT                   /product="mCG132517"
FT                   /note="gene_id=mCG132517.1 transcript_id=mCT133872.1
FT                   protein_id=mCP63678.1"
FT                   /protein_id="EDL22875.1"
FT                   /translation="MDFEARVLMTFTLVAWQELMVVSLLQSPHLVLGRKKPLKPRQPRG
FT                   HGQKTMFA"
FT   assembly_gap    2422136..2424392
FT                   /estimated_length=2257
FT                   /gap_type="unknown"
FT   assembly_gap    2425407..2430929
FT                   /estimated_length=5523
FT                   /gap_type="unknown"
FT   gene            2432683..>2433980
FT                   /gene="Fut1"
FT                   /locus_tag="mCG_132516"
FT                   /note="gene_id=mCG132516.0"
FT   mRNA            join(2432683..2432889,2433007..2433142,2433813..>2433980)
FT                   /gene="Fut1"
FT                   /locus_tag="mCG_132516"
FT                   /product="fucosyltransferase 1"
FT                   /note="gene_id=mCG132516.0 transcript_id=mCT133871.1
FT                   created on 11-NOV-2002"
FT   CDS             2433815..>2433980
FT                   /codon_start=1
FT                   /gene="Fut1"
FT                   /locus_tag="mCG_132516"
FT                   /product="fucosyltransferase 1"
FT                   /note="gene_id=mCG132516.0 transcript_id=mCT133871.1
FT                   protein_id=mCP63677.1"
FT                   /protein_id="EDL22876.1"
FT                   /translation="MWTPSRRQLCLTFLLVCVLSAGSFFFHLNGGNFFRKGLTLSVLCS
FT                   DYHLRSPQGH"
FT   assembly_gap    2434010..2434029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2435090..>2436223
FT                   /locus_tag="mCG_23182"
FT                   /note="gene_id=mCG23182.0"
FT   mRNA            <2435090..>2436223
FT                   /locus_tag="mCG_23182"
FT                   /product="mCG23182"
FT                   /note="gene_id=mCG23182.0 transcript_id=mCT23370.1 created
FT                   on 08-APR-2003"
FT   CDS             2435090..2436223
FT                   /codon_start=1
FT                   /locus_tag="mCG_23182"
FT                   /product="mCG23182"
FT                   /note="gene_id=mCG23182.0 transcript_id=mCT23370.1
FT                   protein_id=mCP22761.0"
FT                   /db_xref="GOA:P97327"
FT                   /db_xref="InterPro:IPR002516"
FT                   /db_xref="MGI:MGI:109375"
FT                   /db_xref="UniProtKB/TrEMBL:P97327"
FT                   /protein_id="EDL22877.1"
FT                   /translation="MWTPSRRQLCLAFLLVCVLSAGSFFFHLNGGNFFRNGLTLSVLCS
FT                   DYHLLKSPVAMVCLPHPLQTSNGSPSCPEQSSSLSGTWTITPGGRFGNQMGQYATLLAL
FT                   AQLNGRQAFIQPEMHAALAPVFRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPF
FT                   LKLSGFPCSWTFFHHLREQIRREFTLHNHLREGAQYLLSGLRIGPAGIRPHTFVGVHVR
FT                   RGDYLEVMPNRWKGVVGDRAYLQQAMDWFRARHKDPIFVVTSNGMKWCLENIDTSHGDV
FT                   VFAGNGQEGTPGKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKI
FT                   FRPEAAFLPEWVGINADLSPLQAQFDPWKPDSLFRLV"
FT   gene            2438290..2443706
FT                   /gene="Izumo1"
FT                   /locus_tag="mCG_23189"
FT                   /note="gene_id=mCG23189.1"
FT   mRNA            join(2438290..2438480,2439200..2439509,2439772..2439846,
FT                   2440613..2440699,2441140..2441160,2441407..2441487,
FT                   2441600..2441700,2442020..2442173,2442501..2442759,
FT                   2443506..2443706)
FT                   /gene="Izumo1"
FT                   /locus_tag="mCG_23189"
FT                   /product="izumo sperm-egg fusion 1"
FT                   /note="gene_id=mCG23189.1 transcript_id=mCT23377.2 created
FT                   on 11-NOV-2002"
FT   CDS             join(2439275..2439509,2439772..2439846,2440613..2440699,
FT                   2441140..2441160,2441407..2441487,2441600..2441700,
FT                   2442020..2442173,2442501..2442759,2443506..2443686)
FT                   /codon_start=1
FT                   /gene="Izumo1"
FT                   /locus_tag="mCG_23189"
FT                   /product="izumo sperm-egg fusion 1"
FT                   /note="gene_id=mCG23189.1 transcript_id=mCT23377.2
FT                   protein_id=mCP22771.2"
FT                   /protein_id="EDL22878.1"
FT                   /translation="MGPHFTLLLAALANCLCPGRPCIKCDQFVTDALKTFENTYLNDHL
FT                   PHDIHKNVMRMVNHEVSSFGVVTSAEDSYLGAVDENTLEQATWSFLKDLKRITDSDLKG
FT                   ELFIKELLWMLRHQKDIFNNLARQFQKEVLCPNKCGVMSQTLIWCLKCEKQLHICRKSL
FT                   DCGERHIEVHRSEDLVLDCLLSWHRASKGLTDYSFYRVWENSSETLIAKGKEPYLTKSM
FT                   VGPEDAGNYRCVLDTINQGHATVIRYDVTVLPPKHSEENQPPNIITQEEHETPVHVTPQ
FT                   TPPGQEPESELYPELHPELYPELIPTVAQNPEKKMKTRLLILLTLGFVVLVASIIISVL
FT                   HFRKVSAKLKNASDEVKPTASGSKSDQSLSQQMGLKKASQADFNSDYSGDKSEATEN"
FT   gene            2443968..2455569
FT                   /gene="Rasip1"
FT                   /locus_tag="mCG_132497"
FT                   /note="gene_id=mCG132497.0"
FT   mRNA            join(2443968..2444068,2444244..2444384,2444978..2445559,
FT                   2446618..2446973,2448713..2449366,2451296..2451333,
FT                   2451446..2451597,2451695..2451810,2452817..2453060,
FT                   2453199..2453371,2454349..2454496,2455164..2455569)
FT                   /gene="Rasip1"
FT                   /locus_tag="mCG_132497"
FT                   /product="Ras interacting protein 1"
FT                   /note="gene_id=mCG132497.0 transcript_id=mCT133852.0
FT                   created on 11-NOV-2002"
FT   CDS             join(2446839..2446973,2448713..2449366,2451296..2451333,
FT                   2451446..2451597,2451695..2451810,2452817..2453060,
FT                   2453199..2453371,2454349..2454496,2455164..2455363)
FT                   /codon_start=1
FT                   /gene="Rasip1"
FT                   /locus_tag="mCG_132497"
FT                   /product="Ras interacting protein 1"
FT                   /note="gene_id=mCG132497.0 transcript_id=mCT133852.0
FT                   protein_id=mCP63514.1"
FT                   /protein_id="EDL22879.1"
FT                   /translation="MAPGAADAQMVPTDPGDFDQLTQCLIQAPSNRPYFLLLQGYQDAQ
FT                   DFVVYVMTREQHVFGRGGPSSSRGGSPAPYVDTFLNAPDILPRHCTVRAGPEPPAMVRP
FT                   SRGAPVTHNGCLLLREAELHPGDLLGLGEHFLFMYKDPRSGGSGPARPSWLPARPGAAP
FT                   PGPGWAFSCRLCGRGLQERGEALAAYLDGREPVLRFRPREEEALLGEIVRAAASGAGDL
FT                   PPLGPATLLALCVQHSARELELGHLPRLLGRLARLIKEAVWEKIKEIGDRQPENHPEGV
FT                   PEAPLTPEAVSVELRPLILWMANTTELLSFVQEKVLEMEKEADQEGLSSDPQLCNDLEL
FT                   CDEALALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELEAMPPG
FT                   LRPTLGVFQAALELTSQCELHPDLVSQTFGYLFFFSNASLLNSLMERGQGRPFYQWSRA
FT                   VQIRTNLDLVLDWLQGAGLGDIATEFFRKLSIAVNLLCVPRTSLLKASWSSLRTDYPTL
FT                   TPAQLHHLLSHYQLGPGRGPPPAWDPPPAERDAVDTGDIFESFSSHPPLILPLGSSRLR
FT                   LTGPVTDDALHRELRRLRRLLWDLEQQELPANHRHGPPVASTP"
FT   gene            2456455..2462249
FT                   /locus_tag="mCG_1050420"
FT                   /note="gene_id=mCG1050420.0"
FT   mRNA            join(2456455..2456509,2457186..2457323,2458262..2458300,
FT                   2458809..2458948,2459228..2459804,2459977..2460171,
FT                   2460684..2460908,2460999..2461053,2461187..2462249)
FT                   /locus_tag="mCG_1050420"
FT                   /product="mCG1050420"
FT                   /note="gene_id=mCG1050420.0 transcript_id=mCT191786.1
FT                   created on 10-JUN-2004"
FT   CDS             join(2459703..2459804,2459977..2460171,2460684..2460908,
FT                   2460999..2461053,2461187..2461470)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050420"
FT                   /product="mCG1050420"
FT                   /note="gene_id=mCG1050420.0 transcript_id=mCT191786.1
FT                   protein_id=mCP112743.1"
FT                   /protein_id="EDL22880.1"
FT                   /translation="MPVARMKPSSAGVSSPSPPSHKLELQTLKLEELTVSELRQQLRLR
FT                   GLPVSGTKAMLLERMRGGTPPRERPKPRREDKEAAAPWPRLKPKALGTTRLPSTVKASA
FT                   TNRRLKFSGATDPLGAAPAPASVPAPTPSPALAPTPTPAPVPAPAPAPFPTPPASLTLE
FT                   EELQEAIRRAQLLPNRNIDDILEDQVEPDDLLPPVPLDFPGSFDLLSPSPDSEGFSSVF
FT                   SSSLPSPTSSLSPSPRALTDSLDWLEALSGGPPLGSGPPGPSIFSADLSDPSGSLLWEL
FT                   LPDPW"
FT   gene            complement(<2466787..2472062)
FT                   /locus_tag="mCG_23184"
FT                   /note="gene_id=mCG23184.1"
FT   mRNA            complement(join(<2466787..2467831,2471978..2472062))
FT                   /locus_tag="mCG_23184"
FT                   /product="mCG23184"
FT                   /note="gene_id=mCG23184.1 transcript_id=mCT23372.2 created
FT                   on 12-NOV-2002"
FT   CDS             complement(<2466787..2467829)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23184"
FT                   /product="mCG23184"
FT                   /note="gene_id=mCG23184.1 transcript_id=mCT23372.2
FT                   protein_id=mCP22764.2"
FT                   /db_xref="GOA:A6H6C9"
FT                   /db_xref="InterPro:IPR002516"
FT                   /db_xref="MGI:MGI:109374"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6C9"
FT                   /protein_id="EDL22881.1"
FT                   /translation="MASAQVPFSFPLAHFLIFVFVTSTIIHLQQRIVKLQTLSEKELQA
FT                   VQMSSPNAARTDMQQSAKLQGIFTINSIGRLGNQMGEYATLFALARMNGRLAFIPESMH
FT                   NALAPIFRISLPVLHSDTARRIPWQNYHLNDWMEERYRHIPGQYVRFTGYPCSWTFYHH
FT                   LRPEILKEFTLHDHVREEAQAFLRGLRVNGSQPSTFVGVHVRRGDYVHVMPKVWKGVVA
FT                   DRGYLEKALDRFRARYSSPVFVVTSNGMAWCRENINTSLGDVVFAGNGIEGSPAKDFAL
FT                   LTQCNHTIMTIGTFGIWAAYLAGGDTIYLANYTLPDSPFLKIFKPAAAFLPEWMGIPAD
FT                   LSPLLKH"
FT   gene            complement(<2495877..>2496983)
FT                   /locus_tag="mCG_23186"
FT                   /note="gene_id=mCG23186.1"
FT   mRNA            complement(<2495877..>2496983)
FT                   /locus_tag="mCG_23186"
FT                   /product="mCG23186"
FT                   /note="gene_id=mCG23186.1 transcript_id=mCT23374.1 created
FT                   on 12-NOV-2002"
FT   CDS             complement(2495877..2496983)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23186"
FT                   /product="mCG23186"
FT                   /note="gene_id=mCG23186.1 transcript_id=mCT23374.1
FT                   protein_id=mCP22765.1"
FT                   /protein_id="EDL22882.1"
FT                   /translation="MPSDSCLLSLTVLQRLRAICPPLSTFYLFFVIFVVSTIFHCHRRL
FT                   GLVPAPWASPSLVVFPPRHMPREGMFTIRVKGRLGNQMGEYATLFALARMNGRLAFIPA
FT                   SMHSTLAPIFRISLPVLHSDTAKRIPWQNYHLNDWMEERYRHIPGHYVRFTGYPCSWTF
FT                   YHHLRPEILKEFTLHDHVREEAQAFLRGLQVNGSQPSTFVGVHVRRGDYVRVMPKVWKG
FT                   VVADRGYLEKALDRFRARYSSPVFVVTSDDMAWCRKSITASRGDVAFAGNGLQGSPAKD
FT                   IALLMQCNHTVITLGTFGIWAAYLTGGDTVYLANFTQPNSPFHTVFKPEAAYLPEWVGI
FT                   AADLGQPNTVGSGHASARAPKRHWGALL"
FT   gene            complement(2502105..>2503264)
FT                   /locus_tag="mCG_1048632"
FT                   /note="gene_id=mCG1048632.0"
FT   mRNA            complement(join(2502105..2502162,2502683..>2503264))
FT                   /locus_tag="mCG_1048632"
FT                   /product="mCG1048632"
FT                   /note="gene_id=mCG1048632.0 transcript_id=mCT166336.0
FT                   created on 12-NOV-2002"
FT   CDS             complement(2502788..2503264)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048632"
FT                   /product="mCG1048632"
FT                   /note="gene_id=mCG1048632.0 transcript_id=mCT166336.0
FT                   protein_id=mCP63652.0"
FT                   /protein_id="EDL22883.1"
FT                   /translation="MEEPGRERKPREKRWRSLAERGSPQRRDGGAWPREEAHREEEQSP
FT                   AQTRGKPEARQGRAEDRVSGWVVGWHEARGSGAGREEQVGSETGMKAQGRLERERRATT
FT                   AWQKIRRRGLGPRGSEWKPFPHGVLTLFSTPRARKADYCQKTLASLPPTPALHP"
FT   gene            <2503680..2512064
FT                   /locus_tag="mCG_23194"
FT                   /note="gene_id=mCG23194.1"
FT   mRNA            join(<2503680..2504324,2508564..2508752,2508929..2509102,
FT                   2509401..2509454,2509858..2509938,2511511..2512064)
FT                   /locus_tag="mCG_23194"
FT                   /product="mCG23194"
FT                   /note="gene_id=mCG23194.1 transcript_id=mCT23382.1 created
FT                   on 06-NOV-2002"
FT   CDS             join(<2503682..2504324,2508564..2508752,2508929..2509102,
FT                   2509401..2509454,2509858..2509938,2511511..2511902)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23194"
FT                   /product="mCG23194"
FT                   /note="gene_id=mCG23194.1 transcript_id=mCT23382.1
FT                   protein_id=mCP22702.1"
FT                   /protein_id="EDL22884.1"
FT                   /translation="AGSTVTTPITLSLLLLLSQATSDPCYDPGGRPRFCLPPVTQLVGK
FT                   AAAPCSQTCALPAASPGPACNSSLTLDLDGSFLLTSVTLRFCTAGPPALVLSAAWATGG
FT                   PWRPLWRRPAWPGALGGPKKVTFHSPPGPKTRIVASYLRVEFGGKAGLVTTGVRGRCQC
FT                   HGHAARCATRAQPPRCRCRHHTTGPGCESCRPSHRDWPWRPATPQHPHPCLPCSCNQHA
FT                   RRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPITSHKACRACQC
FT                   HPIGATGGMCNQTSGQCSCKLGVTGLTCNRCGPGYQQSRSPRMPCQRESYGTRSRIPEA
FT                   TTTPATTPVASRSDPQCQGYCNVSVSSVHMSLQRYCQQDYVLHAQVSASSSQPSEAVGP
FT                   EWWRLAVHVLAVFKQRAWPVRRGGQEAWVPRADLICGCLRLRPGADYLLLGRAAQTHDD
FT                   NYDPARLILNRHGLALPWRPRWARPLRRLQQKERGGACRGLLPPTRSPGPRN"
FT   assembly_gap    2513676..2514403
FT                   /estimated_length=728
FT                   /gap_type="unknown"
FT   gene            2517499..2522103
FT                   /gene="Car11"
FT                   /locus_tag="mCG_142444"
FT                   /note="gene_id=mCG142444.0"
FT   mRNA            join(2517499..2517833,2517920..2517994,2518718..2518860,
FT                   2519928..2520113,2520327..2520422,2520556..2520628,
FT                   2520953..2521107,2521207..2521372,2521983..2522103)
FT                   /gene="Car11"
FT                   /locus_tag="mCG_142444"
FT                   /product="carbonic anhydrase 11"
FT                   /note="gene_id=mCG142444.0 transcript_id=mCT180482.0
FT                   created on 13-FEB-2003"
FT   CDS             join(2517767..2517833,2517920..2517994,2518718..2518860,
FT                   2519928..2520113,2520327..2520422,2520556..2520628,
FT                   2520953..2521107,2521207..2521372,2521983..2522008)
FT                   /codon_start=1
FT                   /gene="Car11"
FT                   /locus_tag="mCG_142444"
FT                   /product="carbonic anhydrase 11"
FT                   /note="gene_id=mCG142444.0 transcript_id=mCT180482.0
FT                   protein_id=mCP103404.0"
FT                   /db_xref="GOA:Q541E9"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="MGI:MGI:1336193"
FT                   /db_xref="UniProtKB/TrEMBL:Q541E9"
FT                   /protein_id="EDL22885.1"
FT                   /translation="MGGAARLSAPQALVLWAALGAAAHIGPAPDPEDWWSYKENLQGNF
FT                   VPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTG
FT                   RHVSFLPASRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHEGFSAEVQLIHF
FT                   NQELYGNLSAASRGPNGLAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDL
FT                   SLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIF
FT                   QSLSGNGRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGGPHGR"
FT   gene            2522725..2527644
FT                   /gene="Dbp"
FT                   /locus_tag="mCG_10314"
FT                   /note="gene_id=mCG10314.1"
FT   mRNA            join(2522725..2523255,2524099..2524509,2525753..2525964,
FT                   2527158..2527644)
FT                   /gene="Dbp"
FT                   /locus_tag="mCG_10314"
FT                   /product="D site albumin promoter binding protein"
FT                   /note="gene_id=mCG10314.1 transcript_id=mCT10497.1 created
FT                   on 06-NOV-2002"
FT   CDS             join(2523117..2523255,2524099..2524509,2525753..2525964,
FT                   2527158..2527373)
FT                   /codon_start=1
FT                   /gene="Dbp"
FT                   /locus_tag="mCG_10314"
FT                   /product="D site albumin promoter binding protein"
FT                   /note="gene_id=mCG10314.1 transcript_id=mCT10497.1
FT                   protein_id=mCP22742.2"
FT                   /protein_id="EDL22886.1"
FT                   /translation="MARPLSDRTPGPLLLGGPAGAPPGGGALLGLRSLLQGNSKPKEPA
FT                   SCLLKEKERKATLPSAPVPGPGLETAGPADAPSGAVSGGGSPRGRSGPVAGPSLFAPLL
FT                   WERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGLSPAPSPARTPAPSPGPGSCSSSSPR
FT                   SSPGHAPARATLGAAGGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHET
FT                   FDPRRHRFSEEELKPQPIMKKARKVQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKEN
FT                   QISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGTL"
FT   gene            complement(2526959..2535424)
FT                   /gene="Sphk2"
FT                   /locus_tag="mCG_10315"
FT                   /note="gene_id=mCG10315.3"
FT   mRNA            complement(join(2526959..2529304,2529551..2529666,
FT                   2529750..2529844,2529949..2530098,2530753..2531221,
FT                   2535178..2535424))
FT                   /gene="Sphk2"
FT                   /locus_tag="mCG_10315"
FT                   /product="sphingosine kinase 2, transcript variant
FT                   mCT185541"
FT                   /note="gene_id=mCG10315.3 transcript_id=mCT185541.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(2526959..2529304,2529551..2529666,
FT                   2529750..2529844,2529949..2530098,2530753..2531221,
FT                   2534467..2534537,2535178..2535424))
FT                   /gene="Sphk2"
FT                   /locus_tag="mCG_10315"
FT                   /product="sphingosine kinase 2, transcript variant
FT                   mCT10498"
FT                   /note="gene_id=mCG10315.3 transcript_id=mCT10498.2 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(2526959..2529304,2529551..2529666,
FT                   2529750..2529844,2529949..2530098,2530753..2531221,
FT                   2532090..2532700))
FT                   /gene="Sphk2"
FT                   /locus_tag="mCG_10315"
FT                   /product="sphingosine kinase 2, transcript variant
FT                   mCT185540"
FT                   /note="gene_id=mCG10315.3 transcript_id=mCT185540.0 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(2528218..2529304,2529551..2529666,
FT                   2529750..2529844,2529949..2530098,2530753..2531158))
FT                   /codon_start=1
FT                   /gene="Sphk2"
FT                   /locus_tag="mCG_10315"
FT                   /product="sphingosine kinase 2, isoform CRA_a"
FT                   /note="gene_id=mCG10315.3 transcript_id=mCT10498.2
FT                   protein_id=mCP22744.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q58E38"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="MGI:MGI:1861380"
FT                   /db_xref="UniProtKB/TrEMBL:Q58E38"
FT                   /protein_id="EDL22887.1"
FT                   /translation="MAPPPLLPVAASTPILHGEFGSYPANGPRFALTLTTQALHIQRLR
FT                   PKPEARPRDGLVSLDEVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADG
FT                   ATTYEENRAEAQRWATALTCLLRGVPLSGDQEITPELLPRKPRLLILVNPFGGRGLAWQ
FT                   RCMDHVVPMISEAGLSFNLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGL
FT                   LDRPDWEDAVRMPIGVLPCGSGNALAGAVNHHGGFEQVVGVDLLLNCSLLLCRGGSHPL
FT                   DLLSVTLASGSRCFSFLSVAWGFLSDVDIHSERFRALGSARFTLGAVLGLASLHTYRGR
FT                   LSYLPATTEPALPIPGHSLPRAKSELVLAPAPAPAATHSPLHRSVSDLPLPLPQPALVS
FT                   PGSPEPLPDLSLNGGGPELTGDWGGAGDAPLSPDPLLPSSPNALKTAQLSPIAEGPPEM
FT                   PASSGFLPPTHSAPEASTWGPVDHLLPPLGSPLPQDWVTIEGEFVLMLGILPSHLCADL
FT                   MAAPHARFDDGVVHLCWVRSGISRAALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEP
FT                   LTPRGLLTVDGELVEYGPIQAQVHPGLATLLTGPAGQKPQA"
FT   CDS             complement(join(2528218..2529304,2529551..2529666,
FT                   2529750..2529844,2529949..2530098,2530753..2531158))
FT                   /codon_start=1
FT                   /gene="Sphk2"
FT                   /locus_tag="mCG_10315"
FT                   /product="sphingosine kinase 2, isoform CRA_a"
FT                   /note="gene_id=mCG10315.3 transcript_id=mCT185540.0
FT                   protein_id=mCP106799.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q58E38"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="MGI:MGI:1861380"
FT                   /db_xref="UniProtKB/TrEMBL:Q58E38"
FT                   /protein_id="EDL22888.1"
FT                   /translation="MAPPPLLPVAASTPILHGEFGSYPANGPRFALTLTTQALHIQRLR
FT                   PKPEARPRDGLVSLDEVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADG
FT                   ATTYEENRAEAQRWATALTCLLRGVPLSGDQEITPELLPRKPRLLILVNPFGGRGLAWQ
FT                   RCMDHVVPMISEAGLSFNLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGL
FT                   LDRPDWEDAVRMPIGVLPCGSGNALAGAVNHHGGFEQVVGVDLLLNCSLLLCRGGSHPL
FT                   DLLSVTLASGSRCFSFLSVAWGFLSDVDIHSERFRALGSARFTLGAVLGLASLHTYRGR
FT                   LSYLPATTEPALPIPGHSLPRAKSELVLAPAPAPAATHSPLHRSVSDLPLPLPQPALVS
FT                   PGSPEPLPDLSLNGGGPELTGDWGGAGDAPLSPDPLLPSSPNALKTAQLSPIAEGPPEM
FT                   PASSGFLPPTHSAPEASTWGPVDHLLPPLGSPLPQDWVTIEGEFVLMLGILPSHLCADL
FT                   MAAPHARFDDGVVHLCWVRSGISRAALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEP
FT                   LTPRGLLTVDGELVEYGPIQAQVHPGLATLLTGPAGQKPQA"
FT   CDS             complement(join(2528218..2529304,2529551..2529666,
FT                   2529750..2529844,2529949..2530098,2530753..2531158))
FT                   /codon_start=1
FT                   /gene="Sphk2"
FT                   /locus_tag="mCG_10315"
FT                   /product="sphingosine kinase 2, isoform CRA_a"
FT                   /note="gene_id=mCG10315.3 transcript_id=mCT185541.0
FT                   protein_id=mCP106798.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q58E38"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="MGI:MGI:1861380"
FT                   /db_xref="UniProtKB/TrEMBL:Q58E38"
FT                   /protein_id="EDL22889.1"
FT                   /translation="MAPPPLLPVAASTPILHGEFGSYPANGPRFALTLTTQALHIQRLR
FT                   PKPEARPRDGLVSLDEVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADG
FT                   ATTYEENRAEAQRWATALTCLLRGVPLSGDQEITPELLPRKPRLLILVNPFGGRGLAWQ
FT                   RCMDHVVPMISEAGLSFNLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGL
FT                   LDRPDWEDAVRMPIGVLPCGSGNALAGAVNHHGGFEQVVGVDLLLNCSLLLCRGGSHPL
FT                   DLLSVTLASGSRCFSFLSVAWGFLSDVDIHSERFRALGSARFTLGAVLGLASLHTYRGR
FT                   LSYLPATTEPALPIPGHSLPRAKSELVLAPAPAPAATHSPLHRSVSDLPLPLPQPALVS
FT                   PGSPEPLPDLSLNGGGPELTGDWGGAGDAPLSPDPLLPSSPNALKTAQLSPIAEGPPEM
FT                   PASSGFLPPTHSAPEASTWGPVDHLLPPLGSPLPQDWVTIEGEFVLMLGILPSHLCADL
FT                   MAAPHARFDDGVVHLCWVRSGISRAALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEP
FT                   LTPRGLLTVDGELVEYGPIQAQVHPGLATLLTGPAGQKPQA"
FT   gene            2535590..2542376
FT                   /locus_tag="mCG_132477"
FT                   /note="gene_id=mCG132477.1"
FT   mRNA            join(2535590..2535616,2536730..2536816,2537006..2537113,
FT                   2537397..2537495,2537771..2537964,2538191..2538310,
FT                   2542354..2542376)
FT                   /locus_tag="mCG_132477"
FT                   /product="mCG132477, transcript variant mCT133832"
FT                   /note="gene_id=mCG132477.1 transcript_id=mCT133832.1
FT                   created on 20-MAR-2003"
FT   CDS             join(2535614..2535616,2536730..2536816,2537006..2537113,
FT                   2537397..2537495,2537771..2537964,2538191..2538266)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132477"
FT                   /product="mCG132477, isoform CRA_a"
FT                   /note="gene_id=mCG132477.1 transcript_id=mCT133832.1
FT                   protein_id=mCP63508.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q58EW0"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="MGI:MGI:98003"
FT                   /db_xref="UniProtKB/TrEMBL:Q58EW0"
FT                   /protein_id="EDL22890.1"
FT                   /translation="MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQ
FT                   VVLKRLFMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALR
FT                   VSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHT
FT                   KPYVRSKGRKFERARGRRASRGYKN"
FT   mRNA            join(2535634..2536057,2536730..2536816,2537006..2537113,
FT                   2537397..2537495,2537771..2537964,2538191..2538303)
FT                   /locus_tag="mCG_132477"
FT                   /product="mCG132477, transcript variant mCT181293"
FT                   /note="gene_id=mCG132477.1 transcript_id=mCT181293.0
FT                   created on 20-MAR-2003"
FT   mRNA            join(2536730..2536816,2537006..2537113,2537397..2537495,
FT                   2537771..2537842,2538242..>2538273)
FT                   /locus_tag="mCG_132477"
FT                   /product="mCG132477, transcript variant mCT181292"
FT                   /note="gene_id=mCG132477.1 transcript_id=mCT181292.0
FT                   created on 20-MAR-2003"
FT   CDS             join(2537072..2537113,2537397..2537495,2537771..2537842,
FT                   2538242..>2538273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132477"
FT                   /product="mCG132477, isoform CRA_b"
FT                   /note="gene_id=mCG132477.1 transcript_id=mCT181292.0
FT                   protein_id=mCP104215.0 isoform=CRA_b"
FT                   /protein_id="EDL22891.1"
FT                   /translation="MSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPK
FT                   LKVCALRVSSRARSRILKAGGKILTFGQQRLQKLTL"
FT   CDS             join(2537072..2537113,2537397..2537495,2537771..2537964,
FT                   2538191..2538266)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132477"
FT                   /product="mCG132477, isoform CRA_c"
FT                   /note="gene_id=mCG132477.1 transcript_id=mCT181293.0
FT                   protein_id=mCP104214.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A1B0GSF7"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="MGI:MGI:98003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GSF7"
FT                   /protein_id="EDL22892.1"
FT                   /translation="MSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPK
FT                   LKVCALRVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAP
FT                   GTPHSHTKPYVRSKGRKFERARGRRASRGYKN"
FT   gene            <2539658..2546976
FT                   /locus_tag="mCG_10325"
FT                   /note="gene_id=mCG10325.2"
FT   mRNA            join(<2539658..2540131,2540932..2541099,2541346..2541470,
FT                   2543351..2543404,2544124..2544568,2546251..2546974)
FT                   /locus_tag="mCG_10325"
FT                   /product="mCG10325, transcript variant mCT10508"
FT                   /note="gene_id=mCG10325.2 transcript_id=mCT10508.1 created
FT                   on 06-NOV-2002"
FT   CDS             join(2539658..2540131,2540932..2541099,2541346..2541470,
FT                   2543351..2543357)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10325"
FT                   /product="mCG10325, isoform CRA_a"
FT                   /note="gene_id=mCG10325.2 transcript_id=mCT10508.1
FT                   protein_id=mCP22767.1 isoform=CRA_a"
FT                   /protein_id="EDL22893.1"
FT                   /translation="MAASQLAALEGEELGAGEPALTKASPAVLYSEGQRLALEALLSSG
FT                   EETFWACVQQERLPPFLSADEAQALATAAEDWLVPSQEPGAAGTGTAITDGDVGSLTYW
FT                   PRQSEEPAPLLRLGWPEDTAWKGITRAQLYTQPPGEGQPPIKELVHQEIQAARKLVAVV
FT                   MDVFTDPDLLRDMVDAATRRWIPVYLLLDHQHLPAFLALAQQLGVNLWTTENLDIRTVQ
FT                   GHTFQSRRRRQVSGHVREKFVLLDGDRVISGSYRR"
FT   mRNA            join(<2539850..2540131,2540932..2541099,2541346..2541470,
FT                   2544124..2544568,2546251..2546976)
FT                   /locus_tag="mCG_10325"
FT                   /product="mCG10325, transcript variant mCT191807"
FT                   /note="gene_id=mCG10325.2 transcript_id=mCT191807.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2539850..2540131,2540932..2541099,2541346..2541470,
FT                   2544124..2544568,2546251..2546484)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10325"
FT                   /product="mCG10325, isoform CRA_b"
FT                   /note="gene_id=mCG10325.2 transcript_id=mCT191807.0
FT                   protein_id=mCP112759.0 isoform=CRA_b"
FT                   /protein_id="EDL22894.1"
FT                   /translation="DEAQALATAAEDWLVPSQEPGAAGTGTAITDGDVGSLTYWPRQSE
FT                   EPAPLLRLGWPEDTAWKGITRAQLYTQPPGEGQPPIKELVHQEIQAARKLVAVVMDVFT
FT                   DPDLLRDMVDAATRRWIPVYLLLDHQHLPAFLALAQQLGVNLWTTENLDIRTVQGHTFQ
FT                   SRRRRQVSGHVREKFVLLDGDRVISGSYSFTWSDSRLHRSLVTLLTGEIADAFNQEFRV
FT                   LYAASRPLSAAPARSPLFSPPEGPQLPRSPHRVALRCPVAPVAPLLSDGPLAQRLAACH
FT                   ILERDKQETPTTTGPALSDILRSVQRTRTTSGPPTRPSRSLWDLSRLSQLSGSSDGENE
FT                   SKKFWVSKDTPARALMRQRGTGGGPRAEMDSRSQPWGGPLPSIPARRLRYLSPAQRRLG
FT                   DNATTSDWASGSGSGRRR"
FT   gene            complement(2542600..2543305)
FT                   /gene="Spaca4"
FT                   /locus_tag="mCG_147781"
FT                   /note="gene_id=mCG147781.0"
FT   mRNA            complement(2542600..2543305)
FT                   /gene="Spaca4"
FT                   /locus_tag="mCG_147781"
FT                   /product="sperm acrosome associated 4"
FT                   /note="gene_id=mCG147781.0 transcript_id=mCT188044.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2542685..2543068)
FT                   /codon_start=1
FT                   /gene="Spaca4"
FT                   /locus_tag="mCG_147781"
FT                   /product="sperm acrosome associated 4"
FT                   /note="gene_id=mCG147781.0 transcript_id=mCT188044.0
FT                   protein_id=mCP109091.0"
FT                   /protein_id="EDL22895.1"
FT                   /translation="MVLGWPLLLVLVLCPGVTGIKDCVFCELTDSARCPGTHMRCGDDE
FT                   DCFTGHGVAQGVGPIINKGCVHSTSCGREEPISYMGLTYSLTTTCCSGHLCNRGTGLST
FT                   GATSLSLGLQLLLGLLLLLQYWL"
FT   gene            complement(2547470..2577886)
FT                   /gene="Sult2b1"
FT                   /locus_tag="mCG_10319"
FT                   /note="gene_id=mCG10319.1"
FT   mRNA            complement(join(2547470..2547685,2548724..2548904,
FT                   2551105..2551199,2551473..2551599,2552621..2552829,
FT                   2559537..2559679,2577756..2577886))
FT                   /gene="Sult2b1"
FT                   /locus_tag="mCG_10319"
FT                   /product="sulfotransferase family, cytosolic, 2B, member 1"
FT                   /note="gene_id=mCG10319.1 transcript_id=mCT10501.1 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(2547486..2547685,2548724..2548904,
FT                   2551105..2551199,2551473..2551599,2552621..2552829,
FT                   2559537..2559679,2577756..2577817))
FT                   /codon_start=1
FT                   /gene="Sult2b1"
FT                   /locus_tag="mCG_10319"
FT                   /product="sulfotransferase family, cytosolic, 2B, member 1"
FT                   /note="gene_id=mCG10319.1 transcript_id=mCT10501.1
FT                   protein_id=mCP22746.2"
FT                   /protein_id="EDL22896.1"
FT                   /translation="MDGPQPRALWSSSEKNVSEMSWNFGGEYFRYKGIPFPVGMYSPES
FT                   LSLAENTSNVRDDDIFIVTYPKSGTNWMIEIVCLILKDGDPSWIRSEPIWQRAPWCETI
FT                   ISAFNVLDRPSPRIMSSHLPIELFTKAFFSSKAKVIYVGRNPRDVVVSLYYYSKIAGQL
FT                   KDPGTPDQFLQNFLKGEVQFGSWFDHIKGWIRMQNQENFLFITYEELQQDLRGSVQRIC
FT                   EFLGRPLGEEALSSVVAHSAFAAMKANTMSNYSLLPASLLDHRQGEFLRKGISGDWKNH
FT                   FTVAQSEAFDSVYREQMHGVQRFPWDTSEEDSSPDGQPDPEPSPSPASDDPNPGSSQ"
FT   assembly_gap    2560859..2560984
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    2566761..2567075
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    2571995..2572014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2575010..2575382
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    2580173..2580192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2604320..2604339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2604599..>2622949
FT                   /gene="Lmtk3"
FT                   /locus_tag="mCG_10318"
FT                   /note="gene_id=mCG10318.1"
FT   mRNA            join(<2604599..2604674,2605444..2605577,2605803..2605953,
FT                   2606387..2606463,2606897..2607015,2609864..2609951,
FT                   2610284..2610432,2611311..2611395,2611477..2611598,
FT                   2611691..2611840,2612124..2613129,2613408..2614325,
FT                   2614419..2614638,2617476..2617675,2619531..2619666,
FT                   2620007..2620144,2622749..2622823,2622870..>2622949)
FT                   /gene="Lmtk3"
FT                   /locus_tag="mCG_10318"
FT                   /product="lemur tyrosine kinase 3"
FT                   /note="gene_id=mCG10318.1 transcript_id=mCT10502.1 created
FT                   on 06-NOV-2002"
FT   CDS             join(2604599..2604674,2605444..2605577,2605803..2605953,
FT                   2606387..2606463,2606897..2607015,2609864..2609951,
FT                   2610284..2610432,2611311..2611395,2611477..2611598,
FT                   2611691..2611840,2612124..2613129,2613408..2614325,
FT                   2614419..2614638,2617476..2617675,2619531..2619666,
FT                   2620007..2620144,2622749..2622823,2622870..2622949)
FT                   /codon_start=1
FT                   /gene="Lmtk3"
FT                   /locus_tag="mCG_10318"
FT                   /product="lemur tyrosine kinase 3"
FT                   /note="gene_id=mCG10318.1 transcript_id=mCT10502.1
FT                   protein_id=mCP22751.1"
FT                   /protein_id="EDL22897.1"
FT                   /translation="MPAPGALILLAAVSASGCLASPAHPDGFALSRAPLAPPYAVVLIS
FT                   CSGLLAFIFLLLTCLCCKRGDVRFKEFENPEGEDCSGEYTPPAEETSSSQSLPDVYILP
FT                   LAEVSLPMPAPQPPHSDISTPLGLSRQHLSYLQEIGSGWFGKVILGEVFSDYSPAQVVV
FT                   KELRASAGPLEQRKFISEAQPYRSLQHPNVLQCLGVCVETLPFLLIMEFCQLGDLKRYL
FT                   RAQRPPEGMSPELPPRDLRTLQRMGLEIARGLAHLHSHNYVHSDLALRNCLLTSDLTVR
FT                   IGDYGLAHSNYKEDYYLTPERLWVPLRWAAPELLGELHGSFVLVDQSRESNVWSLGVTL
FT                   WELFEFGAQPYRHLSDEEVLAFVVRQQHVKLARPRLKLPYADYWYDILQSCWRPPAQRP
FT                   SASDLQLQLTYLLSERPPRPPPPPPPPRDGPFPWPWPPSHSAPRPGTLSSQFPLLDGFP
FT                   GADPDDVLTVTESSRGLNLECLWEKARRGAGRGGGAPPWQPASAPPAPHTNPSNPFYEA
FT                   LSTPSVLPVISARSPSVSSEYYIRLEEHGSPPEPLFPNDWDPLDPGVPGPQAPQTPSEV
FT                   PQLVSETWASPLFPAPRPFPAQSSGSGGFLLSGWDPEGRGAGETLAGDPAEVLGEQGTA
FT                   PWAEEEEEESSPGEDSSSLGGGPSRRGPLPCPLCSREGPCSCLPLERGDAVAGWGGHPA
FT                   LGCPHPPEDDSSLRAERGSLADLPLPGDSGYETETPFSPEGAFPGGGAAEEEGVPRPRA
FT                   PPEPPDPGAPRPPPDPGPLPLPGSQEKPTFVVQVSTEQLLMSLREDVTKNLLGDKGSTP
FT                   GETGPRKAGRSPANREKGPGPNRDLTSLVSRKKVPSRSLPVNGVTVLENGKPGVPDMKE
FT                   KVAENGLESPEREERALVNGEPMSPEAGEKVLANGVLMSPKSEEKVAENGVLRLPRNTE
FT                   RPPEIGPRRVPGPWEKTPETGGLAPETLLDRAPAPCEAALPQNGLEMAPGQLGPAPKSG
FT                   NPDPGTEWRVHESGGAPRAPGAGKLDLGSGGRALGGPLGAQQRRPEPVPLKARPEVAQE
FT                   EEPGVPDNRLGGDMAPSVDEDPLKPERKGPEMPRLFLDLGPPQGNSEQIKAGSRGPGRT
FT                   REAPVPVVVSSADGDTARPLRGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQE
FT                   TPTNELSVQGTPEGDTEPSTPPAPPTPPHPTTPGDGFPNNDSGFGGSFEWAEDFPLLPP
FT                   PGPPLCFSRFSVSPALETPGPPARAPDARPAEEGLRAESCVDDGAIAPDTDTASGGGGP
FT                   GPPPSPPDESPDPPDPPDPLGAT"
FT   assembly_gap    2613220..2613294
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            complement(2626657..2633382)
FT                   /gene="Pscd2"
FT                   /locus_tag="mCG_10321"
FT                   /note="gene_id=mCG10321.3"
FT   mRNA            complement(join(2626657..2626917,2627002..2627156,
FT                   2627245..2627316,2627442..2627518,2629191..2629302,
FT                   2629635..2629783,2629918..2630030,2630593..2630673,
FT                   2631244..2631362,2631911..2631977,2632073..2632220,
FT                   2633162..2633382))
FT                   /gene="Pscd2"
FT                   /locus_tag="mCG_10321"
FT                   /product="pleckstrin homology, Sec7 and coiled-coil domains
FT                   2, transcript variant mCT191806"
FT                   /note="gene_id=mCG10321.3 transcript_id=mCT191806.1 created
FT                   on 28-SEP-2004"
FT   mRNA            complement(join(2626657..2626917,2627002..2627156,
FT                   2627245..2627316,2627442..2627518,2629187..2629302,
FT                   2629635..2629783,2629918..2630030,2630593..2630673,
FT                   2631244..2631362,2631911..2631977,2632073..2632220,
FT                   2633162..2633382))
FT                   /gene="Pscd2"
FT                   /locus_tag="mCG_10321"
FT                   /product="pleckstrin homology, Sec7 and coiled-coil domains
FT                   2, transcript variant mCT10504"
FT                   /note="gene_id=mCG10321.3 transcript_id=mCT10504.2 created
FT                   on 28-SEP-2004"
FT   mRNA            complement(join(2626657..2626917,2627002..2627156,
FT                   2627245..2627316,2627442..2627518,2629187..2629302,
FT                   2629635..2629783,2629918..2630030,2630593..2630673,
FT                   2631244..2631362,2631911..2631977,2632073..2632942))
FT                   /gene="Pscd2"
FT                   /locus_tag="mCG_10321"
FT                   /product="pleckstrin homology, Sec7 and coiled-coil domains
FT                   2, transcript variant mCT191805"
FT                   /note="gene_id=mCG10321.3 transcript_id=mCT191805.1 created
FT                   on 28-SEP-2004"
FT   CDS             complement(join(2626830..2626917,2627002..2627156,
FT                   2627245..2627316,2627442..2627518,2629191..2629302,
FT                   2629635..2629783,2629918..2630030,2630593..2630673,
FT                   2631244..2631362,2631911..2631977,2632073..2632220,
FT                   2633162..2633180))
FT                   /codon_start=1
FT                   /gene="Pscd2"
FT                   /locus_tag="mCG_10321"
FT                   /product="pleckstrin homology, Sec7 and coiled-coil domains
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG10321.3 transcript_id=mCT191806.1
FT                   protein_id=mCP112758.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q99KH2"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="MGI:MGI:1334255"
FT                   /db_xref="UniProtKB/TrEMBL:Q99KH2"
FT                   /protein_id="EDL22898.1"
FT                   /translation="MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMS
FT                   EVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGE
FT                   GLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRM
FT                   MEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINE
FT                   GGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWF
FT                   ILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTE
FT                   ADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
FT                   "
FT   CDS             complement(join(2627452..2627518,2629187..2629302,
FT                   2629635..2629783,2629918..2630030,2630593..2630673,
FT                   2631244..2631362,2631911..2631977,2632073..2632220,
FT                   2633162..2633180))
FT                   /codon_start=1
FT                   /gene="Pscd2"
FT                   /locus_tag="mCG_10321"
FT                   /product="pleckstrin homology, Sec7 and coiled-coil domains
FT                   2, isoform CRA_c"
FT                   /note="gene_id=mCG10321.3 transcript_id=mCT10504.2
FT                   protein_id=mCP22750.3 isoform=CRA_c"
FT                   /db_xref="GOA:A0A1B0GRB8"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="MGI:MGI:1334255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GRB8"
FT                   /protein_id="EDL22900.1"
FT                   /translation="MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMS
FT                   EVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGE
FT                   GLNKTAIGDYLGEREELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRM
FT                   MEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINE
FT                   GGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGTGPGEDLEAAL
FT                   VHPYRQLPLLL"
FT   CDS             complement(join(2627452..2627518,2629187..2629302,
FT                   2629635..2629783,2629918..2630030,2630593..2630673,
FT                   2631244..2631362,2631911..2631977,2632073..2632191))
FT                   /codon_start=1
FT                   /gene="Pscd2"
FT                   /locus_tag="mCG_10321"
FT                   /product="pleckstrin homology, Sec7 and coiled-coil domains
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG10321.3 transcript_id=mCT191805.1
FT                   protein_id=mCP112757.1 isoform=CRA_b"
FT                   /protein_id="EDL22899.1"
FT                   /translation="MELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQR
FT                   NRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
FT                   LNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVF
FT                   QSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSI
FT                   RNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGTGPGEDLEAALVHPYRQLPLLL"
FT   gene            complement(2635551..2643840)
FT                   /gene="Kcnj14"
FT                   /locus_tag="mCG_10320"
FT                   /note="gene_id=mCG10320.1"
FT   mRNA            complement(join(2635551..2637296,2638456..2639217,
FT                   2643701..2643840))
FT                   /gene="Kcnj14"
FT                   /locus_tag="mCG_10320"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 14"
FT                   /note="gene_id=mCG10320.1 transcript_id=mCT10503.1 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(2636700..2637296,2638456..2639163))
FT                   /codon_start=1
FT                   /gene="Kcnj14"
FT                   /locus_tag="mCG_10320"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 14"
FT                   /note="gene_id=mCG10320.1 transcript_id=mCT10503.1
FT                   protein_id=mCP22759.1"
FT                   /protein_id="EDL22901.1"
FT                   /translation="MGLARALRRLSGALEPGNSRAGDEEEAGAGLCRNGWAPGPVAGSR
FT                   RRGRFVKKDGHCNVRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGL
FT                   TFWLIASLHGDLAAPPPPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAA
FT                   VVLQCIAGCVLDAFVVGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRR
FT                   SHLVEAHVRAQLLQPRVTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASP
FT                   LYELGRAELARADFELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQY
FT                   EVDYRHFHRTYEVPGTPVCSAKELDERAEQASHSPKSSFPGSLTAFCYENELALSCCQE
FT                   EDEEEDTKEGTSAETPERAASPQALTPTLALTLPP"
FT   gene            complement(2644298..2649875)
FT                   /gene="Grwd1"
FT                   /locus_tag="mCG_10322"
FT                   /note="gene_id=mCG10322.0"
FT   mRNA            complement(join(2644298..2645177,2646225..2646422,
FT                   2646610..2646752,2646864..2647077,2649070..2649232,
FT                   2649380..2649497,2649683..2649875))
FT                   /gene="Grwd1"
FT                   /locus_tag="mCG_10322"
FT                   /product="glutamate-rich WD repeat containing 1, transcript
FT                   variant mCT10505"
FT                   /note="gene_id=mCG10322.0 transcript_id=mCT10505.1 created
FT                   on 21-MAR-2003"
FT   mRNA            complement(join(2644316..2645177,2646225..2646422,
FT                   2646610..2646752,2646864..2647077,2649070..2649232,
FT                   2649683..2649864))
FT                   /gene="Grwd1"
FT                   /locus_tag="mCG_10322"
FT                   /product="glutamate-rich WD repeat containing 1, transcript
FT                   variant mCT181287"
FT                   /note="gene_id=mCG10322.0 transcript_id=mCT181287.0 created
FT                   on 21-MAR-2003"
FT   CDS             complement(join(2644860..2645177,2646225..2646422,
FT                   2646610..2646752,2646864..2647077,2649070..2649232,
FT                   2649380..2649497,2649683..2649869))
FT                   /codon_start=1
FT                   /gene="Grwd1"
FT                   /locus_tag="mCG_10322"
FT                   /product="glutamate-rich WD repeat containing 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG10322.0 transcript_id=mCT10505.1
FT                   protein_id=mCP22763.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q810D6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="MGI:MGI:2141989"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810D6"
FT                   /protein_id="EDL22902.1"
FT                   /translation="MAARKGRSRTCETGEPMEAETCDPGTEGPSQVYLPGRGPPLSEGE
FT                   ELVMDEEAYVLYHRAQTGAPCLSFDIVRDHLGDNRTELPLSLYLCAGTQAESAQSNRLM
FT                   MLRMHNLHGTRPSPSEGSDDDEEDEDEEDEEEQKPQLELAMVPHYGGINRVRVSWLGEE
FT                   PVAGVWSEKGQVEVFALRRLLQVVDDPQALAIFLRDEQARIKPIFSFAGHMGEGFALDW
FT                   SPRVPGRLLTGDCQKNVHLWTPTEGGSWNVDQRPFVGHTRSVEDLQWSPTEDTVFASCS
FT                   ADASIRIWDIRAAPGKACMLTTATAHDGDVNVISWSRREPFLLSGGDDGALKVWDLRQF
FT                   KSGSPVATFKQHMAPVTSVEWHPQDSGVFAASGADNQITQWDLAVERDPESGETETDPG
FT                   LAALPQQLLFVHQGETDLKELHWHPQCPGVLISTALSGFTVFRTISV"
FT   CDS             complement(join(2644860..2645177,2646225..2646422,
FT                   2646610..2646752,2646864..2647077,2649070..2649228))
FT                   /codon_start=1
FT                   /gene="Grwd1"
FT                   /locus_tag="mCG_10322"
FT                   /product="glutamate-rich WD repeat containing 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG10322.0 transcript_id=mCT181287.0
FT                   protein_id=mCP104209.0 isoform=CRA_b"
FT                   /protein_id="EDL22903.1"
FT                   /translation="MMLRMHNLHGTRPSPSEGSDDDEEDEDEEDEEEQKPQLELAMVPH
FT                   YGGINRVRVSWLGEEPVAGVWSEKGQVEVFALRRLLQVVDDPQALAIFLRDEQARIKPI
FT                   FSFAGHMGEGFALDWSPRVPGRLLTGDCQKNVHLWTPTEGGSWNVDQRPFVGHTRSVED
FT                   LQWSPTEDTVFASCSADASIRIWDIRAAPGKACMLTTATAHDGDVNVISWSRREPFLLS
FT                   GGDDGALKVWDLRQFKSGSPVATFKQHMAPVTSVEWHPQDSGVFAASGADNQITQWDLA
FT                   VERDPESGETETDPGLAALPQQLLFVHQGETDLKELHWHPQCPGVLISTALSGFTVFRT
FT                   ISV"
FT   gene            complement(<2651868..2685620)
FT                   /gene="Grin2d"
FT                   /locus_tag="mCG_10333"
FT                   /note="gene_id=mCG10333.1"
FT   mRNA            complement(join(<2651868..2653175,2653337..2653569,
FT                   2653727..2653914,2672258..2672418,2673282..2673511,
FT                   2673628..2673753,2675810..2675963,2676548..2676716,
FT                   2676943..2677154,2677518..2677632,2681018..2681639,
FT                   2685271..2685620))
FT                   /gene="Grin2d"
FT                   /locus_tag="mCG_10333"
FT                   /product="glutamate receptor, ionotropic, NMDA2D (epsilon
FT                   4)"
FT                   /note="gene_id=mCG10333.1 transcript_id=mCT10516.1 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(2651868..2653175,2653337..2653569,
FT                   2653727..2653914,2672258..2672418,2673282..2673511,
FT                   2673628..2673753,2675810..2675963,2676548..2676716,
FT                   2676943..2677154,2677518..2677632,2681018..2681283))
FT                   /codon_start=1
FT                   /gene="Grin2d"
FT                   /locus_tag="mCG_10333"
FT                   /product="glutamate receptor, ionotropic, NMDA2D (epsilon
FT                   4)"
FT                   /note="gene_id=mCG10333.1 transcript_id=mCT10516.1
FT                   protein_id=mCP22754.2"
FT                   /protein_id="EDL22904.1"
FT                   /translation="MVGPQLAGGGGSGVPGEPLLLPGGAPLPAGLFAVRSAGWRDDLAR
FT                   RVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLHRYFMNITWDNRDYSFN
FT                   EDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFLQPVDDTQHLTVAT
FT                   LEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRCCKGFCIDILKRL
FT                   AHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSV
FT                   PFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYN
FT                   RSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWAFFAVIFLAS
FT                   YTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIRSNYPDMHS
FT                   YMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKVFATTGYG
FT                   IALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDIDNMAGVF
FT                   YMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAPPPAKP
FT                   PPPPQPLPSPAYPAARPPPGPAPFVPRERAAADRWRRAKGTGPPGGAALADGFHRYYGP
FT                   IEPQGLGLGEARAAPRGAAGRPLSPPTTQPPQKPPPSYFAIVREQEPAEPPAGAFPGFP
FT                   SPPAPPAAAAAAVGPPLCRLAFEDESPPAPSRWPRSDPESQPLLGGGAGGPSAGAPTAP
FT                   PPRRAAPPPCAYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYAERLGPPPGRY
FT                   WSVDKLGGWRAGSWDYLPPRGGPAWHCRHCASLELLPPPRHLSCSHDGLDGGWWAPPPP
FT                   PWAAGPPPRRRARCGCPRPHPHRPRASHRAPAAAPHHHRHRRAAGGWDLPPPAPTSRSL
FT                   EDLSSCPRAAPTRRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFSS
FT                   LESEV"
FT   assembly_gap    2684968..2685270
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   gene            2691829..2702835
FT                   /gene="Kdelr1"
FT                   /locus_tag="mCG_10332"
FT                   /note="gene_id=mCG10332.2"
FT   mRNA            join(2691829..2692161,2692819..2692919,2693103..2693261,
FT                   2700603..2700855,2702080..2702835)
FT                   /gene="Kdelr1"
FT                   /locus_tag="mCG_10332"
FT                   /product="KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum
FT                   protein retention receptor 1"
FT                   /note="gene_id=mCG10332.2 transcript_id=mCT10515.2 created
FT                   on 21-MAR-2003"
FT   CDS             join(2692071..2692161,2692819..2692919,2693103..2693261,
FT                   2700603..2700855,2702080..2702114)
FT                   /codon_start=1
FT                   /gene="Kdelr1"
FT                   /locus_tag="mCG_10332"
FT                   /product="KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum
FT                   protein retention receptor 1"
FT                   /note="gene_id=mCG10332.2 transcript_id=mCT10515.2
FT                   protein_id=mCP22749.2"
FT                   /protein_id="EDL22905.1"
FT                   /translation="MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFT
FT                   ARYLDLFTNYISLYNTCMKVVYIACSFTTVWMIYSKFKATYDGNHDTFRVEFLVVPTAI
FT                   LAFLVNHDFTPLEILWTFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYL
FT                   FNWIWRYHFEGFFDLIAIVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA"
FT   gene            complement(2705954..2715694)
FT                   /gene="Syngr4"
FT                   /locus_tag="mCG_10324"
FT                   /note="gene_id=mCG10324.1"
FT   mRNA            complement(join(2705954..2706239,2707726..2707963,
FT                   2714786..2714933,2715668..2715694))
FT                   /gene="Syngr4"
FT                   /locus_tag="mCG_10324"
FT                   /product="synaptogyrin 4"
FT                   /note="gene_id=mCG10324.1 transcript_id=mCT10507.1 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(2706160..2706239,2707726..2707963,
FT                   2714786..2714878))
FT                   /codon_start=1
FT                   /gene="Syngr4"
FT                   /locus_tag="mCG_10324"
FT                   /product="synaptogyrin 4"
FT                   /note="gene_id=mCG10324.1 transcript_id=mCT10507.1
FT                   protein_id=mCP22727.2"
FT                   /db_xref="GOA:D3Z3G3"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="InterPro:IPR016579"
FT                   /db_xref="MGI:MGI:1928903"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3G3"
FT                   /protein_id="EDL22906.1"
FT                   /translation="MHLPESLHDLADNETVRFLRRPKSISRIFGGVFSLVIFSSLLTDG
FT                   YQNRTESPQLRCVLNSNHMACSFAVGAGFLSFLSCLVFLAIDAYERRLVGTRFKIAFQL
FT                   LDFILADTPGLPSLPGPPRRGSSPLQALPGGG"
FT   assembly_gap    2714934..2714953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2716029..2737364
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /note="gene_id=mCG10331.1"
FT   mRNA            join(2716029..2716156,2716490..2716721,2718688..2718792,
FT                   2726851..2727045,2728040..2728170,2729255..2729534,
FT                   2736027..2736216,2736355..2736592,2737273..2737364)
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, transcript variant
FT                   mCT10514"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT10514.3 created
FT                   on 21-MAR-2003"
FT   mRNA            join(<2716130..2716156,2716490..2716721,2718688..2718792,
FT                   2726851..2727045,2728040..2728170,2729255..2729534,
FT                   2736027..2736216,2736355..2737355)
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, transcript variant
FT                   mCT191756"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT191756.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2716131..2716156,2716490..2716721,2718688..2718792,
FT                   2726851..2727045,2728040..2728170,2729255..2729534,
FT                   2736027..2736216,2736355..2736575)
FT                   /codon_start=1
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, isoform CRA_c"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT191756.0
FT                   protein_id=mCP112689.0 isoform=CRA_c"
FT                   /protein_id="EDL22909.1"
FT                   /translation="SMTVARWLRLWERGQAMLHVTWGSKVRLWSLVPALLGTPRALSSL
FT                   ENRMGVYRKMWNPKEPCDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAERAALEAFSAH
FT                   VDFCTLFHYHQLLARLQALYDPINPDRETLDQPSLTDPERLSSEKDVLQALRPLLAQAN
FT                   FSPLSEDALAYALVVHHPQDEVQVTINLDQYIYIQFWALGQRVGQMPHKSSVGSKRGFF
FT                   RKLPPVERRYFKRVVLAARTKGGHLVLKSFKDTPLEGLEQLLPELKVRTPVLQRALLNL
FT                   MLVVSGVMIFVNVGMVILSDLKMATSLLLLLFAAFMGVKASKVFGQRRSAQALELAHVL
FT                   YYRSTSNNSELLSALALRAQEEHIKEALLAHSFLARRPGGSQGKPEETSRWLQSEVESW
FT                   LLAQSGCDVTFNGPRALAHLQALTPSLGLFPPPELPQLDPMVLGTPEATQAALGSSYPS
FT                   P"
FT   CDS             join(2716134..2716156,2716490..2716721,2718688..2718792,
FT                   2726851..2727045,2728040..2728170,2729255..2729534,
FT                   2736027..2736216,2736355..2736575)
FT                   /codon_start=1
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, isoform CRA_a"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT10514.3
FT                   protein_id=mCP22739.3 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9F4"
FT                   /db_xref="InterPro:IPR022227"
FT                   /db_xref="MGI:MGI:1917459"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9F4"
FT                   /protein_id="EDL22907.1"
FT                   /translation="MTVARWLRLWERGQAMLHVTWGSKVRLWSLVPALLGTPRALSSLE
FT                   NRMGVYRKMWNPKEPCDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAERAALEAFSAHV
FT                   DFCTLFHYHQLLARLQALYDPINPDRETLDQPSLTDPERLSSEKDVLQALRPLLAQANF
FT                   SPLSEDALAYALVVHHPQDEVQVTINLDQYIYIQFWALGQRVGQMPHKSSVGSKRGFFR
FT                   KLPPVERRYFKRVVLAARTKGGHLVLKSFKDTPLEGLEQLLPELKVRTPVLQRALLNLM
FT                   LVVSGVMIFVNVGMVILSDLKMATSLLLLLFAAFMGVKASKVFGQRRSAQALELAHVLY
FT                   YRSTSNNSELLSALALRAQEEHIKEALLAHSFLARRPGGSQGKPEETSRWLQSEVESWL
FT                   LAQSGCDVTFNGPRALAHLQALTPSLGLFPPPELPQLDPMVLGTPEATQAALGSSYPSP
FT                   "
FT   mRNA            join(<2716252..2716721,2718688..2718792,2726851..2727045,
FT                   2728040..2728170,2729255..2729534,2736027..2736216,
FT                   2736355..2737355)
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, transcript variant
FT                   mCT191758"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT191758.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2716389..2716721,2718688..2718792,2726851..2727045,
FT                   2728040..2728170,2729255..2729534,2736027..2736216,
FT                   2736355..2736575)
FT                   /codon_start=1
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, isoform CRA_e"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT191758.0
FT                   protein_id=mCP112691.0 isoform=CRA_e"
FT                   /protein_id="EDL22911.1"
FT                   /translation="REGDWPGTVPEGRGVWRYYLQLTFDIPLHLLMFRLWERGQAMLHV
FT                   TWGSKVRLWSLVPALLGTPRALSSLENRMGVYRKMWNPKEPCDWAQQYRERFIPFSKEQ
FT                   LLRLLIQEFHSSPAERAALEAFSAHVDFCTLFHYHQLLARLQALYDPINPDRETLDQPS
FT                   LTDPERLSSEKDVLQALRPLLAQANFSPLSEDALAYALVVHHPQDEVQVTINLDQYIYI
FT                   QFWALGQRVGQMPHKSSVGSKRGFFRKLPPVERRYFKRVVLAARTKGGHLVLKSFKDTP
FT                   LEGLEQLLPELKVRTPVLQRALLNLMLVVSGVMIFVNVGMVILSDLKMATSLLLLLFAA
FT                   FMGVKASKVFGQRRSAQALELAHVLYYRSTSNNSELLSALALRAQEEHIKEALLAHSFL
FT                   ARRPGGSQGKPEETSRWLQSEVESWLLAQSGCDVTFNGPRALAHLQALTPSLGLFPPPE
FT                   LPQLDPMVLGTPEATQAALGSSYPSP"
FT   mRNA            join(2716489..2716721,2726851..2727045,2728040..2728170,
FT                   2729255..>2729366)
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, transcript variant
FT                   mCT181288"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT181288.0 created
FT                   on 21-MAR-2003"
FT   mRNA            join(<2716490..2716721,2718688..2718792,2726851..2727045,
FT                   2729255..2729534,2736027..2736216,2736355..2737355)
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, transcript variant
FT                   mCT191757"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT191757.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2716491..2716721,2718688..2718792,2726851..2727045,
FT                   2729255..2729467)
FT                   /codon_start=1
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, isoform CRA_d"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT191757.0
FT                   protein_id=mCP112690.0 isoform=CRA_d"
FT                   /protein_id="EDL22910.1"
FT                   /translation="LWERGQAMLHVTWGSKVRLWSLVPALLGTPRALSSLENRMGVYRK
FT                   MWNPKEPCDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAERAALEAFSAHVDFCTLFHY
FT                   HQLLARLQALYDPINPDRETLDQPSLTDPERLSSEKDVLQALRPLLAQANFSPLSEDAL
FT                   AYALVVHHPQDEVQEILQACGVGCPDERRAPGPEELQGYPAGGLRAAAAGAEGAHARAA
FT                   ARPAQPHVGGLRRHDLRQRGHGDTV"
FT   CDS             join(2716512..2716721,2726851..2727045,2728040..2728170,
FT                   2729255..>2729366)
FT                   /codon_start=1
FT                   /gene="Tmem143"
FT                   /locus_tag="mCG_10331"
FT                   /product="transmembrane protein 143, isoform CRA_b"
FT                   /note="gene_id=mCG10331.1 transcript_id=mCT181288.0
FT                   protein_id=mCP104210.0 isoform=CRA_b"
FT                   /protein_id="EDL22908.1"
FT                   /translation="MLHVTWGSKVRLWSLVPALLGTPRALSSLENRMGVYRKMWNPKEP
FT                   CDWAQQYRERFIPFSKEQLLRLLIQALYDPINPDRETLDQPSLTDPERLSSEKDVLQAL
FT                   RPLLAQANFSPLSEDALAYALVVHHPQDEVQVTINLDQYIYIQFWALGQRVGQMPHKSS
FT                   VGSKRGFFRKLPPVERRYFKRVVLAARTKGGHLVLKSFKDTPLEGLEQLLPEL"
FT   gene            complement(2738012..2741354)
FT                   /gene="Emp3"
FT                   /locus_tag="mCG_10323"
FT                   /note="gene_id=mCG10323.1"
FT   mRNA            complement(join(2738012..2738183,2739267..2739407,
FT                   2739885..2739987,2740239..2740354,2741192..2741354))
FT                   /gene="Emp3"
FT                   /locus_tag="mCG_10323"
FT                   /product="epithelial membrane protein 3"
FT                   /note="gene_id=mCG10323.1 transcript_id=mCT10506.1 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(2738014..2738183,2739267..2739407,
FT                   2739885..2739987,2740239..2740316))
FT                   /codon_start=1
FT                   /gene="Emp3"
FT                   /locus_tag="mCG_10323"
FT                   /product="epithelial membrane protein 3"
FT                   /note="gene_id=mCG10323.1 transcript_id=mCT10506.1
FT                   protein_id=mCP22760.1"
FT                   /protein_id="EDL22912.1"
FT                   /translation="MSLLLLVVSALHILILVLLFVATLDKSWWTLPDKESLNLWYDCTW
FT                   NTTTQTWACSNVSENGWLKAVQALMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQ
FT                   LCTSAAVFSGALIYAIHTEEILAKHPSGGSFGYCFALAWVAFPLALVSGIVYIHLRKRE
FT                   "
FT   gene            2744021..2749121
FT                   /locus_tag="mCG_132513"
FT                   /note="gene_id=mCG132513.0"
FT   mRNA            join(2744021..2744217,2744449..2744540,2748474..2748573,
FT                   2748812..2749121)
FT                   /locus_tag="mCG_132513"
FT                   /product="mCG132513"
FT                   /note="gene_id=mCG132513.0 transcript_id=mCT133868.0
FT                   created on 21-MAR-2003"
FT   CDS             join(2744462..2744540,2748474..2748573,2748812..2749118)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132513"
FT                   /product="mCG132513"
FT                   /note="gene_id=mCG132513.0 transcript_id=mCT133868.0
FT                   protein_id=mCP63563.1"
FT                   /protein_id="EDL22913.1"
FT                   /translation="MSRMRLGPPTRSARSEEGSEIFLEGSVDGELSRLQRQCKMMELER
FT                   RAYSKEVHQRLRKQVEGRRLELVECCHLLVRTTCSSRLDSEEIRQLEMLRAKLQTQINV
FT                   AQSQVKRLGDKKHLAEMECLLKSRAQVQVEIEALQEQNRALDKQVGSPSWPPSYQTL"
FT   assembly_gap    2748634..2748805
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   gene            2753620..2754108
FT                   /locus_tag="mCG_10317"
FT                   /note="gene_id=mCG10317.1"
FT   mRNA            2753620..2754108
FT                   /locus_tag="mCG_10317"
FT                   /product="mCG10317"
FT                   /note="gene_id=mCG10317.1 transcript_id=mCT10500.2 created
FT                   on 06-NOV-2002"
FT   CDS             2753669..2753803
FT                   /codon_start=1
FT                   /locus_tag="mCG_10317"
FT                   /product="mCG10317"
FT                   /note="gene_id=mCG10317.1 transcript_id=mCT10500.2
FT                   protein_id=mCP22745.1"
FT                   /protein_id="EDL22914.1"
FT                   /translation="MAKFIHNFSEKSPSMVAAAVTYSKPRLATFWHYAKVELVSPNPW"
FT   gene            <2759507..>2768233
FT                   /locus_tag="mCG_10327"
FT                   /note="gene_id=mCG10327.1"
FT   mRNA            join(<2759507..2759553,2761487..2761674,2761884..2762018,
FT                   2762403..2762485,2762586..2762754,2766973..2767136,
FT                   2767730..>2768233)
FT                   /locus_tag="mCG_10327"
FT                   /product="mCG10327"
FT                   /note="gene_id=mCG10327.1 transcript_id=mCT10510.1 created
FT                   on 06-NOV-2002"
FT   CDS             join(2759507..2759553,2761487..2761674,2761884..2762018,
FT                   2762403..2762485,2762586..2762754,2766973..2767136,
FT                   2767730..2768233)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10327"
FT                   /product="mCG10327"
FT                   /note="gene_id=mCG10327.1 transcript_id=mCT10510.1
FT                   protein_id=mCP22772.1"
FT                   /protein_id="EDL22915.1"
FT                   /translation="MVGALSTSSTSAYTAREEAKTKMGMLQERAEKELAQSDTEAQILL
FT                   RQISHLEQLHRFLKLKNDERQPDPRVVQKAEQRDWEVSEGLRKTSQEKLVLRYEDTLGK
FT                   LAQLTGESDPDLLVEKYLELEERNFAEFNFINEQNSEIHHLQEEIKEMQEALVSEHASQ
FT                   DKQRMQQEQQCKMLQQDVDKMCSESEQLEGRFQALRGQLEKIKTDIQVLFDKAKCDSSV
FT                   IKDLLGVKTYMRDRDIGLFLSTIERRLVQLLTVQAFLQVQLQLQDEEESAKKLDSSPSL
FT                   TLSSPQISLVTVPKHSKKTSVVPESILSHKTNRGRGTGSVSHVTFGDSASAAGPVAMAS
FT                   ASASGAPVSSRSSQGGRGGFKPTSSSSYLGSTGYLETSRGRESTAGGVHSQSMGSELSR
FT                   GLSSSSGHASSPAPPSRPSSSTSKDSRGYN"
FT   assembly_gap    2775832..2775851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2778245..2778264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2779472..2779542
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    2782911..2787167
FT                   /estimated_length=4257
FT                   /gap_type="unknown"
FT   gene            complement(2799991..2857673)
FT                   /gene="Abcc6"
FT                   /locus_tag="mCG_142482"
FT                   /note="gene_id=mCG142482.0"
FT   mRNA            complement(join(2799991..2800555,2800855..2801049,
FT                   2803246..2803412,2803494..2803652,2804586..2804732,
FT                   2805749..2805850,2806923..2807049,2808702..2808904,
FT                   2810329..2810343,2813219..2813426,2813971..2814097,
FT                   2816045..2816120,2818948..2819107,2820421..2820588,
FT                   2822416..2822592,2822769..2822895,2824771..2824843,
FT                   2826351..2826438,2832084..2832230,2832401..2832604,
FT                   2835704..2835796,2839810..2839971,2841385..2841562,
FT                   2842729..2842908,2843698..2843829,2844789..2844850,
FT                   2845807..2845932,2847381..2847509,2847870..2847995,
FT                   2856540..2856722,2857607..2857673))
FT                   /gene="Abcc6"
FT                   /locus_tag="mCG_142482"
FT                   /product="ATP-binding cassette, sub-family C (CFTR/MRP),
FT                   member 6"
FT                   /note="gene_id=mCG142482.0 transcript_id=mCT180521.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(2808822..2808904,2810329..2810343,
FT                   2813219..2813426,2813971..2814097,2816045..2816120,
FT                   2818948..2819107,2820421..2820588,2822416..2822592,
FT                   2822769..2822895,2824771..2824843,2826351..2826438,
FT                   2832084..2832230,2832401..2832604,2835704..2835796,
FT                   2839810..2839971,2841385..2841562,2842729..2842908,
FT                   2843698..2843829,2844789..2844850,2845807..2845932,
FT                   2847381..2847509,2847870..2847995,2856540..2856722,
FT                   2857607..2857660))
FT                   /codon_start=1
FT                   /gene="Abcc6"
FT                   /locus_tag="mCG_142482"
FT                   /product="ATP-binding cassette, sub-family C (CFTR/MRP),
FT                   member 6"
FT                   /note="gene_id=mCG142482.0 transcript_id=mCT180521.0
FT                   protein_id=mCP103443.0"
FT                   /protein_id="EDL22916.1"
FT                   /translation="MNRGRSMATPGEQCAGLRVWNQTEQEPAAYHLLSLCFVRAASSWV
FT                   PPMYLWVLGPIYLLYIHRHGRCYLRMSHLFKTKMVLGLALILLYTFNVAVPLWRIHQGV
FT                   PQAPELLIHPTVWLTTMSFATFLIHMERRKGVRASGVLFGYWLLCCVLPGINTVQQASA
FT                   GNLRQEPLHHLATYLCLSLVVAELVLSCLVDQPPFFSEDSQPLNPCPEAEASFPSKAMF
FT                   WWASGLLWRGYKKLLGPKDLWSLGRENSSEELVSQLEREWRRSCNGLPGHKGHSSVGAP
FT                   ETEAFLQPERSQRGPLLRAIWRVFRSTFLLGTLSLVISDAFRFAVPKLLSLFLEFMGDR
FT                   NSSAWTGWLLAVLMFAAACLQTLFEQQHMYRAKVLQMRLRTAITGLVYRKVLVLSSGSR
FT                   KSSAAGDVVNLVSVDIQRLAESIIYLNGLWLLFLWIFVCFVYLWQLLGPSALTAVAVFL
FT                   SLLPLNFFITKKRGFHQEEQMRQKASRARLTSSMLRTVRTIKSHGWEHAFLERLLHIRG
FT                   QELSALKTSTLLFSVSLVSFQVSTFLVALVVFAVHTLVAEDNAMDAEKAFVTLTVLSIL
FT                   NKAQAFLPFSVHCIVQARVSFDRLAAFLCLEEVDPNGMIASNSRRSSKDRISVHNGTFA
FT                   WSQESPPCLHGINLTVPQGCLLAVVGPVGAGKSSLLSALLGELLKVEGSVSIEGSVAYV
FT                   PQEAWVQNTSVVENVCFRQELDLPWLQKVLDACALGSDVASFPAGVHTPIGEQGMNLSG
FT                   GQKQRLSLARAVYKKAAIYLLDDPLAALDAHVSQQVFKQVIGPSGLLQGTTRILVTHTL
FT                   HVLPQADRILVLANGTIAEMGSYQDLLQRNGALVGLLDGARQPAGTHDAATSDDLGGFP
FT                   GGGRPTCRPDRPRPTEAAPVKGRSTSEVQMEASLDDPEATGLTAEEDSVRYGRVKITIY
FT                   LSYLRAVGTPLCTYTLFLFLCQQVASFSQGYWLSLWADDPVVDGRQMHAALRGWVFGLL
FT                   GCLQAIGLFAEPLCGHILPAETSRVGPLLICVFPYG"
FT   assembly_gap    2809366..2810328
FT                   /estimated_length=963
FT                   /gap_type="unknown"
FT   assembly_gap    2827798..2827817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2828963..2828982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2830338..2830357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2831475..2831494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2849619..2852938
FT                   /estimated_length=3320
FT                   /gap_type="unknown"
FT   assembly_gap    2864212..2864231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2873821..2912289
FT                   /gene="Nomo1"
FT                   /locus_tag="mCG_142457"
FT                   /note="gene_id=mCG142457.0"
FT   mRNA            join(2873821..2873934,2874857..2874946,2878234..2878339,
FT                   2878510..2878660,2882526..2882700,2884619..2884760,
FT                   2885101..2885232,2886440..2886576,2888897..2888984,
FT                   2889786..2889849,2890984..2891079,2894249..2894467,
FT                   2894547..2894629,2896467..2896626,2896760..2896886,
FT                   2898011..2898124,2898863..2898990,2900586..2900727,
FT                   2904163..2904246,2906113..2906223,2907574..2907675,
FT                   2909478..2909597,2911318..2911410,2911686..2912289)
FT                   /gene="Nomo1"
FT                   /locus_tag="mCG_142457"
FT                   /product="nodal modulator 1"
FT                   /note="gene_id=mCG142457.0 transcript_id=mCT180496.0
FT                   created on 13-FEB-2003"
FT   CDS             join(2878249..2878339,2878510..2878660,2882526..2882700,
FT                   2884619..2884760,2885101..2885232,2886440..2886576,
FT                   2888897..2888984,2889786..2889849,2890984..2891079,
FT                   2894249..2894467,2894547..2894629,2896467..2896626,
FT                   2896760..2896886,2898011..2898124,2898863..2898990,
FT                   2900586..2900727,2904163..2904246,2906113..2906223,
FT                   2907574..2907675,2909478..2909597,2911318..2911410,
FT                   2911686..2911817)
FT                   /codon_start=1
FT                   /gene="Nomo1"
FT                   /locus_tag="mCG_142457"
FT                   /product="nodal modulator 1"
FT                   /note="gene_id=mCG142457.0 transcript_id=mCT180496.0
FT                   protein_id=mCP103418.0"
FT                   /protein_id="EDL22917.1"
FT                   /translation="MGFSVTGRVLNGPDGEGVPEAVVTLNNQIKVKTKADGSFRLENIT
FT                   TGTYTIHAQKEHLYFEMVTIKIAPNTPQLADLIATGFSICGQIAIVRSPDTIKQMSKYR
FT                   VVLSSQDKDKALLTVDSDAHGSFCFKAKPGAYKVQVVVPEAETRAGLMLKPQVFPLTVT
FT                   NRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFD
FT                   KVLPGRYKISIMHEDWCWRNKSLEVEVLEDDVSAVEFRQTGYMLRCALSHAITLEFHQD
FT                   GNGPENVGIYNLSRGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRH
FT                   HVLGTIITDKMMDVTVTIKSSIDSEPALVLGPLKSAQELRREQQLAEIETRRQEREKNG
FT                   KEEGEEGRARPPGQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEATVS
FT                   GESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPL
FT                   HSDLEYTVNSQKEGYVLTAVEGTVGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVF
FT                   RSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLRITITGFRTAY
FT                   SCYGTVSSLNGEPEQGVAVEAVGQKDCSIYGEDTVTDEEGKFRLRGLLPGCMYHVQLKA
FT                   EGNDHIERALPHHRVIEVGNNDVDDVNIIVFRQINQFDLSGNVITSSEYLSTLWVKLYK
FT                   SESLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDTTLPRSQYDYVLPQVSFTAVGYH
FT                   KHITLVFSPTRKLPEQDIAQGSYIALPLTLLLLLAGYNHDKLIPLLLQLTSRLQGVRAL
FT                   GQAASDSSGPEDMKRQTKKQKTRRT"
FT   assembly_gap    2893076..2893230
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    2919533..2920151
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    2922601..2922999
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   gene            complement(2926797..2928406)
FT                   /gene="Kcnj11"
FT                   /locus_tag="mCG_142430"
FT                   /note="gene_id=mCG142430.0"
FT   mRNA            complement(2926797..2928406)
FT                   /gene="Kcnj11"
FT                   /locus_tag="mCG_142430"
FT                   /product="potassium inwardly rectifying channel, subfamily
FT                   J, member 11"
FT                   /note="gene_id=mCG142430.0 transcript_id=mCT180468.0
FT                   created on 11-FEB-2003"
FT   CDS             complement(2926979..2928151)
FT                   /codon_start=1
FT                   /gene="Kcnj11"
FT                   /locus_tag="mCG_142430"
FT                   /product="potassium inwardly rectifying channel, subfamily
FT                   J, member 11"
FT                   /note="gene_id=mCG142430.0 transcript_id=mCT180468.0
FT                   protein_id=mCP103390.0"
FT                   /protein_id="EDL22918.1"
FT                   /translation="MLSRKGIIPEEYVLTRLAEDPAEPRYRTRERRARFVSKKGNCNVA
FT                   HKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFLCSWLLFAMVWWLIAFAHGDLAPGE
FT                   GTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIM
FT                   LGCIFMKTAQAHRRAETLIFSKHAVITLRHGRLCFMLRVGDLRKSMIISATIHMQVVRK
FT                   TTSPEGEVVPLHQVDIPMENGVGGNGIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDL
FT                   EIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVP
FT                   TPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS"
FT   gene            complement(2932755..2979107)
FT                   /gene="Abcc8"
FT                   /locus_tag="mCG_144716"
FT                   /note="gene_id=mCG144716.0"
FT   mRNA            complement(join(2932755..2932987,2933690..2933752,
FT                   2934035..2934168,2934811..2934914,2935178..2935286,
FT                   2935464..2935542,2936310..2936440,2936541..2936661,
FT                   2936979..2937092,2937767..2937869,2941284..2941376,
FT                   2943162..2943319,2943994..2944063,2945126..2945292,
FT                   2945392..2945633,2946190..2946289,2947176..2947301,
FT                   2948593..2948730,2950327..2950407,2951076..2951160,
FT                   2952111..2952209,2953061..2953099,2954985..2955035,
FT                   2963715..2963820,2964396..2964471,2964842..2964958,
FT                   2965098..2965203,2966193..2966338,2967399..2967439,
FT                   2978979..2979107))
FT                   /gene="Abcc8"
FT                   /locus_tag="mCG_144716"
FT                   /product="ATP-binding cassette, sub-family C (CFTR/MRP),
FT                   member 8"
FT                   /note="gene_id=mCG144716.0 transcript_id=mCT184140.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(2932850..2932987,2933690..2933752,
FT                   2934035..2934168,2934811..2934914,2935178..2935286,
FT                   2935464..2935542,2936310..2936440,2936541..2936661,
FT                   2936979..2937092,2937767..2937869,2941284..2941376,
FT                   2943162..2943319,2943994..2944063,2945126..2945292,
FT                   2945392..2945633,2946190..2946289,2947176..2947301,
FT                   2948593..2948730,2950327..2950407,2951076..2951160,
FT                   2952111..2952209,2953061..2953099,2954985..2955035,
FT                   2963715..2963820,2964396..2964471,2964842..2964958,
FT                   2965098..2965203,2966193..2966338,2967399..2967439,
FT                   2978979..2979105))
FT                   /codon_start=1
FT                   /gene="Abcc8"
FT                   /locus_tag="mCG_144716"
FT                   /product="ATP-binding cassette, sub-family C (CFTR/MRP),
FT                   member 8"
FT                   /note="gene_id=mCG144716.0 transcript_id=mCT184140.0
FT                   protein_id=mCP105456.0"
FT                   /db_xref="GOA:Q8BNE2"
FT                   /db_xref="InterPro:IPR000844"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1352629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BNE2"
FT                   /protein_id="EDL22919.1"
FT                   /translation="MLRGIKLLKLYAWENIFCSRVEMTRRKEMTSLRAFAVYTSISIFM
FT                   NTAIPIAAVLITFVGHVSFFKESDFSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALV
FT                   SVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQAVPLKVVNRKRPAREEVRDLLGPLQ
FT                   RLTPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKSSLL
FT                   LATLGEMQRVSGAVFWNSSLPDSEGEDPRYCLRTSNPERETAADSDARSRGPVAYASQK
FT                   PWLLNATVEENITFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQR
FT                   QRISVARALYQHTNVVFLDDPFSALDVHLSDHLMQAGILELLRDDKRTVVLVTHKLQYL
FT                   PHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKAPEPS
FT                   QGLPRAMSSRDGLLLDEDEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGVLL
FT                   LSLLVFSQLLKHMVLVAIDYWLAKWTDSALVLSPAARNCSLSQECALDQSVYAMVFTVL
FT                   CSLGIALCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCN
FT                   TIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDL
FT                   QQLDDTTQLPLLSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWL
FT                   EVRMEYIGACVVLIAAATSISNSLHRELSAGLVGLGLTYALMVSNYLNWMVRNLADMEI
FT                   QLGAVKRIHTLLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKPVLKHVN
FT                   ALIAPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSII
FT                   LQDPVLFSGTIRFNLDPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQ
FT                   GQRQLFCLARAFVRKTSIFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTI
FT                   LSADLVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK"
FT   gene            <2951569..2958801
FT                   /locus_tag="mCG_144711"
FT                   /note="gene_id=mCG144711.0"
FT   mRNA            join(<2951569..2951684,2957148..2957493,2958134..2958663,
FT                   2958685..2958801)
FT                   /locus_tag="mCG_144711"
FT                   /product="mCG144711"
FT                   /note="gene_id=mCG144711.0 transcript_id=mCT184135.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2957366..2957493,2958134..2958314)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144711"
FT                   /product="mCG144711"
FT                   /note="gene_id=mCG144711.0 transcript_id=mCT184135.0
FT                   protein_id=mCP105452.0"
FT                   /protein_id="EDL22920.1"
FT                   /translation="KQTDRRKRTTGAQKKVGGTKVLENFEEDDTQLDEMKKTGSTRSCL
FT                   SSFPAATTYAPPNQLGQRLWILFACFKGRVSLMWLRLTWNSLYTPGWPQAHRDPKGS"
FT   assembly_gap    2966368..2966387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2969432..2970480
FT                   /estimated_length=1049
FT                   /gap_type="unknown"
FT   assembly_gap    2980158..2980445
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    3009992..3010171
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    3018883..3019045
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            complement(3023867..>3067009)
FT                   /gene="Ush1c"
FT                   /locus_tag="mCG_142417"
FT                   /note="gene_id=mCG142417.0"
FT   mRNA            complement(join(3023867..3024244,3025222..3025307,
FT                   3025706..3025761,3026863..3026972,3029484..3029583,
FT                   3029879..3029932,3030143..3030184,3032640..3032690,
FT                   3033704..3033823,3037360..3037842,3038374..3038490,
FT                   3039668..3039820,3043451..3043500,3047802..3047926,
FT                   3048972..3049037,3049916..3050058,3050164..3050220,
FT                   3050372..3050431,3051341..3051425,3053361..3053455,
FT                   3053707..3053764,3053933..3053957,3054066..3054174,
FT                   3057726..3057864,3057977..3058120,3058587..3058654,
FT                   3066948..>3067009))
FT                   /gene="Ush1c"
FT                   /locus_tag="mCG_142417"
FT                   /product="Usher syndrome 1C homolog (human), transcript
FT                   variant mCT191801"
FT                   /note="gene_id=mCG142417.0 transcript_id=mCT191801.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3023867..3024244,3025706..3025761,
FT                   3026863..3026972,3029484..3029583,3029879..3029932,
FT                   3030143..3030184,3044538..3044599,3047802..3047926,
FT                   3048972..3049037,3049916..3050058,3050164..3050220,
FT                   3050372..3050431,3051341..3051425,3053361..3053455,
FT                   3053707..3053764,3053933..3053957,3054066..3054174,
FT                   3057726..3057864,3057977..3058120,3058587..3058654,
FT                   3066948..3067009))
FT                   /gene="Ush1c"
FT                   /locus_tag="mCG_142417"
FT                   /product="Usher syndrome 1C homolog (human), transcript
FT                   variant mCT180454"
FT                   /note="gene_id=mCG142417.0 transcript_id=mCT180454.0
FT                   created on 13-FEB-2003"
FT   mRNA            complement(join(3024141..3024244,3025214..3025330,
FT                   3025706..3025761,3026863..3026972,3029484..3029583,
FT                   3029879..3029932,3030143..3030184,3032640..3032690,
FT                   3033704..3033823,3037360..3037842,3038374..3038490,
FT                   3039668..3039820,3043451..3043500,3047802..3047926,
FT                   3048972..3049037,3049916..3050058,3050164..3050220,
FT                   3050372..3050431,3051341..3051425,3053361..3053455,
FT                   3053707..3053764,3053933..3053957,3054066..3054174,
FT                   3057726..3057864,3057977..3058120,3058587..3058654,
FT                   3066948..>3066983))
FT                   /gene="Ush1c"
FT                   /locus_tag="mCG_142417"
FT                   /product="Usher syndrome 1C homolog (human), transcript
FT                   variant mCT191800"
FT                   /note="gene_id=mCG142417.0 transcript_id=mCT191800.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(3024232..3024244,3025214..3025330,
FT                   3025706..3025761,3026863..3026972,3029484..3029583,
FT                   3029879..3029932,3030143..3030184,3032640..3032690,
FT                   3033704..3033823,3037360..3037842,3038374..3038490,
FT                   3039668..3039820,3043451..3043500,3047802..3047926,
FT                   3048972..3049037,3049916..3050058,3050164..3050220,
FT                   3050372..3050431,3051341..3051425,3053361..3053455,
FT                   3053707..3053764,3053933..3053957,3054066..3054174,
FT                   3057726..3057864,3057977..3058120,3058587..3058654,
FT                   3066948..3066983))
FT                   /codon_start=1
FT                   /gene="Ush1c"
FT                   /locus_tag="mCG_142417"
FT                   /product="Usher syndrome 1C homolog (human), isoform CRA_b"
FT                   /note="gene_id=mCG142417.0 transcript_id=mCT191800.0
FT                   protein_id=mCP112761.0 isoform=CRA_b"
FT                   /protein_id="EDL22922.1"
FT                   /translation="MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGD
FT                   LKLVINEPNRLPLFDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRG
FT                   GLEFGCGLFISHLIKGGQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKTVSIK
FT                   VRHIGLIPVKSSPEESLKWQYVDQFVSESGGVRGGLGSPGNRTTKEKKVFISLVGSRGL
FT                   GCSISSGPIQKPGIFVSHVKPGSLSAEVGLETGDQIVEVNGIDFTNLDHKEAVNVLKSS
FT                   RSLTISIVAGAGRELFMTDRERLEEARQRELQRQELLMQKRLAMESNKILQEQQEMERQ
FT                   RRKEIAQKAAEENERYRKEMEQISEEEEKFKKQWEEDWGSKEQLILPKTITAEVHPVPL
FT                   RKPKSFGWFYRYDGKFPTIRKKAKEKKKAKYDSLQDLRKNKKELEFEQKLYKEKEEMLE
FT                   KEKQLKINRLAQEVSETEREDLEESEKTQYWVERLCQTRLEQISSAENEIPEMTTGPPP
FT                   PPPSVSPLAPPLRRFAGGIHLHTTDLDDIPLDMFYYPPKTPSALPVMPHPPSVNSPSKV
FT                   PAPPVLPSSGHVSSSSSPWVQRTPPPIPIPPPPSIPTQDLTPTRPLPSALEEALGNHPF
FT                   RTGDPGHPADDWEANTHSGKPSSSPTTERSFPPAPKTFCPSPQPPRGPGVSTISKPVMV
FT                   HQEHNFVYRPAVKSEVLPQEMLKRMVVYQTAFRQDFRKYEEGFDPYSMFSPEQIAGKDV
FT                   RLLRIKKEGSLDLALEGGVDSPVGKVVVSAVYEGGAAERHGGVVKGDEIMAINGKIVTD
FT                   YTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDELSSLPSSAAESPQLARKQLEAYE
FT                   PVCRHGFFLQLEPTVTRTFF"
FT   CDS             complement(join(3024232..3024244,3025706..3025761,
FT                   3026863..3026972,3029484..3029583,3029879..3029932,
FT                   3030143..3030184,3044538..3044599,3047802..3047926,
FT                   3048972..3049037,3049916..3050058,3050164..3050220,
FT                   3050372..3050431,3051341..3051425,3053361..3053455,
FT                   3053707..3053764,3053933..3053957,3054066..3054174,
FT                   3057726..3057864,3057977..3058120,3058587..3058654,
FT                   3066948..3066983))
FT                   /codon_start=1
FT                   /gene="Ush1c"
FT                   /locus_tag="mCG_142417"
FT                   /product="Usher syndrome 1C homolog (human), isoform CRA_a"
FT                   /note="gene_id=mCG142417.0 transcript_id=mCT180454.0
FT                   protein_id=mCP103376.0 isoform=CRA_a"
FT                   /protein_id="EDL22921.1"
FT                   /translation="MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGD
FT                   LKLVINEPNRLPLFDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRG
FT                   GLEFGCGLFISHLIKGGQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKTVSIK
FT                   VRHIGLIPVKSSPEESLKWQYVDQFVSESGGVRGGLGSPGNRTTKEKKVFISLVGSRGL
FT                   GCSISSGPIQKPGIFVSHVKPGSLSAEVGLETGDQIVEVNGIDFTNLDHKEAVNVLKSS
FT                   RSLTISIVAGAGRELFMTDRERLEEARQRELQRQELLMQKRLAMESNKILQEQQEMERQ
FT                   RRKEIAQKAAEENERYRKEMEQISEEEEKFKKQWEEDWGSKEQLILPKTITAEVHPVPL
FT                   RKPKYDQGVEPADHLDGSTEEQRQQDFRKYEEGFDPYSMFSPEQIAGKDVRLLRIKKEG
FT                   SLDLALEGGVDSPVGKVVVSAVYEGGAAERHGGVVKGDEIMAINGKIVTDYTLAEAEAA
FT                   LQKAWNQGGDWIDLVVAVCPPKEYDDELTFF"
FT   CDS             complement(join(3025274..3025307,3025706..3025761,
FT                   3026863..3026972,3029484..3029583,3029879..3029932,
FT                   3030143..3030184,3032640..3032690,3033704..3033823,
FT                   3037360..3037842,3038374..3038490,3039668..3039820,
FT                   3043451..3043500,3047802..3047926,3048972..3049037,
FT                   3049916..3050058,3050164..3050220,3050372..3050431,
FT                   3051341..3051425,3053361..3053455,3053707..3053764,
FT                   3053933..3053957,3054066..3054174,3057726..3057864,
FT                   3057977..3058120,3058587..3058654,3066948..>3067007))
FT                   /codon_start=1
FT                   /gene="Ush1c"
FT                   /locus_tag="mCG_142417"
FT                   /product="Usher syndrome 1C homolog (human), isoform CRA_c"
FT                   /note="gene_id=mCG142417.0 transcript_id=mCT191801.0
FT                   protein_id=mCP112762.0 isoform=CRA_c"
FT                   /protein_id="EDL22923.1"
FT                   /translation="KATGSGSVMDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTM
FT                   DVAVLVGDLKLVINEPNRLPLFDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPE
FT                   GLGLSVRGGLEFGCGLFISHLIKGGQADSVGLQVGDEIVRINGYSISSCTHEEVINLIR
FT                   TKKTVSIKVRHIGLIPVKSSPEESLKWQYVDQFVSESGGVRGGLGSPGNRTTKEKKVFI
FT                   SLVGSRGLGCSISSGPIQKPGIFVSHVKPGSLSAEVGLETGDQIVEVNGIDFTNLDHKE
FT                   AVNVLKSSRSLTISIVAGAGRELFMTDRERLEEARQRELQRQELLMQKRLAMESNKILQ
FT                   EQQEMERQRRKEIAQKAAEENERYRKEMEQISEEEEKFKKQWEEDWGSKEQLILPKTIT
FT                   AEVHPVPLRKPKSFGWFYRYDGKFPTIRKKAKEKKKAKYDSLQDLRKNKKELEFEQKLY
FT                   KEKEEMLEKEKQLKINRLAQEVSETEREDLEESEKTQYWVERLCQTRLEQISSAENEIP
FT                   EMTTGPPPPPPSVSPLAPPLRRFAGGIHLHTTDLDDIPLDMFYYPPKTPSALPVMPHPP
FT                   SVNSPSKVPAPPVLPSSGHVSSSSSPWVQRTPPPIPIPPPPSIPTQDLTPTRPLPSALE
FT                   EALGNHPFRTGDPGHPADDWEANTHSGKPSSSPTTERSFPPAPKTFCPSPQPPRGPGVS
FT                   TISKPVMVHQEHNFVYRPAVKSEVLPQEMLKRMVVYQTAFRQDFRKYEEGFDPYSMFSP
FT                   EQIAGKDVRLLRIKKEGSLDLALEGGVDSPVGKVVVSAVYEGGAAERHGGVVKGDEIMA
FT                   INGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDELRKPPAGPKAA"
FT   gene            3033058..3036711
FT                   /locus_tag="mCG_147776"
FT                   /note="gene_id=mCG147776.0"
FT   mRNA            3033058..3036711
FT                   /locus_tag="mCG_147776"
FT                   /product="mCG147776"
FT                   /note="gene_id=mCG147776.0 transcript_id=mCT188039.0
FT                   created on 13-JAN-2004"
FT   CDS             3034835..3035206
FT                   /codon_start=1
FT                   /locus_tag="mCG_147776"
FT                   /product="mCG147776"
FT                   /note="gene_id=mCG147776.0 transcript_id=mCT188039.0
FT                   protein_id=mCP109088.0"
FT                   /db_xref="MGI:MGI:3642591"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CB92"
FT                   /protein_id="EDL22924.1"
FT                   /translation="MQCLADMVLEPSLGRCWVVGSQYPTLLPEASYADMLPTLPAVHIE
FT                   NLQGAHRQRTRQDGWDGGQHNEIALSQGQSGCFEIFMVVQSFKGLYVGTLMFLYSEQER
FT                   TVAFFIPCRVRESGACLES"
FT   gene            3069486..3139928
FT                   /gene="Otog"
FT                   /locus_tag="mCG_142479"
FT                   /note="gene_id=mCG142479.0"
FT   mRNA            join(3069486..3069618,3070009..3070069,3070211..3070271,
FT                   3073803..3073878,3074752..3074844,3074994..3075148,
FT                   3077486..3077604,3078422..3078627,3079448..3079578,
FT                   3079767..3079873,3080468..3080577,3080948..3081076,
FT                   3082600..3082708,3082961..3083007,3083437..3083582,
FT                   3087720..3087852,3088381..3088558,3090172..3090296,
FT                   3091133..3091345,3092528..3092720,3094189..3094263,
FT                   3094433..3094476,3095730..3095883,3097745..3097852,
FT                   3099734..3099872,3102200..3102334,3102577..3102723,
FT                   3102998..3103117,3105114..3105230,3105846..3106002,
FT                   3109605..3109631,3112247..3112414,3113396..3113674,
FT                   3114248..3114365,3115248..3115327,3115720..3117485,
FT                   3118165..3118333,3118585..3118730,3119423..3119512,
FT                   3124326..3124509,3126622..3126842,3126995..3127133,
FT                   3128497..3128691,3128868..3129080,3129616..3129720,
FT                   3129876..3129983,3131318..3131419,3131636..3131734,
FT                   3132705..3132745,3133724..3133799,3133907..3134085,
FT                   3134314..3134418,3134618..3134737,3135544..3135589,
FT                   3138272..3138351,3138466..3139928)
FT                   /gene="Otog"
FT                   /locus_tag="mCG_142479"
FT                   /product="otogelin"
FT                   /note="gene_id=mCG142479.0 transcript_id=mCT180518.0
FT                   created on 13-FEB-2003"
FT   CDS             join(3069528..3069618,3070009..3070069,3070211..3070271,
FT                   3073803..3073878,3074752..3074844,3074994..3075148,
FT                   3077486..3077604,3078422..3078627,3079448..3079578,
FT                   3079767..3079873,3080468..3080577,3080948..3081076,
FT                   3082600..3082708,3082961..3083007,3083437..3083582,
FT                   3087720..3087852,3088381..3088558,3090172..3090296,
FT                   3091133..3091345,3092528..3092720,3094189..3094263,
FT                   3094433..3094476,3095730..3095883,3097745..3097852,
FT                   3099734..3099872,3102200..3102334,3102577..3102723,
FT                   3102998..3103117,3105114..3105230,3105846..3106002,
FT                   3109605..3109631,3112247..3112414,3113396..3113674,
FT                   3114248..3114365,3115248..3115327,3115720..3117485,
FT                   3118165..3118333,3118585..3118730,3119423..3119512,
FT                   3124326..3124509,3126622..3126842,3126995..3127133,
FT                   3128497..3128691,3128868..3129080,3129616..3129720,
FT                   3129876..3129983,3131318..3131419,3131636..3131734,
FT                   3132705..3132745,3133724..3133799,3133907..3134085,
FT                   3134314..3134418,3134618..3134737,3135544..3135589,
FT                   3138272..3138351,3138466..3138666)
FT                   /codon_start=1
FT                   /gene="Otog"
FT                   /locus_tag="mCG_142479"
FT                   /product="otogelin"
FT                   /note="gene_id=mCG142479.0 transcript_id=mCT180518.0
FT                   protein_id=mCP103440.0"
FT                   /db_xref="GOA:G3UWC8"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001007"
FT                   /db_xref="InterPro:IPR001846"
FT                   /db_xref="InterPro:IPR002919"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR007934"
FT                   /db_xref="InterPro:IPR014853"
FT                   /db_xref="InterPro:IPR030105"
FT                   /db_xref="MGI:MGI:1202064"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWC8"
FT                   /protein_id="EDL22925.1"
FT                   /translation="MGARMPRRCLLLLSCFCLLRVESTAEVQHQASALTWKISAELQQE
FT                   PAPEPSHTYQEMSLAVEDVTTVMEGQEAEALAASAMSSWERRLHRAKCAPSYLFSCFNG
FT                   GECVHPALCDCRRFNATGPRCQLVYNVGPERDSICRTWGQHHVETFDGLYYYFSGKGSY
FT                   TLVGHHEPEGQSFSIQVHNDPQCGSAHYTCPRSVSLFLSGEREICLAKEVTHGGVRVQL
FT                   PQVVGGVQLQQLAGYVIARHPSAFTLAWDGISAIYIKMSPEFLGWTHGLCGNNNADPQD
FT                   DLVTSYGKVTDDVGEFVHSWQEQVPNSPPGPVTTSLPRPPCLQQSPASMQGVYERCEVL
FT                   LRPPFDTCHAYVSPLPFAASCTSDLCQSGGDEATWCRALMEYARACAQAGRPLQGWRTQ
FT                   LSQCTVHCKEKAFIYNECIACCPASCQSRASCVDSEITCVDGCYCPNGLIFEDGGCMSP
FT                   AECPCEFHGTLHPPGSVVTEDCNACTCTAGKWVCSSSVCPAECSVTGDIHFTTFDGRRY
FT                   TFPATCQYILAKSRSSGTFTVTLQNAPCGLNQDGACVQSVSVILHQDPRRQVTLTQAGD
FT                   VLLFDQYKITPPYSDDAFEIRRLSSVFLRVRTNVGVRILYDREGLRLYLQVDQRWVEDT
FT                   VGLCGTFNGNTQDDFLSPVGVPESTPQLFGNSWKTLSACVPLVPGSLLDPCDVHLQAAS
FT                   YALQSCSVLTGELFAPCSAYLSPIPYFEQCRRDACRCGQPCLCATLAHYARLCRRHGLP
FT                   VDFRAHLPACALSCEATKEYSPCVTLCAPTCQDLASPDVCGANGGGNFSREECVEGCTC
FT                   PPDTFLDTQADLCVPRNQCSCHFQGVDYPPGDSDIPSLGHCHCKDGVMSCDSRAPAAAC
FT                   PAGQVFVNCSELHPDPELSRERTCEQQLLNLSVPARGPCLSGCACPQGLLRHGDACFPP
FT                   EECPCTWKGKEYFPGDQVVSSCHTCVCQRGSFQCTLHPCASTCTAYGDRHYRTFDGLPY
FT                   DFVGACKVHLVKSTSELSFSVMVEDVNCYGSGVICRKSISINVGSSLIIFDDDSGDPSP
FT                   ESFLDEKQAVHIWRAGFFTLVHFPREHITLLWDQRTTVHVQAGPQWQGQLVGLCGNFDL
FT                   KTINEMRTPENLELTNPQEFGSSWAAVECPDTPDPRDTCVLNPLREPFARKECGILLSE
FT                   VFETCHPVVDVTWFYSNCLTDTCGCSRGGDCECFCASVAAYAHQCCQHGVVIDWRTPRI
FT                   CPYDCDFFNKALGKGPYQLSSVAAGGTLVATKAVDSDIALVRAEDLAPGDISSFLLTAA
FT                   LYKAKAHDPDVVSLEAADRPNFFLHTTANGSIGLAKWQRDEAFHQHASFSLHRGTWQAG
FT                   LVALESLAKPGSFLHSSGLELALRAYEHTEVFRGGALFRLLDAKPLGAAYPTCEWRYDA
FT                   CASPCFQTCRDPRATSCQDVPRVEGCVPVCPTPKVLDEVTQRCVYLEDCVEPAPRGPTE
FT                   TLGNETLVPGQVPPTTSAEQQLPQGLPGASAYSPAPVPVAPPTSAPNPPMAATEGQAPS
FT                   PGSTQPTLQTPLGLTTSNFPAGHTEATAREEGAASLLTTSHPPGFSSSLPSSLQMPTSG
FT                   IVSGATETTKVTITFTGSPNTTVASRSPPIPRFPLMTKAVTVPSHDSFPVKTTPLQPSW
FT                   LWSLSSRPMTSLGATSWPPTSPGSHLSTAVTKVANKTMTSLSVLAQSTSSSSQPLAAVT
FT                   TAHRAPASPLVTKGLEVVSATEKGEAGHSQLTELPVSPPPSPAPIDLPHPAQHTTTAPG
FT                   PSALSPGILAAGSPSTGAHRPGATALASLEPTRPPHLLSGLPLDTSLPLAKVGTSAPVA
FT                   TPGSKGYIPTPPPQHQATTLATAMTVSPLTQSLSLTVPLMSAVEEQAHSPSPKPPQGTG
FT                   MAPDQMLGATLPSFGASSVIAGVPPTVSAAPRKSTTQRAAILSKKVSPPTLISDSVQGG
FT                   FTELTPIVSHTVTPLATEAEGPRAGTVPLVPTTYSLSRVSARTASREGPLVLLPQLAEA
FT                   YGTPAGLQPQEDLVRQATTEQSGRSAPAKSIAEESMEAEVNTSATCVPIAEQDCVRHIC
FT                   LEGQLIRVNQTQHCPQGAVRPRCGVLGLAVRVGGDRCCPQWECACRCSIFPDLSFVTFD
FT                   GSHAALFKEAIYVLSQSPDETISVHVLDCKSANLGHLNWPPFCLVILNVTHLAHHVSID
FT                   RFNRKVTVDSQVVWPPMSRYGFRIEDTGHMYIVRTPSHIQIQWLHSSGLMILEASKVSK
FT                   TQGHGLCGICDGDAANDLTLKDGSVLGEAEDPAPFLDSWQVPSSLTSEGQTRFRPDSCA
FT                   TADCSPCLRMVSNRTFSACHSFVSPESFCELWIRDTKYVQQPCVALTVYVAMCHKFHVC
FT                   IEWRGSDYCPFLCSSDSTYQACVAACEPPDTCQDGILGPLDPEQCQVLGEGCVCTEGTI
FT                   LHRRHSALCIPEDKCACTDSTGVPRALGETWNSSLSGCCQQQCQAPDTIIPVDLDCPGP
FT                   RPESCPRFGEVILLQPTEDPCCLGSVCVCNQTLCEGLAPTCRPGHSLITHFQEDSCCPS
FT                   YSCECDPGLCEAEQVPTCREDQILIEGRLGDSCCTSYFCGCGECSDPMPECQEGEALTV
FT                   HRNTTELCCPLYQCVCENFRCPQVQCGMGTSLVEVWSPDRCCPYKSCECDCDTIPVPRC
FT                   HLWEKSQLDEEFMHSVENVCGCAKYECVKAPVCLSRELGVMQPGQTVVELSADGVCHTS
FT                   RCTDVLDPLTNFYQINITSVLCDMHCEANQEYDHPRDLAACCGSCRNVSCLFTFPNGTT
FT                   SLFLPGASWIADCARHHCGSTPLGAVLVRSPISCPPFNETECAKVGGSVVPSLEGCCRA
FT                   CKEDGRSCKKVTIRMTIRKNDCRSNTPVNLVSCDGRCPSASIYNHNINTYARFCKCCRE
FT                   VGLQRRSVQLFCATNATWVPYTVQEPTDCACQWS"
FT   gene            complement(3174228..3177477)
FT                   /locus_tag="mCG_147774"
FT                   /note="gene_id=mCG147774.0"
FT   mRNA            complement(join(3174228..3174701,3177093..3177477))
FT                   /locus_tag="mCG_147774"
FT                   /product="mCG147774"
FT                   /note="gene_id=mCG147774.0 transcript_id=mCT188037.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3174456..3174647)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147774"
FT                   /product="mCG147774"
FT                   /note="gene_id=mCG147774.0 transcript_id=mCT188037.0
FT                   protein_id=mCP109084.0"
FT                   /protein_id="EDL22926.1"
FT                   /translation="MKMLAGLGLISRPDWGEATPILLHLTGSLSFLSCGAAHNMAAGFS
FT                   LEKVNEESMQRHRAPEAS"
FT   assembly_gap    3192306..3192884
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   gene            3204913..3207525
FT                   /gene="Myod1"
FT                   /locus_tag="mCG_144018"
FT                   /note="gene_id=mCG144018.0"
FT   mRNA            join(3204913..3205730,3206171..3206249,3206575..3207525)
FT                   /gene="Myod1"
FT                   /locus_tag="mCG_144018"
FT                   /product="myogenic differentiation 1"
FT                   /note="gene_id=mCG144018.0 transcript_id=mCT183442.0
FT                   created on 02-JUL-2003"
FT   CDS             join(3205104..3205730,3206171..3206249,3206575..3206825)
FT                   /codon_start=1
FT                   /gene="Myod1"
FT                   /locus_tag="mCG_144018"
FT                   /product="myogenic differentiation 1"
FT                   /note="gene_id=mCG144018.0 transcript_id=mCT183442.0
FT                   protein_id=mCP105450.0"
FT                   /protein_id="EDL22927.1"
FT                   /translation="MELLSPPLRDIDLTGPDGSLCSFETADDFYDDPCFDSPDLRFFED
FT                   LDPRLVHVGALLKPEEHAHFPTAVHPGPGAREDEHVRAPSGHHQAGRCLLWACKACKRK
FT                   TTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQAL
FT                   LRDQDAAPPGAAAFYAPGPLPPGRGSEHYSGDSDASSPRSNCSDGMMDYSGPPSGPRRQ
FT                   NGYDTAYYSEAARESRPGKSAAVSSLDCLSSIVERISTDSPAAPALLLADAPPESPPGP
FT                   PEGASLSDTEQGTQTPSPDAAPQCPAGSNPNAIYQVL"
FT   assembly_gap    3211990..3212128
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   gene            3226014..3256903
FT                   /gene="Kcnc1"
FT                   /locus_tag="mCG_142473"
FT                   /note="gene_id=mCG142473.0"
FT   mRNA            join(3226014..3226719,3255805..3256903)
FT                   /gene="Kcnc1"
FT                   /locus_tag="mCG_142473"
FT                   /product="potassium voltage gated channel, Shaw-related
FT                   subfamily, member 1"
FT                   /note="gene_id=mCG142473.0 transcript_id=mCT180512.0
FT                   created on 13-FEB-2003"
FT   CDS             join(3226150..3226719,3255805..3256770)
FT                   /codon_start=1
FT                   /gene="Kcnc1"
FT                   /locus_tag="mCG_142473"
FT                   /product="potassium voltage gated channel, Shaw-related
FT                   subfamily, member 1"
FT                   /note="gene_id=mCG142473.0 transcript_id=mCT180512.0
FT                   protein_id=mCP103434.0"
FT                   /db_xref="GOA:Q3UHB6"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003974"
FT                   /db_xref="InterPro:IPR005403"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:96667"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UHB6"
FT                   /protein_id="EDL22928.1"
FT                   /translation="MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSH
FT                   FDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPC
FT                   CWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDG
FT                   RPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKT
FT                   EIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNII
FT                   DFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRA
FT                   STNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMT
FT                   TLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKK
FT                   HIPRPPQLGSPNYCKSVVNSPHHSTQSDTCPLAQEEILEINRAGRKPLRGMSI"
FT   gene            complement(3271628..3468900)
FT                   /gene="Sergef"
FT                   /locus_tag="mCG_142478"
FT                   /note="gene_id=mCG142478.0"
FT   mRNA            complement(join(3271628..3271990,3343856..3343892,
FT                   3419543..3419709,3443631..3443789,3447709..3447771,
FT                   3450574..3450687,3455322..3455382,3461772..3461866,
FT                   3462867..3463022,3464533..3464668,3468823..3468900))
FT                   /gene="Sergef"
FT                   /locus_tag="mCG_142478"
FT                   /product="secretion regulating guanine nucleotide exchange
FT                   factor"
FT                   /note="gene_id=mCG142478.0 transcript_id=mCT180517.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(3271644..3271990,3343856..3343892,
FT                   3419543..3419709,3443631..3443789,3447709..3447771,
FT                   3450574..3450687,3455322..3455382,3461772..3461866,
FT                   3462867..3463022,3464533..3464668,3468823..3468882))
FT                   /codon_start=1
FT                   /gene="Sergef"
FT                   /locus_tag="mCG_142478"
FT                   /product="secretion regulating guanine nucleotide exchange
FT                   factor"
FT                   /note="gene_id=mCG142478.0 transcript_id=mCT180517.0
FT                   protein_id=mCP103439.0"
FT                   /protein_id="EDL22929.1"
FT                   /translation="MARESCASETVSAAAVLFAWGANSYGQLGLGHKEDVFLPQQLSDF
FT                   CQAGCIKSVTGGGGHSAVVTDGGDLFVCGLNKDGQLGLGHTEEVLRFTICKPLRGCPIR
FT                   QVACGWDFTIMLTEKGQVLSCGSNAFGQLGVPHGPRKCVVPQAIECLREKVVCVAAGLR
FT                   HALATTATGSVFQWGTGLASSGRRLCPGQNLPLFLTAKEPSRVTGLENSTAVCAVAGSD
FT                   HSASLTDTGELYVWGRNKHGQLASRAVFLPLPQRIEAHYFQDEKVTAVWSGWTHLVAKT
FT                   ETGKVFTWGRADYGQLGRRLEPPEAQKPVEQDSSLAFQGPQNSVPSPLHCLTGATEISC
FT                   GSEHNLAVIRDKCCSWGWNEHGMCGDGTESNVWTPTPVQALPPSPSRLLLVGCGAGHSL
FT                   AVCQLPAHPVPCQDLKVTCPLPDDTENTESQGAVDRDRLEGETISDLNPDRTRNGGGGC
FT                   ESETVQ"
FT   assembly_gap    3364033..3364661
FT                   /estimated_length=629
FT                   /gap_type="unknown"
FT   assembly_gap    3384804..3385238
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    3453145..3453164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3476241..3496458)
FT                   /gene="Tph1"
FT                   /locus_tag="mCG_142470"
FT                   /note="gene_id=mCG142470.0"
FT   mRNA            complement(join(3476241..3476710,3479057..3479190,
FT                   3480001..3480096,3481968..3482094,3482851..3482986,
FT                   3485970..3486166,3486318..3486385,3489526..3489626,
FT                   3491117..3491300,3494286..3494418,3496373..3496458))
FT                   /gene="Tph1"
FT                   /locus_tag="mCG_142470"
FT                   /product="tryptophan hydroxylase 1"
FT                   /note="gene_id=mCG142470.0 transcript_id=mCT180509.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(3476536..3476710,3479057..3479190,
FT                   3480001..3480096,3481968..3482094,3482851..3482986,
FT                   3485970..3486166,3486318..3486385,3489526..3489626,
FT                   3491117..3491300,3494286..3494411))
FT                   /codon_start=1
FT                   /gene="Tph1"
FT                   /locus_tag="mCG_142470"
FT                   /product="tryptophan hydroxylase 1"
FT                   /note="gene_id=mCG142470.0 transcript_id=mCT180509.0
FT                   protein_id=mCP103431.0"
FT                   /db_xref="GOA:Q3UK52"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005963"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019773"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="MGI:MGI:98796"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UK52"
FT                   /protein_id="EDL22930.1"
FT                   /translation="MIEDNKENKENKDHSSERGRVTLIFSLENEVGGLIKVLKIFQENH
FT                   VSLLHIESRKSKQRNSEFEIFVDCDISREQLNDIFPLLKSHATVLSVDSPDQLTAKEDV
FT                   METVPWFPKKISDLDFCANRVLLYGSELDADHPGFKDNVYRRRRKYFAELAMNYKHGDP
FT                   IPKIEFTEEEIKTWGTIFRELNKLYPTHACREYLRNLPLLSKYCGYREDNIPQLEDVSN
FT                   FLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPLYTPEPDTCHELLGHV
FT                   PLLAEPSFAQFSQEIGLASLGASEETVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSS
FT                   ISELKHALSGHAKVKPFDPKIACKQECLITSFQDVYFVSESFEDAKEKMREFAKTVKRP
FT                   FGLKYNPYTQSVQVLRDTKSITSAMNELRYDLDVISDALARVTRWPSV"
FT   gene            complement(3511949..3514494)
FT                   /locus_tag="mCG_147783"
FT                   /note="gene_id=mCG147783.0"
FT   mRNA            complement(3511949..3514494)
FT                   /locus_tag="mCG_147783"
FT                   /product="mCG147783"
FT                   /note="gene_id=mCG147783.0 transcript_id=mCT188046.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3514045..3514470)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147783"
FT                   /product="mCG147783"
FT                   /note="gene_id=mCG147783.0 transcript_id=mCT188046.0
FT                   protein_id=mCP109093.0"
FT                   /protein_id="EDL22931.1"
FT                   /translation="MCVCERLSDPLEQELTNNWGLPCGCWELNPSPLEEQPVLITAGPS
FT                   LQPLRINSYAIKVVPDSSMWVSQAGGVILLGESSVPDGHLPPHPFFVLASQRAIVPSLW
FT                   RPRQESHEFKSSLGYKARPSFKQSITNTLLCVVQSSL"
FT   gene            complement(3518380..>3539775)
FT                   /locus_tag="mCG_145364"
FT                   /note="gene_id=mCG145364.1"
FT   mRNA            complement(join(3518380..3518566,3518914..3519006,
FT                   3521890..3522086,3528475..3528663,3528747..3531072,
FT                   3531513..3531628,3531732..3531791,3533125..3533204,
FT                   3536105..3536188,3537976..>3538029))
FT                   /locus_tag="mCG_145364"
FT                   /product="mCG145364, transcript variant mCT191736"
FT                   /note="gene_id=mCG145364.1 transcript_id=mCT191736.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3518417..3518566,3518914..3519006,
FT                   3521890..3522086,3528475..3528663,3528747..3528829,
FT                   3529451..3529504,3530892..3531399,3531513..3531603,
FT                   3531732..3531791,3533125..3533204,3536105..3536188,
FT                   3537976..3538089,3539610..>3539755))
FT                   /locus_tag="mCG_145364"
FT                   /product="mCG145364, transcript variant mCT184788"
FT                   /note="gene_id=mCG145364.1 transcript_id=mCT184788.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3518474..3518566,3518914..3519006,
FT                   3521890..3522086,3528475..3528663,3528747..>3528855))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145364"
FT                   /product="mCG145364, isoform CRA_c"
FT                   /note="gene_id=mCG145364.1 transcript_id=mCT191736.0
FT                   protein_id=mCP112704.0 isoform=CRA_c"
FT                   /protein_id="EDL22934.1"
FT                   /translation="SYFSVSLLSSENLEGLDVYMRILQLLTTVDDGVQAIVQCPDTGND
FT                   TWRLLFDLVCHEFCQPDDPPVILQEQKTVLASVFSVLSAISASRAEQEHLKIEEGDLPL
FT                   IDSLIRVLQNMEHCQKKPENPSESDTEEPTICGPTQDDFHMKILKDISCEFLSNIFQVL
FT                   TKEKVAQGLKEGQLSKQKCSCAFQSLLPLYGPAVEDFVKVVREVDEALADDLEDSFPSV
FT                   KAQT"
FT   mRNA            complement(join(3521349..3522086,3528475..3528658,
FT                   3528747..3531072,3531513..3531603,3531732..3531791,
FT                   3533125..3533204,3536105..3536188,3537976..3538089,
FT                   3539610..>3539775))
FT                   /locus_tag="mCG_145364"
FT                   /product="mCG145364, transcript variant mCT191735"
FT                   /note="gene_id=mCG145364.1 transcript_id=mCT191735.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(3531058..3531072,3531513..3531603,
FT                   3531732..3531791,3533125..3533204,3536105..3536188,
FT                   3537976..3538089,3539610..>3539774))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145364"
FT                   /product="mCG145364, isoform CRA_b"
FT                   /note="gene_id=mCG145364.1 transcript_id=mCT191735.0
FT                   protein_id=mCP112703.0 isoform=CRA_b"
FT                   /protein_id="EDL22933.1"
FT                   /translation="RLPVLLARIGMDRNPSPPPPTCGSEDEEDLGGGDRIGSTVYSKHW
FT                   LFGVLSGLIQIVTPESGTSGSADEEEQADLAEEMENEICRVWDMSMDEDVALFLQEFKA
FT                   PDIFMGVLAKSPCPRLREICVGILGNMACFREICESISKNEDHGQVLLQCLCDSDPPTL
FT                   LETCRQKWPVSGLEGSGNTHLSTLTFASSCPVQQTLTCW"
FT   CDS             complement(join(3531226..3531399,3531513..3531603,
FT                   3531732..3531791,3533125..3533204,3536105..3536188,
FT                   3537976..3538089,3539610..>3539753))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145364"
FT                   /product="mCG145364, isoform CRA_a"
FT                   /note="gene_id=mCG145364.1 transcript_id=mCT184788.0
FT                   protein_id=mCP105467.0 isoform=CRA_a"
FT                   /protein_id="EDL22932.1"
FT                   /translation="RIGMDRNPSPPPPTCGSEDEEDLGGGDRIGSTVYSKHWLFGVLSG
FT                   LIQIVTPESGTSGSADEEEQADLAEEMENEICRVWDMSMDEDVALFLQEFKAPDIFMGV
FT                   LAKSPCPRLREICVGILGNMACFREICESISKNEDHGQVLLQCLCDSDPPTLLETCRQK
FT                   WPVSGLEGSGNTHLSTLTFASSCPVQQTVFACICVSLTYWCVPGAHRGQKTGSDPLGLE
FT                   LRQFCELLPVWVLGIKPGCAGGALSG"
FT   gene            complement(3541111..3544813)
FT                   /gene="Saa3"
FT                   /locus_tag="mCG_147785"
FT                   /note="gene_id=mCG147785.1"
FT   mRNA            complement(join(3541111..3541376,3541701..3541839,
FT                   3544122..3544216,3544759..3544813))
FT                   /gene="Saa3"
FT                   /locus_tag="mCG_147785"
FT                   /product="serum amyloid A 3, transcript variant mCT188048"
FT                   /note="gene_id=mCG147785.1 transcript_id=mCT188048.1
FT                   created on 28-SEP-2004"
FT   mRNA            complement(join(3541111..3541376,3541701..3541839,
FT                   3542773..3542863))
FT                   /gene="Saa3"
FT                   /locus_tag="mCG_147785"
FT                   /product="serum amyloid A 3, transcript variant mCT194538"
FT                   /note="gene_id=mCG147785.1 transcript_id=mCT194538.0
FT                   created on 28-SEP-2004"
FT   CDS             complement(join(3541238..3541376,3541701..3541839,
FT                   3544122..3544212))
FT                   /codon_start=1
FT                   /gene="Saa3"
FT                   /locus_tag="mCG_147785"
FT                   /product="serum amyloid A 3, isoform CRA_b"
FT                   /note="gene_id=mCG147785.1 transcript_id=mCT188048.1
FT                   protein_id=mCP109095.1 isoform=CRA_b"
FT                   /protein_id="EDL22936.1"
FT                   /translation="MKPSIAIILCILILGVDSQRWVQFMKEAGQGSRDMWRAYSDMKKA
FT                   NWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWG
FT                   RSGKDPNHFRPAGLPKRY"
FT   CDS             complement(join(3541238..3541376,3541701..3541839,
FT                   3542773..3542809))
FT                   /codon_start=1
FT                   /gene="Saa3"
FT                   /locus_tag="mCG_147785"
FT                   /product="serum amyloid A 3, isoform CRA_a"
FT                   /note="gene_id=mCG147785.1 transcript_id=mCT194538.0
FT                   protein_id=mCP115567.0 isoform=CRA_a"
FT                   /protein_id="EDL22935.1"
FT                   /translation="MVDSTLPCSWRGGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAA
FT                   RRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
FT                   "
FT   assembly_gap    3551582..3551601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3552929..3552963
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   gene            complement(3557810..3561737)
FT                   /gene="Saa4"
FT                   /locus_tag="mCG_142476"
FT                   /note="gene_id=mCG142476.0"
FT   mRNA            complement(join(3557810..3558845,3559198..3559336,
FT                   3560769..3560863,3561594..3561737))
FT                   /gene="Saa4"
FT                   /locus_tag="mCG_142476"
FT                   /product="serum amyloid A 4"
FT                   /note="gene_id=mCG142476.0 transcript_id=mCT180515.0
FT                   created on 11-FEB-2003"
FT   CDS             complement(join(3558683..3558845,3559198..3559336,
FT                   3560769..3560859))
FT                   /codon_start=1
FT                   /gene="Saa4"
FT                   /locus_tag="mCG_142476"
FT                   /product="serum amyloid A 4"
FT                   /note="gene_id=mCG142476.0 transcript_id=mCT180515.0
FT                   protein_id=mCP103437.0"
FT                   /protein_id="EDL22937.1"
FT                   /translation="MRLATVIVLCSLFLGVSGDGWYSFFREAVQGTWDLWRAYRDNLEA
FT                   NYQNADQYFYARGNYEAQQRGSGGIWAAKIISTSRKYFQGLLNRYYFGIRNHGLETLQA
FT                   TQKAEEWGRSGKNPNHFRPEGLPEKF"
FT   gene            complement(<3569867..>3571685)
FT                   /locus_tag="mCG_142464"
FT                   /note="gene_id=mCG142464.0"
FT   mRNA            complement(join(<3569867..3570005,3570419..3570557,
FT                   3571595..>3571685))
FT                   /locus_tag="mCG_142464"
FT                   /product="mCG142464"
FT                   /note="gene_id=mCG142464.0 transcript_id=mCT180503.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(3569867..3570005,3570419..3570557,
FT                   3571595..3571685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142464"
FT                   /product="mCG142464"
FT                   /note="gene_id=mCG142464.0 transcript_id=mCT180503.0
FT                   protein_id=mCP103425.0"
FT                   /db_xref="GOA:Q5I0U6"
FT                   /db_xref="InterPro:IPR000096"
FT                   /db_xref="MGI:MGI:98221"
FT                   /db_xref="UniProtKB/TrEMBL:Q5I0U6"
FT                   /protein_id="EDL22938.1"
FT                   /translation="MKLLTSLVFCSLLLGVCHGGFFSFVHEAFQGAGDMWRAYTDMKEA
FT                   NWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHG
FT                   RSGKDPNYYRPPGLPDKY"
FT   gene            <3580996..3583477
FT                   /locus_tag="mCG_144019"
FT                   /note="gene_id=mCG144019.0"
FT   mRNA            join(<3580996..3581027,3581452..3581546,3582583..3582721,
FT                   3583136..3583477)
FT                   /locus_tag="mCG_144019"
FT                   /product="mCG144019"
FT                   /note="gene_id=mCG144019.0 transcript_id=mCT183443.0
FT                   created on 04-JUN-2003"
FT   CDS             join(<3580996..3581027,3581452..3581546,3582583..3582721,
FT                   3583136..3583274)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144019"
FT                   /product="mCG144019"
FT                   /note="gene_id=mCG144019.0 transcript_id=mCT183443.0
FT                   protein_id=mCP105449.0"
FT                   /protein_id="EDL22939.1"
FT                   /translation="IDHQICPGDTSRMKLLTSLVFCSLLLGVCHGGFFSFIGEAFQGAG
FT                   DMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHE
FT                   DTMADQEANRHGRSGKDPNYYRPPGLPAKY"
FT   gene            complement(3589633..3629320)
FT                   /locus_tag="mCG_145355"
FT                   /note="gene_id=mCG145355.1"
FT   mRNA            complement(join(3589633..3590615,3592108..3592378,
FT                   3593984..3594090,3596259..3596372,3597198..3597317,
FT                   3598102..3598257,3598458..3598578,3600772..3601346,
FT                   3601637..3601708,3602285..3602434,3603979..3604102,
FT                   3604930..3605116,3606041..3606199,3607186..3607364,
FT                   3608237..3608325,3612308..3612379,3612636..3612848,
FT                   3615675..3615808,3617338..3617530,3622249..3622313,
FT                   3622410..3622520,3624238..3624369,3629228..3629320))
FT                   /locus_tag="mCG_145355"
FT                   /product="mCG145355, transcript variant mCT191769"
FT                   /note="gene_id=mCG145355.1 transcript_id=mCT191769.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3589633..3590615,3592108..3592378,
FT                   3593984..3594090,3596259..3596372,3597198..3597317,
FT                   3598102..3598257,3598458..3598578,3600772..3601346,
FT                   3601637..3601708,3602285..3602434,3603979..3604102,
FT                   3604930..3605116,3606041..3606199,3607186..3607364,
FT                   3608237..3608325,3612308..3612379,3612636..3612848,
FT                   3615675..3615808,3617338..3617530,3622249..3622313,
FT                   3622410..3622520,3624238..3624369,3628749..3628999))
FT                   /locus_tag="mCG_145355"
FT                   /product="mCG145355, transcript variant mCT191768"
FT                   /note="gene_id=mCG145355.1 transcript_id=mCT191768.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3589633..3590615,3592108..3592378,
FT                   3593984..3594090,3596259..3596372,3597198..3597317,
FT                   3598102..3598257,3598458..3598578,3600772..3601346,
FT                   3601637..3601708,3602285..3602434,3603979..3604102,
FT                   3604930..3605116,3606041..3606199,3607186..3607364,
FT                   3608237..3608325,3612308..3612379,3612636..3612848,
FT                   3615675..3615808,3617338..3617530,3622249..3622313,
FT                   3622410..3622520,3624238..3624393,3628749..3628999))
FT                   /locus_tag="mCG_145355"
FT                   /product="mCG145355, transcript variant mCT191767"
FT                   /note="gene_id=mCG145355.1 transcript_id=mCT191767.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(3589633..3590615,3592108..3592378,
FT                   3593984..3594090,3596259..3596372,3597198..3597317,
FT                   3598102..3598257,3598458..3598578,3600772..3601346,
FT                   3601637..3601708,3602285..3602434,3603979..3604102,
FT                   3604319..3604449,3604930..3605116,3606041..3606199,
FT                   3607186..3607364,3608237..3608325,3612308..3612379,
FT                   3612636..3612848,3615675..3615808,3617338..3617530,
FT                   3622249..3622313,3622410..3622520,3624238..3624393,
FT                   3628749..>3628999))
FT                   /locus_tag="mCG_145355"
FT                   /product="mCG145355, transcript variant mCT184779"
FT                   /note="gene_id=mCG145355.1 transcript_id=mCT184779.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3590555..3590615,3592108..3592378,
FT                   3593984..3594090,3596259..3596372,3597198..3597317,
FT                   3598102..3598257,3598458..3598578,3600772..3601346,
FT                   3601637..3601708,3602285..3602434,3603979..3604102,
FT                   3604930..3605116,3606041..3606199,3607186..3607364,
FT                   3608237..3608325,3612308..3612379,3612636..3612848,
FT                   3615675..3615808,3617338..3617530,3622249..3622313,
FT                   3622410..3622520,3624238..3624345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145355"
FT                   /product="mCG145355, isoform CRA_b"
FT                   /note="gene_id=mCG145355.1 transcript_id=mCT191767.0
FT                   protein_id=mCP112697.0 isoform=CRA_b"
FT                   /db_xref="GOA:P59438"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR035431"
FT                   /db_xref="MGI:MGI:2180307"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59438"
FT                   /protein_id="EDL22941.1"
FT                   /translation="MTFVPVIPEAYSHVLAEFESLDPLLTALRLDSSRLRCTSIAVSRK
FT                   WLALGSTGGGLNLIQKDGWKQRLFLSHREGAISQIACCSHDDDYVAVATSQGLVVVWEL
FT                   NQERRGKPERIHVSSEHKGRKVTALCWDTAVLRVFVGDHVGKVSAIKLNTLKQAKAAAA
FT                   FVMFPVQTVLTVDSCVVQLDYLDGRLLVSSLTRSFLCDTEREKFWKIGNKERHGEYGAC
FT                   FFPGRCAGGQQPVIYCARPGSRMWEVNFDGEVLSTHQFKKLLSMPPLPVITARSEPQYD
FT                   HTVGSSQSLAFPKLLHLSEHCVLTWTEKGIYIFIPQNVQVLLWSEVKDIQDVAVYKNEL
FT                   FCLHFNGKISHLSLLSVERCVERLLRRGLWDLAARTCCLFQNSIITSRARKTLTADKLE
FT                   HLKSQLDLTACSELISQLDDLILRFEPLESACSSRRSSISSHESFSILDSGIYRIISSR
FT                   RGSQSDEDSCSLHSQTFSEDERLKEFASHQEEEQPEQGCGANRNEESASHSPVMSEVDK
FT                   SEAFLPFSIALPFRSPSPLVSLQAVKDSVSSFVRKTTEKIGTLHGSPELKEPFESKDAD
FT                   RAHEEEVSAVTCPLEEDTEEKEIHQPPKEDRLQELTAATAEAMTKLLDPLVLFEPKVLR
FT                   MVLLEWLSQLEKTFAMKDFPGISNTSSPTVKSNLGAHLLGETEKRVLDEESGEGRRVSL
FT                   VTEEAGGQITCDPVSNLSEPSADRFRVCSPYAITNSLQRDLAELTTLCLELNVLTSAME
FT                   SVGGHVDRASQQLSPEILACRFLKKYFFLLDLKRAKESIKLTYDSPCVWDTFVEGLKEM
FT                   ARSNPAYTELEEGDLPTGLQLLDGSVPSDSPLLIAFATRLYDRFGESALRACIKFYPSI
FT                   SPSDIAQLCRHHPAQFLAYLDSLVKSRPEDQWPSFLEFLLQPESLRLEWLLLAVSHDAP
FT                   PSTSTVDDEGHPRPHSHLLSWGYSQLILLLIKLPADFTTKEKMTDICRSYGFWPGYLTL
FT                   CLELERRREAFTNIVYLNDISLMEGDNGWIPETLEEWKLLLHLLQTKSTRPAPQESLNG
FT                   SLSDGPAPINVENVALLLAKAMGPDRAWSLLQECGLALELSEKFTRTCDILRIAERRQR
FT                   ALIQGMLEKCDRFLWSQQA"
FT   CDS             complement(join(3590555..3590615,3592108..3592378,
FT                   3593984..3594090,3596259..3596372,3597198..3597317,
FT                   3598102..3598257,3598458..3598578,3600772..3601346,
FT                   3601637..3601708,3602285..3602434,3603979..3604102,
FT                   3604930..3605116,3606041..3606199,3607186..3607364,
FT                   3608237..3608325,3612308..3612379,3612636..3612848,
FT                   3615675..3615808,3617338..3617530,3622249..3622313,
FT                   3622410..3622520,3624238..3624345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145355"
FT                   /product="mCG145355, isoform CRA_b"
FT                   /note="gene_id=mCG145355.1 transcript_id=mCT191768.0
FT                   protein_id=mCP112698.0 isoform=CRA_b"
FT                   /db_xref="GOA:P59438"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR035431"
FT                   /db_xref="MGI:MGI:2180307"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59438"
FT                   /protein_id="EDL22942.1"
FT                   /translation="MTFVPVIPEAYSHVLAEFESLDPLLTALRLDSSRLRCTSIAVSRK
FT                   WLALGSTGGGLNLIQKDGWKQRLFLSHREGAISQIACCSHDDDYVAVATSQGLVVVWEL
FT                   NQERRGKPERIHVSSEHKGRKVTALCWDTAVLRVFVGDHVGKVSAIKLNTLKQAKAAAA
FT                   FVMFPVQTVLTVDSCVVQLDYLDGRLLVSSLTRSFLCDTEREKFWKIGNKERHGEYGAC
FT                   FFPGRCAGGQQPVIYCARPGSRMWEVNFDGEVLSTHQFKKLLSMPPLPVITARSEPQYD
FT                   HTVGSSQSLAFPKLLHLSEHCVLTWTEKGIYIFIPQNVQVLLWSEVKDIQDVAVYKNEL
FT                   FCLHFNGKISHLSLLSVERCVERLLRRGLWDLAARTCCLFQNSIITSRARKTLTADKLE
FT                   HLKSQLDLTACSELISQLDDLILRFEPLESACSSRRSSISSHESFSILDSGIYRIISSR
FT                   RGSQSDEDSCSLHSQTFSEDERLKEFASHQEEEQPEQGCGANRNEESASHSPVMSEVDK
FT                   SEAFLPFSIALPFRSPSPLVSLQAVKDSVSSFVRKTTEKIGTLHGSPELKEPFESKDAD
FT                   RAHEEEVSAVTCPLEEDTEEKEIHQPPKEDRLQELTAATAEAMTKLLDPLVLFEPKVLR
FT                   MVLLEWLSQLEKTFAMKDFPGISNTSSPTVKSNLGAHLLGETEKRVLDEESGEGRRVSL
FT                   VTEEAGGQITCDPVSNLSEPSADRFRVCSPYAITNSLQRDLAELTTLCLELNVLTSAME
FT                   SVGGHVDRASQQLSPEILACRFLKKYFFLLDLKRAKESIKLTYDSPCVWDTFVEGLKEM
FT                   ARSNPAYTELEEGDLPTGLQLLDGSVPSDSPLLIAFATRLYDRFGESALRACIKFYPSI
FT                   SPSDIAQLCRHHPAQFLAYLDSLVKSRPEDQWPSFLEFLLQPESLRLEWLLLAVSHDAP
FT                   PSTSTVDDEGHPRPHSHLLSWGYSQLILLLIKLPADFTTKEKMTDICRSYGFWPGYLTL
FT                   CLELERRREAFTNIVYLNDISLMEGDNGWIPETLEEWKLLLHLLQTKSTRPAPQESLNG
FT                   SLSDGPAPINVENVALLLAKAMGPDRAWSLLQECGLALELSEKFTRTCDILRIAERRQR
FT                   ALIQGMLEKCDRFLWSQQA"
FT   CDS             complement(join(3590555..3590615,3592108..3592378,
FT                   3593984..3594090,3596259..3596372,3597198..3597317,
FT                   3598102..3598257,3598458..3598578,3600772..3601346,
FT                   3601637..3601708,3602285..3602434,3603979..3604102,
FT                   3604930..3605116,3606041..3606199,3607186..3607364,
FT                   3608237..3608325,3612308..3612379,3612636..3612848,
FT                   3615675..3615808,3617338..3617530,3622249..3622313,
FT                   3622410..3622520,3624238..3624345))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145355"
FT                   /product="mCG145355, isoform CRA_b"
FT                   /note="gene_id=mCG145355.1 transcript_id=mCT191769.0
FT                   protein_id=mCP112699.0 isoform=CRA_b"
FT                   /db_xref="GOA:P59438"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR035431"
FT                   /db_xref="MGI:MGI:2180307"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59438"
FT                   /protein_id="EDL22943.1"
FT                   /translation="MTFVPVIPEAYSHVLAEFESLDPLLTALRLDSSRLRCTSIAVSRK
FT                   WLALGSTGGGLNLIQKDGWKQRLFLSHREGAISQIACCSHDDDYVAVATSQGLVVVWEL
FT                   NQERRGKPERIHVSSEHKGRKVTALCWDTAVLRVFVGDHVGKVSAIKLNTLKQAKAAAA
FT                   FVMFPVQTVLTVDSCVVQLDYLDGRLLVSSLTRSFLCDTEREKFWKIGNKERHGEYGAC
FT                   FFPGRCAGGQQPVIYCARPGSRMWEVNFDGEVLSTHQFKKLLSMPPLPVITARSEPQYD
FT                   HTVGSSQSLAFPKLLHLSEHCVLTWTEKGIYIFIPQNVQVLLWSEVKDIQDVAVYKNEL
FT                   FCLHFNGKISHLSLLSVERCVERLLRRGLWDLAARTCCLFQNSIITSRARKTLTADKLE
FT                   HLKSQLDLTACSELISQLDDLILRFEPLESACSSRRSSISSHESFSILDSGIYRIISSR
FT                   RGSQSDEDSCSLHSQTFSEDERLKEFASHQEEEQPEQGCGANRNEESASHSPVMSEVDK
FT                   SEAFLPFSIALPFRSPSPLVSLQAVKDSVSSFVRKTTEKIGTLHGSPELKEPFESKDAD
FT                   RAHEEEVSAVTCPLEEDTEEKEIHQPPKEDRLQELTAATAEAMTKLLDPLVLFEPKVLR
FT                   MVLLEWLSQLEKTFAMKDFPGISNTSSPTVKSNLGAHLLGETEKRVLDEESGEGRRVSL
FT                   VTEEAGGQITCDPVSNLSEPSADRFRVCSPYAITNSLQRDLAELTTLCLELNVLTSAME
FT                   SVGGHVDRASQQLSPEILACRFLKKYFFLLDLKRAKESIKLTYDSPCVWDTFVEGLKEM
FT                   ARSNPAYTELEEGDLPTGLQLLDGSVPSDSPLLIAFATRLYDRFGESALRACIKFYPSI
FT                   SPSDIAQLCRHHPAQFLAYLDSLVKSRPEDQWPSFLEFLLQPESLRLEWLLLAVSHDAP
FT                   PSTSTVDDEGHPRPHSHLLSWGYSQLILLLIKLPADFTTKEKMTDICRSYGFWPGYLTL
FT                   CLELERRREAFTNIVYLNDISLMEGDNGWIPETLEEWKLLLHLLQTKSTRPAPQESLNG
FT                   SLSDGPAPINVENVALLLAKAMGPDRAWSLLQECGLALELSEKFTRTCDILRIAERRQR
FT                   ALIQGMLEKCDRFLWSQQA"
FT   CDS             complement(join(3590555..3590615,3592108..3592378,
FT                   3593984..3594090,3596259..3596372,3597198..3597317,
FT                   3598102..3598257,3598458..3598578,3600772..3601346,
FT                   3601637..3601708,3602285..3602434,3603979..3604102,
FT                   3604319..>3604370))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145355"
FT                   /product="mCG145355, isoform CRA_a"
FT                   /note="gene_id=mCG145355.1 transcript_id=mCT184779.0
FT                   protein_id=mCP105457.0 isoform=CRA_a"
FT                   /protein_id="EDL22940.1"
FT                   /translation="EEISRNSKLPLWLMGIQESASHSPVMSEVDKSEAFLPFSIALPFR
FT                   SPSPLVSLQAVKDSVSSFVRKTTEKIGTLHGSPELKEPFESKDADRAHEEEVSAVTCPL
FT                   EEDTEEKEIHQPPKEDRLQELTAATAEAMTKLLDPLVLFEPKVLRMVLLEWLSQLEKTF
FT                   AMKDFPGISNTSSPTVKSNLGAHLLGETEKRVLDEESGEGRRVSLVTEEAGGQITCDPV
FT                   SNLSEPSADRFRVCSPYAITNSLQRDLAELTTLCLELNVLTSAMESVGGHVDRASQQLS
FT                   PEILACRFLKKYFFLLDLKRAKESIKLTYDSPCVWDTFVEGLKEMARSNPAYTELEEGD
FT                   LPTGLQLLDGSVPSDSPLLIAFATRLYDRFGESALRACIKFYPSISPSDIAQLCRHHPA
FT                   QFLAYLDSLVKSRPEDQWPSFLEFLLQPESLRLEWLLLAVSHDAPPSTSTVDDEGHPRP
FT                   HSHLLSWGYSQLILLLIKLPADFTTKEKMTDICRSYGFWPGYLTLCLELERRREAFTNI
FT                   VYLNDISLMEGDNGWIPETLEEWKLLLHLLQTKSTRPAPQESLNGSLSDGPAPINVENV
FT                   ALLLAKAMGPDRAWSLLQECGLALELSEKFTRTCDILRIAERRQRALIQGMLEKCDRFL
FT                   WSQQA"
FT   assembly_gap    3617928..3617947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3621523..3621542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3629585..3657762
FT                   /gene="Gtf2h1"
FT                   /locus_tag="mCG_142472"
FT                   /note="gene_id=mCG142472.0"
FT   mRNA            join(3629585..3629609,3634999..3635167,3637143..3637335,
FT                   3638287..3638449,3640062..3640155,3641863..3642012,
FT                   3642126..3642205,3645758..3645885,3645988..3646075,
FT                   3647442..3647530,3648626..3648743,3649710..3649800,
FT                   3650223..3650338,3652448..3652540,3656788..3657762)
FT                   /gene="Gtf2h1"
FT                   /locus_tag="mCG_142472"
FT                   /product="general transcription factor II H, polypeptide 1"
FT                   /note="gene_id=mCG142472.0 transcript_id=mCT180511.0
FT                   created on 11-FEB-2003"
FT   CDS             join(3635014..3635167,3637143..3637335,3638287..3638449,
FT                   3640062..3640155,3641863..3642012,3642126..3642205,
FT                   3645758..3645885,3645988..3646075,3647442..3647530,
FT                   3648626..3648743,3649710..3649800,3650223..3650338,
FT                   3652448..3652540,3656788..3656874)
FT                   /codon_start=1
FT                   /gene="Gtf2h1"
FT                   /locus_tag="mCG_142472"
FT                   /product="general transcription factor II H, polypeptide 1"
FT                   /note="gene_id=mCG142472.0 transcript_id=mCT180511.0
FT                   protein_id=mCP103433.0"
FT                   /db_xref="GOA:G3X8R4"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013876"
FT                   /db_xref="InterPro:IPR027079"
FT                   /db_xref="MGI:MGI:1277216"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8R4"
FT                   /protein_id="EDL22944.1"
FT                   /translation="MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISH
FT                   MYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFK
FT                   RKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSTSSHKQDV
FT                   GISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAETVPHNMTEKEFWTR
FT                   FFQSHYFHRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPMLDLTSLEDKPLDEGYG
FT                   ISSVPSTSNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQQAQNGQNGEPSSVDGNSGD
FT                   TDCFQPAVKRAKLQESIEYEDLGNNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDI
FT                   INSFQSIRQEMEAYTPKLTQVLSSSAASSTITALSPGGALMQGGTQQAVNQMVPNDIQS
FT                   ELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLS
FT                   TNLVSHIEEMLQTAYNKLHAWQSRRLMKKT"
FT   gene            complement(3648919..3766926)
FT                   /locus_tag="mCG_147780"
FT                   /note="gene_id=mCG147780.0"
FT   mRNA            complement(join(3648919..3648965,3765342..3766926))
FT                   /locus_tag="mCG_147780"
FT                   /product="mCG147780"
FT                   /note="gene_id=mCG147780.0 transcript_id=mCT188043.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    3652694..3652713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3661239..3661258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3680725..3690508
FT                   /locus_tag="mCG_19938"
FT                   /note="gene_id=mCG19938.2"
FT   mRNA            join(3680725..3680803,3682482..3682631,3683859..3683976,
FT                   3685064..3685237,3685771..3685944,3686759..3686876,
FT                   3688865..3688988,3689859..3690508)
FT                   /locus_tag="mCG_19938"
FT                   /product="mCG19938, transcript variant mCT181736"
FT                   /note="gene_id=mCG19938.2 transcript_id=mCT181736.0 created
FT                   on 04-APR-2003"
FT   mRNA            join(3682099..3682274,3682482..3682631,3683859..3683976,
FT                   3685064..3685237,3685771..3685944,3686759..3686876,
FT                   3688865..3688988,3689859..3690508)
FT                   /locus_tag="mCG_19938"
FT                   /product="mCG19938, transcript variant mCT18322"
FT                   /note="gene_id=mCG19938.2 transcript_id=mCT18322.1 created
FT                   on 04-APR-2003"
FT   CDS             join(3682212..3682274,3682482..3682631,3683859..3683976,
FT                   3685064..3685237,3685771..3685944,3686759..3686876,
FT                   3688865..3688988,3689859..3690023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19938"
FT                   /product="mCG19938, isoform CRA_b"
FT                   /note="gene_id=mCG19938.2 transcript_id=mCT18322.1
FT                   protein_id=mCP5033.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A1B0GSX0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="MGI:MGI:96759"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1B0GSX0"
FT                   /protein_id="EDL22947.1"
FT                   /translation="MSKSSGGYTYTETSVLFFHFKVSKDSKSKMATLKDQLIVNLLKEE
FT                   QAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTP
FT                   KIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLL
FT                   IVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEH
FT                   GDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAI
FT                   GLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPE
FT                   EEARLKKSADTLWGIQKELQF"
FT   CDS             join(3682506..3682631,3683859..3683976,3685064..3685237,
FT                   3685771..3685944,3686759..3686876,3688865..3688988,
FT                   3689859..3690023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19938"
FT                   /product="mCG19938, isoform CRA_a"
FT                   /note="gene_id=mCG19938.2 transcript_id=mCT181736.0
FT                   protein_id=mCP104658.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q564E2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="MGI:MGI:96759"
FT                   /db_xref="UniProtKB/TrEMBL:Q564E2"
FT                   /protein_id="EDL22946.1"
FT                   /translation="MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLA
FT                   DELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGE
FT                   SRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGC
FT                   NLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDA
FT                   DKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLY
FT                   GINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF"
FT   gene            3696137..3712874
FT                   /gene="Ldhc"
FT                   /locus_tag="mCG_19939"
FT                   /note="gene_id=mCG19939.1"
FT   mRNA            join(3696137..3696183,3696644..3696776,3701292..3701409,
FT                   3704482..3704655,3707795..3707968,3710559..3710676,
FT                   3711357..3711480,3712596..3712874)
FT                   /gene="Ldhc"
FT                   /locus_tag="mCG_19939"
FT                   /product="lactate dehydrogenase C"
FT                   /note="gene_id=mCG19939.1 transcript_id=mCT18323.0 created
FT                   on 04-APR-2003"
FT   CDS             join(3696651..3696776,3701292..3701409,3704482..3704655,
FT                   3707795..3707968,3710559..3710676,3711357..3711480,
FT                   3712596..3712760)
FT                   /codon_start=1
FT                   /gene="Ldhc"
FT                   /locus_tag="mCG_19939"
FT                   /product="lactate dehydrogenase C"
FT                   /note="gene_id=mCG19939.1 transcript_id=mCT18323.0
FT                   protein_id=mCP5034.1"
FT                   /db_xref="GOA:Q548Z6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="MGI:MGI:96764"
FT                   /db_xref="UniProtKB/TrEMBL:Q548Z6"
FT                   /protein_id="EDL22948.1"
FT                   /translation="MSTVKEQLIQNLVPEDKLSRCKITVVGVGNVGMACAISILLKGLA
FT                   DELALVDADTNKLRGEALDLLHGSLFLSTPKIVFGKDYNVSANSKLVIITAGARMVSGE
FT                   TRLDLLQRNVAIMKAIVPGIVQNSPDCKIIIVTNPVDILTYVVWKISGFPVGRVIGSGC
FT                   NLDSARFRYLIGEKLGVNPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDS
FT                   DKEHWKNVHKQVVEGGYEVLNMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFH
FT                   GIKEEVFLSIPCVLGQSGITDFVKVNMTAEEEGLLKKSADTLWNMQKDLQL"
FT   assembly_gap    3716052..3716071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3718219..3720879
FT                   /estimated_length=2661
FT                   /gap_type="unknown"
FT   gene            complement(3724538..3755071)
FT                   /locus_tag="mCG_123182"
FT                   /note="gene_id=mCG123182.0"
FT   mRNA            complement(join(3724538..3724868,3726086..3726325,
FT                   3727522..3727724,3736191..3736282,3738686..3738752,
FT                   3742215..3742341,3744092..3744255,3745932..3745997,
FT                   3748555..3748639,3754998..3755071))
FT                   /locus_tag="mCG_123182"
FT                   /product="mCG123182"
FT                   /note="gene_id=mCG123182.0 transcript_id=mCT124412.0
FT                   created on 02-APR-2003"
FT   CDS             complement(join(3724779..3724868,3726086..3726325,
FT                   3727522..3727724,3736191..3736282,3738686..3738752,
FT                   3742215..3742341,3744092..3744255,3745932..3745997,
FT                   3748555..3748639,3754998..3755039))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123182"
FT                   /product="mCG123182"
FT                   /note="gene_id=mCG123182.0 transcript_id=mCT124412.0
FT                   protein_id=mCP63700.1"
FT                   /db_xref="GOA:Q3UCW0"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="MGI:MGI:106581"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UCW0"
FT                   /protein_id="EDL22949.1"
FT                   /translation="MAVSESQLKKMMSKYKYRDLTVRQTVNVIAMYKDLKPVLDSYVFN
FT                   DGSSRELVNLTGTIPVRYRGNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVD
FT                   ANGKIYLPYLHDWKHPRSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTS
FT                   YMPGMPSGISAYPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTTVGPSRDGTI
FT                   SEDTIRASLISAVSDKLRWRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE
FT                   VAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIE
FT                   DTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY"
FT   assembly_gap    3760133..3760152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(3765987..3766142)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147780"
FT                   /product="mCG147780"
FT                   /note="gene_id=mCG147780.0 transcript_id=mCT188043.0
FT                   protein_id=mCP109090.0"
FT                   /protein_id="EDL22945.1"
FT                   /translation="MAPWCSLRAHEHFLAQQCQHQQLWCNMWEFSLLAHPWHHPKEAKQ
FT                   RNLLKP"
FT   gene            complement(3783508..3795964)
FT                   /locus_tag="mCG_19942"
FT                   /note="gene_id=mCG19942.2"
FT   mRNA            complement(join(3783508..3785556,3788336..3788499,
FT                   3792516..3792581,3793110..3793194,3795883..3795964))
FT                   /locus_tag="mCG_19942"
FT                   /product="mCG19942, transcript variant mCT18326"
FT                   /note="gene_id=mCG19942.2 transcript_id=mCT18326.1 created
FT                   on 04-APR-2003"
FT   mRNA            complement(join(3783508..3785556,3788336..3788499,
FT                   3792516..>3793503))
FT                   /locus_tag="mCG_19942"
FT                   /product="mCG19942, transcript variant mCT191797"
FT                   /note="gene_id=mCG19942.2 transcript_id=mCT191797.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3785404..3785556,3788336..3788499,
FT                   3792516..3792581,3793110..3793194,3795883..3795924))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19942"
FT                   /product="mCG19942, isoform CRA_b"
FT                   /note="gene_id=mCG19942.2 transcript_id=mCT18326.1
FT                   protein_id=mCP5043.1 isoform=CRA_b"
FT                   /protein_id="EDL22951.1"
FT                   /translation="MEFDCEGVRRLLGKYKFRDLTVEELKNVSVSFPHFRYSVDTYVFK
FT                   DTSQKDLLNFTGTIPVMYQGKTYNIPIRFWILDSHPFAPPICFLKPTANMEISVGKHVD
FT                   AKGRIYLPYLQNWSHPKSAIVGLIKEMIAKFQEELPLYSIPSSNEAQQVDLLAYITKIT
FT                   EGLYCQ"
FT   CDS             complement(join(3785404..3785556,3788336..3788499,
FT                   3792516..>3792621))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19942"
FT                   /product="mCG19942, isoform CRA_a"
FT                   /note="gene_id=mCG19942.2 transcript_id=mCT191797.0
FT                   protein_id=mCP112705.0 isoform=CRA_a"
FT                   /protein_id="EDL22950.1"
FT                   /translation="SLLLTDILELCLLVFKDTSQKDLLNFTGTIPVMYQGKTYNIPIRF
FT                   WILDSHPFAPPICFLKPTANMEISVGKHVDAKGRIYLPYLQNWSHPKSAIVGLIKEMIA
FT                   KFQEELPLYSIPSSNEAQQVDLLAYITKITEGLYCQ"
FT   gene            3821020..3825205
FT                   /locus_tag="mCG_123190"
FT                   /note="gene_id=mCG123190.0"
FT   mRNA            join(3821020..3821229,3821692..3821793,3824419..3824456,
FT                   3825099..3825205)
FT                   /locus_tag="mCG_123190"
FT                   /product="mCG123190"
FT                   /note="gene_id=mCG123190.0 transcript_id=mCT124433.1
FT                   created on 02-APR-2003"
FT   CDS             join(3821161..3821229,3821692..3821784)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123190"
FT                   /product="mCG123190"
FT                   /note="gene_id=mCG123190.0 transcript_id=mCT124433.1
FT                   protein_id=mCP63479.1"
FT                   /protein_id="EDL22952.1"
FT                   /translation="MIVLGWMLFVGLATYMGTFPEAMPPTLKWKERLPGQENKARRRTQ
FT                   ALEEELLL"
FT   gene            complement(3827810..3846061)
FT                   /gene="Spty2d1"
FT                   /locus_tag="mCG_19949"
FT                   /note="gene_id=mCG19949.1"
FT   mRNA            complement(join(3827810..3830796,3831974..3832051,
FT                   3833426..3833594,3834883..3836415,3837182..3837296,
FT                   3845691..3846061))
FT                   /gene="Spty2d1"
FT                   /locus_tag="mCG_19949"
FT                   /product="SPT2, Suppressor of Ty, domain containing 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG19949.1 transcript_id=mCT18333.1 created
FT                   on 04-APR-2003"
FT   CDS             complement(join(3830703..3830796,3831974..3832051,
FT                   3833426..3833594,3834883..3836415,3837182..3837296,
FT                   3845691..3845750))
FT                   /codon_start=1
FT                   /gene="Spty2d1"
FT                   /locus_tag="mCG_19949"
FT                   /product="SPT2, Suppressor of Ty, domain containing 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG19949.1 transcript_id=mCT18333.1
FT                   protein_id=mCP5022.2"
FT                   /protein_id="EDL22953.1"
FT                   /translation="MDFREILLIASKGQGVNHVPKRYSLAVGPPKKDPKVKGVQSAAVQ
FT                   AFLRRKEEELRQKALEEKKRKEELVKKRIELKHDKKARAMAKRTKDNFHGYDGIPVEEK
FT                   TKKKQLVESHLNQGTDQEYDVEEEDFIDYNQAELDQDYEEEQEPPKAESKPKAPLKSAP
FT                   SPMNFTDLLRLAEKKQFEPVEIKVVKKAEDRPLTAEELREREFLERKHRKKKPEPDAKL
FT                   PPPVLKKAPSHKDIMGTKPSRGAGDRQLASKGLPFPQAEKKFRPSTASEKQAALSSPKS
FT                   LPGERTKVGSGSSTQPSLREGHNRPVFNGAGKPRPSTCSPSVPKTPASGTQKSASEHKA
FT                   KKPLPSHPSHSKPGPTVLSHNKSKSPGVRQPGSNSGSAPGQPNPGTARPTLSSGPVPRR
FT                   QNGSSSSGPEQSAGGIRKLASNSHLSGRTLNGTNGPGRPASSSSGPGRPISGSAGSGRP
FT                   VGSSGGPGQPVNNPHDLRRPMNSLSSPGRAVSGPGRSISGSIPAGRTVNSGPGRPVSSL
FT                   GPGRAVSNPGLPTKPRCTVVSETISSKNIISRSSNGQINGMKPLLSGYRSAQGPQRLPF
FT                   PTGYKRPREYEEDDDDEYDSEMDDFIEDEGEPQEEISKHIREIFGYDRKKYKDESDYAL
FT                   RYMESSWKEQQKEEAKSLRLGMQEDLEEMRREEEELKRRKAKKLKRH"
FT   assembly_gap    3854047..3854230
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    3866955..3867043
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    3876977..3877189
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   gene            3887757..3891985
FT                   /gene="Tmem86a"
FT                   /locus_tag="mCG_50019"
FT                   /note="gene_id=mCG50019.1"
FT   mRNA            join(3887757..3888022,3890060..3890324,3890623..3891985)
FT                   /gene="Tmem86a"
FT                   /locus_tag="mCG_50019"
FT                   /product="transmembrane protein 86A"
FT                   /note="gene_id=mCG50019.1 transcript_id=mCT50202.1 created
FT                   on 08-APR-2003"
FT   CDS             join(3888002..3888022,3890060..3890324,3890623..3891062)
FT                   /codon_start=1
FT                   /gene="Tmem86a"
FT                   /locus_tag="mCG_50019"
FT                   /product="transmembrane protein 86A"
FT                   /note="gene_id=mCG50019.1 transcript_id=mCT50202.1
FT                   protein_id=mCP27908.2"
FT                   /protein_id="EDL22954.1"
FT                   /translation="MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSALIKCL
FT                   PIFCLWLFLLAHGVRFLLAHPSASLIFVGLVFSAVGDAFLIWQDHGYFEHGLLMFAVAH
FT                   ILYAAAFGMRPLALRTGLVIGVLSGLCYALLYPGLSGAFTYLVGVYVALISFMGWRAMA
FT                   GLRLVGAAWRWTELAAGGGALLFILSDLTIALNKFCFPVPYSRALIMSTYYAAQMLIAL
FT                   SAVESREPVGEDYRLSKAD"
FT   assembly_gap    3907989..3908008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3914956..3914975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3915220..3971121)
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /note="gene_id=mCG2895.1"
FT   mRNA            complement(join(3915220..3916336,3916664..3916777,
FT                   3916865..3917025,3919281..3919391,3920179..3920316,
FT                   3920504..3920583,3923459..3923543,3925908..3926097,
FT                   3927195..3927436,3927839..3927922,3928145..3928252,
FT                   3928795..3928988,3950140..3950216,3970688..3971121))
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   5, transcript variant mCT2483"
FT                   /note="gene_id=mCG2895.1 transcript_id=mCT2483.1 created on
FT                   08-APR-2003"
FT   mRNA            complement(join(3915220..3916336,3916664..3916777,
FT                   3916865..3917025,3919281..3919391,3920179..3920316,
FT                   3920504..3920583,3923459..3923543,3925908..3926097,
FT                   3927195..3927436,3927839..3927922,3928145..3928988,
FT                   3950140..3950216,3969710..>3969758))
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   5, transcript variant mCT191795"
FT                   /note="gene_id=mCG2895.1 transcript_id=mCT191795.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3915223..3916336,3916664..3916777,
FT                   3916865..3917025,3919281..3919391,3920179..3920316,
FT                   3920504..3920583,3923459..3923543,3925908..3926097,
FT                   3927195..3927436,3927839..3927922,3928145..3928252,
FT                   3928795..3928988,3950140..3950216,3969710..>3969807))
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   5, transcript variant mCT191796"
FT                   /note="gene_id=mCG2895.1 transcript_id=mCT191796.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3916243..3916336,3916664..3916777,
FT                   3916865..3917025,3919281..3919391,3920179..3920316,
FT                   3920504..3920583,3923459..3923543,3925908..3926097,
FT                   3927195..3927436,3927839..3927922,3928145..3928252,
FT                   3928795..3928988,3950140..3950216,3969710..>3969807))
FT                   /codon_start=1
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   5, isoform CRA_c"
FT                   /note="gene_id=mCG2895.1 transcript_id=mCT191796.0
FT                   protein_id=mCP112755.0 isoform=CRA_c"
FT                   /protein_id="EDL22957.1"
FT                   /translation="HTQTGTHADTHTRALTSSRQPACPPAPGARSGRSERESQAADDSE
FT                   GGTLDMCCSERLLGLPQPVEMEAPDEAEGLPSKQKEMPPPPPPSPPSEPAQKLPPQGAG
FT                   SHSLTVRSSLCLFAASQFLLACGVLWLSGHGHSWLQNTTDLISSSLTVLNHLGPVAWLG
FT                   SGTWGIPSLLLVSLTVSLVIVTTLVWHLLKAPPEPPAPLPPEDRRQSVSRQPSFTYSEW
FT                   MEEKVEDDFLDLDAVPETPVFDCVMDIKPETDPASLTVKSMGLQERRGSNVSLTLDMCT
FT                   PGCNEEGFGYLVSPREESAHEYLLSASRVLRAEELHEKALDPFLLQAEFFEIPMNFVDP
FT                   KEYDIPGLVRKNRYKTILPNPHSRVRLTSPDPEDPLSSYINANYIRGYSGEEKVYIATQ
FT                   GPIVSTVADFWRMVWQERTPIIVMITNIEEMNEKCTEYWPEEQVVHDGVEITVQKVIHT
FT                   EDYRLRLISLRRGTEERSLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCSP
FT                   IIVHCSAGIGRTGCFIATSICCQQLRREGVVDILKTTCQLRQDRGGMIQTCEQYQFVHH
FT                   AMSLYEKQLSLQSSE"
FT   CDS             complement(join(3916243..3916336,3916664..3916777,
FT                   3916865..3917025,3919281..3919391,3920179..3920316,
FT                   3920504..3920583,3923459..3923543,3925908..3926097,
FT                   3927195..3927436,3927839..3927922,3928145..3928252,
FT                   3928795..3928988,3950140..3950164))
FT                   /codon_start=1
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   5, isoform CRA_d"
FT                   /note="gene_id=mCG2895.1 transcript_id=mCT2483.1
FT                   protein_id=mCP5041.1 isoform=CRA_d"
FT                   /db_xref="GOA:P54830"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR008356"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016334"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:97807"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54830"
FT                   /protein_id="EDL22958.1"
FT                   /translation="MCCSERLLGLPQPVEMEAPDEAEGLPSKQKEMPPPPPPSPPSEPA
FT                   QKLPPQGAGSHSLTVRSSLCLFAASQFLLACGVLWLSGHGHSWLQNTTDLISSSLTVLN
FT                   HLGPVAWLGSGTWGIPSLLLVSLTVSLVIVTTLVWHLLKAPPEPPAPLPPEDRRQSVSR
FT                   QPSFTYSEWMEEKVEDDFLDLDAVPETPVFDCVMDIKPETDPASLTVKSMGLQERRGSN
FT                   VSLTLDMCTPGCNEEGFGYLVSPREESAHEYLLSASRVLRAEELHEKALDPFLLQAEFF
FT                   EIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVRLTSPDPEDPLSSYINANYIRGYSG
FT                   EEKVYIATQGPIVSTVADFWRMVWQERTPIIVMITNIEEMNEKCTEYWPEEQVVHDGVE
FT                   ITVQKVIHTEDYRLRLISLRRGTEERSLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAA
FT                   QQEGPHCSPIIVHCSAGIGRTGCFIATSICCQQLRREGVVDILKTTCQLRQDRGGMIQT
FT                   CEQYQFVHHAMSLYEKQLSLQSSE"
FT   CDS             complement(join(3916243..3916336,3916664..3916777,
FT                   3916865..3917025,3919281..3919391,3920179..3920316,
FT                   3920504..3920583,3923459..3923543,3925908..3926097,
FT                   3927195..3927436,3927839..3927922,3928145..>3928303))
FT                   /codon_start=1
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   5, isoform CRA_b"
FT                   /note="gene_id=mCG2895.1 transcript_id=mCT191795.0
FT                   protein_id=mCP112754.0 isoform=CRA_b"
FT                   /protein_id="EDL22956.1"
FT                   /translation="GQRAAAVHSVCASQLPQLACGVLWLSGHGHSWLQNTTDLISSSLT
FT                   VLNHLGPVAWLGSGTWGIPSLLLVSLTVSLVIVTTLVWHLLKAPPEPPAPLPPEDRRQS
FT                   VSRQPSFTYSEWMEEKVEDDFLDLDAVPETPVFDCVMDIKPETDPASLTVKSMGLQERR
FT                   GSNVSLTLDMCTPGCNEEGFGYLVSPREESAHEYLLSASRVLRAEELHEKALDPFLLQA
FT                   EFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVRLTSPDPEDPLSSYINANYIRG
FT                   YSGEEKVYIATQGPIVSTVADFWRMVWQERTPIIVMITNIEEMNEKCTEYWPEEQVVHD
FT                   GVEITVQKVIHTEDYRLRLISLRRGTEERSLKHYWFTSWPDQKTPDRAPPLLHLVREVE
FT                   EAAQQEGPHCSPIIVHCSAGIGRTGCFIATSICCQQLRREGVVDILKTTCQLRQDRGGM
FT                   IQTCEQYQFVHHAMSLYEKQLSLQSSE"
FT   mRNA            complement(join(3919872..3920583,3923459..3923543,
FT                   3925908..3926097,3927195..3927436,3927839..3927922,
FT                   3928145..3928252,3928795..3928988,3950140..3950216,
FT                   3970688..>3970869))
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   5, transcript variant mCT191794"
FT                   /note="gene_id=mCG2895.1 transcript_id=mCT191794.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3920471..3920583,3923459..3923543,
FT                   3925908..3926097,3927195..3927436,3927839..3927922,
FT                   3928145..3928252,3928795..3928988,3950140..3950216,
FT                   3970688..>3970713))
FT                   /codon_start=1
FT                   /gene="Ptpn5"
FT                   /locus_tag="mCG_2895"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   5, isoform CRA_a"
FT                   /note="gene_id=mCG2895.1 transcript_id=mCT191794.0
FT                   protein_id=mCP112753.0 isoform=CRA_a"
FT                   /protein_id="EDL22955.1"
FT                   /translation="NVRNKPRRRSERESQAADDSEGGTLDMCCSERLLGLPQPVEMEAP
FT                   DEAEGLPSKQKEMPPPPPPSPPSEPAQKLPPQGAGSHSLTVRSSLCLFAASQFLLACGV
FT                   LWLSGHGHSWLQNTTDLISSSLTVLNHLGPVAWLGSGTWGIPSLLLVSLTVSLVIVTTL
FT                   VWHLLKAPPEPPAPLPPEDRRQSVSRQPSFTYSEWMEEKVEDDFLDLDAVPETPVFDCV
FT                   MDIKPETDPASLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLVSPREESAHEYLL
FT                   SASRVLRAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSR
FT                   VRLTSPDPEDPLSSYINANYIRVCSSIPRAFH"
FT   gene            <3948268..3963423
FT                   /locus_tag="mCG_144714"
FT                   /note="gene_id=mCG144714.0"
FT   mRNA            join(<3948268..3948298,3948789..3948997,3961556..3963423)
FT                   /locus_tag="mCG_144714"
FT                   /product="mCG144714"
FT                   /note="gene_id=mCG144714.0 transcript_id=mCT184138.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<3948269..3948298,3948789..3948997,3961556..3961631)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144714"
FT                   /product="mCG144714"
FT                   /note="gene_id=mCG144714.0 transcript_id=mCT184138.0
FT                   protein_id=mCP105454.0"
FT                   /protein_id="EDL22959.1"
FT                   /translation="HRTRPRTFIKHLNASSDGALISLLWNHQLDDWTTLKVRKLSSSPR
FT                   GPPSFLPTCWTYAITLKYEGWICHPTLPSTRWPFRAHLSACFLQELSPSEAAACNLGSE
FT                   "
FT   gene            complement(3979589..3981760)
FT                   /locus_tag="mCG_147778"
FT                   /note="gene_id=mCG147778.0"
FT   mRNA            complement(join(3979589..3980058,3981680..3981760))
FT                   /locus_tag="mCG_147778"
FT                   /product="mCG147778"
FT                   /note="gene_id=mCG147778.0 transcript_id=mCT188041.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(3979804..3980058,3981680..3981694))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147778"
FT                   /product="mCG147778"
FT                   /note="gene_id=mCG147778.0 transcript_id=mCT188041.0
FT                   protein_id=mCP109087.0"
FT                   /protein_id="EDL22960.1"
FT                   /translation="MEQVEIEVALIIGWRSLFQPWAWAKAEIYNIPKHREGTAEFSTAK
FT                   QKSISLTPKPRNISEEERKGCKSWRVERTFIKCCHLSITQLLQL"
FT   assembly_gap    3993803..3994550
FT                   /estimated_length=748
FT                   /gap_type="unknown"
FT   assembly_gap    4010599..4010618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4016659..4017432
FT                   /estimated_length=774
FT                   /gap_type="unknown"
FT   assembly_gap    4024188..4024207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4030809..4030828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4038521..4038640
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    4051705..4051724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4059033..4062732
FT                   /estimated_length=3700
FT                   /gap_type="unknown"
FT   assembly_gap    4077027..4077772
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   assembly_gap    4097936..4098408
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    4111569..4112042
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    4123704..4123879
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    4157738..4157792
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   gene            complement(4170339..4189670)
FT                   /gene="Mrgpra1"
FT                   /locus_tag="mCG_142446"
FT                   /note="gene_id=mCG142446.0"
FT   mRNA            complement(join(4170339..4171382,4189627..4189670))
FT                   /gene="Mrgpra1"
FT                   /locus_tag="mCG_142446"
FT                   /product="MAS-related GPR, member A1"
FT                   /note="gene_id=mCG142446.0 transcript_id=mCT180484.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(4170398..4171382,4189627..4189637))
FT                   /codon_start=1
FT                   /gene="Mrgpra1"
FT                   /locus_tag="mCG_142446"
FT                   /product="MAS-related GPR, member A1"
FT                   /note="gene_id=mCG142446.0 transcript_id=mCT180484.0
FT                   protein_id=mCP103406.0"
FT                   /db_xref="GOA:G3UW97"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026233"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:3033095"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW97"
FT                   /protein_id="EDL22961.1"
FT                   /translation="MGESSTCAGFLALNTSASPTAPTTTNPMDNTIPGGINITILIPNL
FT                   MIIIFGLVGLTGNGIVFWLLGFCLHRNAFSVYILNLALADFFFLLGHIIDSILLLLNVF
FT                   YPITFLLCFYTIMMVLYIAGLSMLSAISTERCLSVLCPIWYHCHRPEHTSTVMCAVIWV
FT                   LSLLICILNSYFCGFLNTQYKNENGCLALSFFTAAYLMFLFVVLCLSSLALVARLFCGT
FT                   GQIKLTRLYVTIILSILVFLLCGLPFGIHWFLLFKIKDDFHVFDLGFYLASVVLTAINS
FT                   CANPIIYFFVGSFRHRLKHQTLKMVLQNALQDTPETAKIMVEMSRSKSEP"
FT   assembly_gap    4186644..4186663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4190551..4190570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4239429..4239448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4250024..4250043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4250999..4251018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4253928..4253947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4257063..4262836
FT                   /estimated_length=5774
FT                   /gap_type="unknown"
FT   assembly_gap    4271332..4290192
FT                   /estimated_length=18861
FT                   /gap_type="unknown"
FT   assembly_gap    4294880..4295335
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    4298737..4298756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4316157..4320984
FT                   /estimated_length=4828
FT                   /gap_type="unknown"
FT   assembly_gap    4327210..4329753
FT                   /estimated_length=2544
FT                   /gap_type="unknown"
FT   assembly_gap    4365843..4367904
FT                   /estimated_length=2062
FT                   /gap_type="unknown"
FT   assembly_gap    4371999..4372018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4373367..4397303
FT                   /estimated_length=23937
FT                   /gap_type="unknown"
FT   gene            complement(4404282..4416815)
FT                   /gene="Mrgpra3"
FT                   /locus_tag="mCG_142445"
FT                   /note="gene_id=mCG142445.0"
FT   mRNA            complement(join(4404282..4405497,4416738..4416815))
FT                   /gene="Mrgpra3"
FT                   /locus_tag="mCG_142445"
FT                   /product="MAS-related GPR, member A3"
FT                   /note="gene_id=mCG142445.0 transcript_id=mCT180483.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(4404519..4405497,4416738..4416748))
FT                   /codon_start=1
FT                   /gene="Mrgpra3"
FT                   /locus_tag="mCG_142445"
FT                   /product="MAS-related GPR, member A3"
FT                   /note="gene_id=mCG142445.0 transcript_id=mCT180483.0
FT                   protein_id=mCP103405.0"
FT                   /db_xref="GOA:H3BKL3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026233"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:2684085"
FT                   /db_xref="UniProtKB/TrEMBL:H3BKL3"
FT                   /protein_id="EDL22962.1"
FT                   /translation="MGESNTSAGFLARNTSASTMTPTTTNSMNETIPGSIDIETLIPDL
FT                   MIIIFGLVGLTGNAIVFWLLGFRMHRTAFLVYILNLALADFLFLLCHIINSTVDLLKFT
FT                   LPKGIFAFCFHTIKRVLYITGLSMLSAISTERCLSVLCPIWYHCRRPEHTSTVMCAVIW
FT                   VLSLLICILDGYFCGYLDNHYFNYSVCQAWDIFIGAYLMFLFVVLCLSTLALLARLFCG
FT                   ARNMKFTRLFVTIMLTVLVFLLCGLPWGITWFLLFWIAPGVFVLDYSPLLVLTAINSCA
FT                   NPIIYFFVGSFRQRLNKQTLKMVLQKALQDTPETPENMVEMSRNKAEP"
FT   assembly_gap    4409371..4409967
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    4434184..4434484
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    4441526..4442043
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    4447346..4447365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4459600..4459619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4471823..4471996
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    4484291..4484310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4496959..4497114
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    4498887..4498925
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4509495..4509654
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    4529879..4530016
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    4548830..4548849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4568050..4568069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4614653..4614732
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    4616138..4620480
FT                   /estimated_length=4343
FT                   /gap_type="unknown"
FT   assembly_gap    4628175..4628368
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    4642189..4642223
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    4665837..4667055
FT                   /estimated_length=1219
FT                   /gap_type="unknown"
FT   assembly_gap    4684431..4684593
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    4695828..4695847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4703964..4704153
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    4718089..4718360
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    4738087..4738176
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    4742548..4742567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4792324..4793826)
FT                   /gene="Mrgpra8"
FT                   /locus_tag="mCG_142447"
FT                   /note="gene_id=mCG142447.0"
FT   mRNA            complement(4792324..4793826)
FT                   /gene="Mrgpra8"
FT                   /locus_tag="mCG_142447"
FT                   /product="MAS-related GPR, member A8"
FT                   /note="gene_id=mCG142447.0 transcript_id=mCT180485.0
FT                   created on 12-FEB-2003"
FT   CDS             complement(4792440..4793381)
FT                   /codon_start=1
FT                   /gene="Mrgpra8"
FT                   /locus_tag="mCG_142447"
FT                   /product="MAS-related GPR, member A8"
FT                   /note="gene_id=mCG142447.0 transcript_id=mCT180485.0
FT                   protein_id=mCP103407.0"
FT                   /db_xref="GOA:Q91WW2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026233"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:3033100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91WW2"
FT                   /protein_id="EDL22963.1"
FT                   /translation="MAPTTTNPMNETIPGSIDIETLIPNLMIIIFGLVGLTGNVILFWL
FT                   LGFHLHRNAFLVYILNLALADFLFLLCHIINSTMLLLKVHLPNNILNHCFDIIMTVLYI
FT                   TGLSMLSAISTERCLSVLCPIWYRCRRPEHTSTVLCAVIWFLPLLICILNGYFCHFFGP
FT                   KYVIDSVCLATNFFIRTYPMFLFIVLCLSTLALLARLFCGAGKTKFTRLFVTIMLTVLV
FT                   FLLCGLPLGFFWFLVPWINRDFSVLDYILFQTSLVLTSVNSCANPIIYFFVGSFRHRLK
FT                   HKTLKMVLQSALQDTPETPENMVEMSRSKAEP"
FT   assembly_gap    4814703..4814757
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    4822901..4822920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4831171..4831190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4855069..4856273
FT                   /estimated_length=1205
FT                   /gap_type="unknown"
FT   assembly_gap    4869939..4869958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4934402..4936638
FT                   /estimated_length=2237
FT                   /gap_type="unknown"
FT   gene            complement(4937980..4939200)
FT                   /locus_tag="mCG_142419"
FT                   /note="gene_id=mCG142419.0"
FT   mRNA            complement(4937980..4939200)
FT                   /locus_tag="mCG_142419"
FT                   /product="mCG142419"
FT                   /note="gene_id=mCG142419.0 transcript_id=mCT180457.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(4938313..4938729)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142419"
FT                   /product="mCG142419"
FT                   /note="gene_id=mCG142419.0 transcript_id=mCT180457.0
FT                   protein_id=mCP103379.0"
FT                   /protein_id="EDL22964.1"
FT                   /translation="MGNSHSVTTALHSVLKQRQIKVSTRTLETFIREIERISPWYACSG
FT                   SLTLSSWEKLREDLAKEQQNGKLKAGTMPLWKLVRSCLEDERCLPAIITGQEILEEAQD
FT                   SMAETEWCERLRALKKENVHKRKKALPETLSQRK"
FT   assembly_gap    4941646..4941665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4942938..4942957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4945937..4945956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4948303..4948322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4950439..4950458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4957218..4958583
FT                   /estimated_length=1366
FT                   /gap_type="unknown"
FT   assembly_gap    4960059..4960078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5020897..5020916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5022766..5022785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5060225..5060244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5062481..5066105
FT                   /estimated_length=3625
FT                   /gap_type="unknown"
FT   assembly_gap    5096887..5096906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5108339..5108358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5145755..5145832
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    5172609..5174941
FT                   /estimated_length=2333
FT                   /gap_type="unknown"
FT   assembly_gap    5189958..5190646
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    5204084..5204103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5206781..5212170
FT                   /estimated_length=5390
FT                   /gap_type="unknown"
FT   assembly_gap    5213182..5213201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5214389..5214707
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    5218386..5218405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5229920..5229959
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5264684..5264750
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    5288401..5288423
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    5346616..5346635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5351523..5358642)
FT                   /gene="Mrgprb2"
FT                   /locus_tag="mCG_147782"
FT                   /note="gene_id=mCG147782.0"
FT   mRNA            complement(join(5351523..5353534,5358580..5358642))
FT                   /gene="Mrgprb2"
FT                   /locus_tag="mCG_147782"
FT                   /product="MAS-related GPR, member B2"
FT                   /note="gene_id=mCG147782.0 transcript_id=mCT188045.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5352514..5353530)
FT                   /codon_start=1
FT                   /gene="Mrgprb2"
FT                   /locus_tag="mCG_147782"
FT                   /product="MAS-related GPR, member B2"
FT                   /note="gene_id=mCG147782.0 transcript_id=mCT188045.0
FT                   protein_id=mCP109092.0"
FT                   /db_xref="GOA:W8W3G3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:2441674"
FT                   /db_xref="UniProtKB/TrEMBL:W8W3G3"
FT                   /protein_id="EDL22965.1"
FT                   /translation="MSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSI
FT                   IISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSI
FT                   DINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVM
FT                   SLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQR
FT                   IPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCM
FT                   NPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS"
FT   assembly_gap    5371665..5371684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5399901..5399920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5401013..5401107
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    5403657..5410125
FT                   /estimated_length=6469
FT                   /gap_type="unknown"
FT   assembly_gap    5429997..5430016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5435933..5435967
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    5498217..5501094
FT                   /estimated_length=2878
FT                   /gap_type="unknown"
FT   assembly_gap    5518222..5518241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5526943..5527217
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   gene            5587970..5626433
FT                   /gene="Zdhhc13"
FT                   /locus_tag="mCG_142458"
FT                   /note="gene_id=mCG142458.0"
FT   mRNA            join(5587970..5588104,5594868..5595013,5598796..5598918,
FT                   5600274..5600351,5601883..5602027,5603317..5603381,
FT                   5604157..5604319,5604536..5604661,5607759..5607892,
FT                   5610291..5610397,5614424..5614542,5615386..5615448,
FT                   5616112..5616205,5617603..5617686,5621536..5621693,
FT                   5623630..5623727,5625865..5626433)
FT                   /gene="Zdhhc13"
FT                   /locus_tag="mCG_142458"
FT                   /product="zinc finger, DHHC domain containing 13"
FT                   /note="gene_id=mCG142458.0 transcript_id=mCT180497.0
FT                   created on 13-FEB-2003"
FT   CDS             join(5588078..5588104,5594868..5595013,5598796..5598918,
FT                   5600274..5600351,5601883..5602027,5603317..5603381,
FT                   5604157..5604319,5604536..5604661,5607759..5607892,
FT                   5610291..5610397,5614424..5614542,5615386..5615448,
FT                   5616112..5616205,5617603..5617686,5621536..5621693,
FT                   5623630..5623727,5625865..5626003)
FT                   /codon_start=1
FT                   /gene="Zdhhc13"
FT                   /locus_tag="mCG_142458"
FT                   /product="zinc finger, DHHC domain containing 13"
FT                   /note="gene_id=mCG142458.0 transcript_id=mCT180497.0
FT                   protein_id=mCP103419.0"
FT                   /protein_id="EDL22966.1"
FT                   /translation="MEGPGLGSQCRNHSHGSHVPGFGRHGICVHENKELAKAKEILPLI
FT                   EDSSNCDIVKATQYGIFERCKELVEAGYDVRQPDRENVSLLHWAAINNRLELVKFYISK
FT                   GAVIDQLGGDLNSTPLHWAIRQGHLPMVILLLQHGADPTLIDGEGFSSIHLAVLFQHMP
FT                   IIAYLISKGQSVNMTDVNGQTPLMLSAYKVIGPEPTGFLLKFNPSLSVVDKTHQNTPLH
FT                   WAVAAGNVSAVDKLLEAGSSLDIRNAKGETPLDMALQSKNQLISHMLRTEAKMRANKQF
FT                   RLWRWLHKCELFLLLILSMITLWAVGYILDFNSDSWLLKGCLLVALFFLTSLFPRFLVG
FT                   YKNLVYLPTVFLLSSIFWIFMTWFILFFPDIPGSPLYFAFIFSIMAFLYFFYKTWATDP
FT                   GFTKASEEERKVNIVTLAETGSLDFRTFCTSCLIRKPLRSLHCHVCNSCVARFDQHCFW
FT                   TGRCIGFGNHHHYIFFLLSLSMVCDWIIYGSFVYWSNHCATTFKEDGLWTYLNQIVACS
FT                   PWVLYIFMLAAFHFSWSTFLLINQLFQIAFLGLTSHERISLLKQSRHMKQTLSLRKTPY
FT                   NLGFTQNLADFFQCGCFGLVKPCIIDWTSQYTMVFHPAKEKVLRSV"
FT   assembly_gap    5629330..5629349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5629520..5646983)
FT                   /gene="Csrp3"
FT                   /locus_tag="mCG_142477"
FT                   /note="gene_id=mCG142477.0"
FT   mRNA            complement(join(5629520..5629666,5631522..5631615,
FT                   5632699..5632831,5634427..5634595,5638381..5638518,
FT                   5646954..5646983))
FT                   /gene="Csrp3"
FT                   /locus_tag="mCG_142477"
FT                   /product="cysteine and glycine-rich protein 3"
FT                   /note="gene_id=mCG142477.0 transcript_id=mCT180516.0
FT                   created on 12-FEB-2003"
FT   CDS             complement(join(5629590..5629666,5631522..5631615,
FT                   5632699..5632831,5634427..5634595,5638381..5638492))
FT                   /codon_start=1
FT                   /gene="Csrp3"
FT                   /locus_tag="mCG_142477"
FT                   /product="cysteine and glycine-rich protein 3"
FT                   /note="gene_id=mCG142477.0 transcript_id=mCT180516.0
FT                   protein_id=mCP103438.0"
FT                   /db_xref="GOA:Q545C7"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="MGI:MGI:1330824"
FT                   /db_xref="UniProtKB/TrEMBL:Q545C7"
FT                   /protein_id="EDL22967.1"
FT                   /translation="MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALD
FT                   STTVAAHESEIYCKVCYGRRYGPKGIGFGQGAGCLSTDTGEHLGLQFQQSPKPARAATT
FT                   SNPSKFSAKFGESEKCPRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKD
FT                   GELYCKVCYAKNFGPTGIGFGGLTQQVEKKE"
FT   assembly_gap    5651321..5651340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5665446..>5679982)
FT                   /gene="E2f8"
FT                   /locus_tag="mCG_145994"
FT                   /note="gene_id=mCG145994.0"
FT   mRNA            complement(join(5665446..5666214,5666639..5667024,
FT                   5667144..5667276,5669676..5670201,5670798..5670885,
FT                   5671071..5671271,5672246..5672383,5673953..5674114,
FT                   5674438..5674752,5676923..5677079,5677406..5677684,
FT                   5679259..5679382,5679642..>5679982))
FT                   /gene="E2f8"
FT                   /locus_tag="mCG_145994"
FT                   /product="E2F transcription factor 8"
FT                   /note="gene_id=mCG145994.0 transcript_id=mCT186102.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(5666032..5666214,5666639..5667024,
FT                   5667144..5667276,5669676..5670201,5670798..5670885,
FT                   5671071..5671271,5672246..5672383,5673953..5674114,
FT                   5674438..5674752,5676923..5677079,5677406..5677684,
FT                   5679259..>5679285))
FT                   /codon_start=1
FT                   /gene="E2f8"
FT                   /locus_tag="mCG_145994"
FT                   /product="E2F transcription factor 8"
FT                   /note="gene_id=mCG145994.0 transcript_id=mCT186102.0
FT                   protein_id=mCP107393.0"
FT                   /protein_id="EDL22968.1"
FT                   /translation="GIDKMENQKENLFSEPHKRGLMKSPLHPSSKANMVLAEIQPDLGP
FT                   LTTPTKPKEVSQGEPWTPTANLKMLISAVSPEIRSRDQKRGLSDNRSALPEARDCLHEH
FT                   LSGDEFEKSQPSRKEKSLGLLCHKFLARYPKYPNPAVNNDICLDEVAEELNVERRRIYD
FT                   IVNVLESLHMVSRLAKNRYTWHGRHNLTKTLGTLKSVGEENKYAEQIMMIKRKEYEQEF
FT                   DFIKSCGIEDHVIKSHTGQNGHSDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLF
FT                   LVSTPQIVSLEIAAKILIGEDHVEDLDKSKYKTKIRRLYDIANVLSSLDLIKKVHVTEE
FT                   RGRKPAFKWTGPEISPNNSGSSPIMPLPASLEAEQSAKENCAKNLFSTRGKPSFTRHPS
FT                   LIKLVKSIENDRRKISSAPSSPVKSNKAESSQNSPPVPNKMAQLAAICKMQLEEQSSEP
FT                   RKKVKVNLARSGHYKPLAPLDPTVNTELELLTPSLIQPLGVVPLIPSPLSSAVPVILPQ
FT                   APSGPSYAIYLQPAQAQMLTPPPGLSPTVCPTQPSNATGSKDPTDAPAEKTATDAATTG
FT                   SLQPAPERHGAKHRSKETTGDRGTKRMITAEDSGPSSVKKPKEDLKALENVPTPTPLFP
FT                   SGYLIPLTQCSSLGPDSVLSNTENSGTPSPNHRIYGSPIAGVIPVASSELTAVNFPPFH
FT                   VTPLKLMVSPTSMAAVPVGNSPALNSGHPAPAQNPSSAIVNFTLQHLGLISPGVQMSAS
FT                   PGPGAGTVPVSPRVEADNLSSRQRRATNHDSPVLGQSQLNGQPVAGTGAQQPVPVTPKG
FT                   SQLVAENFFRTPGGPTKPTSSPYTDFDGANKTSFGTLFVPQRKLEVSTEDIH"
FT   assembly_gap    5680506..5680624
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    5687349..5687368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5697852..5712066
FT                   /locus_tag="mCG_1051029"
FT                   /note="gene_id=mCG1051029.0"
FT   mRNA            join(5697852..5698109,5706919..5707049,5708180..5708370,
FT                   5708665..5712066)
FT                   /locus_tag="mCG_1051029"
FT                   /product="mCG1051029"
FT                   /note="gene_id=mCG1051029.0 transcript_id=mCT194818.0
FT                   created on 27-JAN-2005"
FT   CDS             5710937..5711359
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051029"
FT                   /product="mCG1051029"
FT                   /note="gene_id=mCG1051029.0 transcript_id=mCT194818.0
FT                   protein_id=mCP115846.0"
FT                   /protein_id="EDL22969.1"
FT                   /translation="MYYLLDGWMDGWMDGWMDRWMDGWIETGAYCIDKAGLELIEFYLP
FT                   LPPSTGIRSVCLAAISFFFKGKLLGVFFPPILTSFAVSVSFTCLLSVGWLSSLFHIESF
FT                   KEFPGCSSVSKTKALQCGFCVSPWFVLWQPSVLGSW"
FT   assembly_gap    5745065..5745281
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    5757321..5757340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5757844..>6253060
FT                   /gene="5330421F07Rik"
FT                   /locus_tag="mCG_145358"
FT                   /note="gene_id=mCG145358.0"
FT   mRNA            join(<5757844..5757925,5762587..5763229,6162049..6162166,
FT                   6172474..6172526,6198142..6198214,6208691..6208964,
FT                   6220264..6220430,6252501..>6253060)
FT                   /gene="5330421F07Rik"
FT                   /locus_tag="mCG_145358"
FT                   /product="RIKEN cDNA 5330421F07"
FT                   /note="gene_id=mCG145358.0 transcript_id=mCT184782.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    5762268..5762415
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   CDS             join(<5763038..5763229,6162049..6162166,6172474..6172526,
FT                   6198142..6198214,6208691..6208964,6220264..6220430,
FT                   6252501..>6253060)
FT                   /codon_start=1
FT                   /gene="5330421F07Rik"
FT                   /locus_tag="mCG_145358"
FT                   /product="RIKEN cDNA 5330421F07"
FT                   /note="gene_id=mCG145358.0 transcript_id=mCT184782.0
FT                   protein_id=mCP105461.0"
FT                   /protein_id="EDL22970.1"
FT                   /translation="HDLLSGGTSSGGVHRSPLCGALGSAVDLNYHGGRFYVWEMESISE
FT                   SSQQQRRKPVTHGLEDQKRIYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAQIIQVVA
FT                   NDKIEDINGCPKNRSQMIENIDACLNFLAAKGINTQGLSAEEIRNGNLKAILGLFFSLS
FT                   RYKQQQQQQQQQPEKQPLSSSPLPPAGSQVAGAPSQCQAGTPQHQGLATPQAPCQLLQP
FT                   VSHQQGKTQVEMQSRLPGPTARVAAAGSEAKTRGGSAAANNRRSQSFNNYDKSKPVTSP
FT                   PPPAPPSNHEKEPLASSASSHPGMSENVPAPLENSPSVPVNCSSSAIPQPSMTSKPWRS
FT                   KSLSVKHTATSAMLSVKPAGPEAPRPTPEAMKPAPNNQKSMLEKLKLFNSKGGSKAGEG
FT                   SASRDTSCERLEILPSFEETEELEATANRALSTVGPASSSPKIALKGIAQRTFSRALTN
FT                   KKSSPKGNEKEKEKQQREKEK"
FT   assembly_gap    5784058..5784085
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    5800772..5800791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5818785..5818846
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    5840835..5841033
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    5847721..5847740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5862605..5862705
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5871713..5872019
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    5875544..5875563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5883893..5885736
FT                   /locus_tag="mCG_147787"
FT                   /note="gene_id=mCG147787.0"
FT   mRNA            join(5883893..5883997,5884099..5885736)
FT                   /locus_tag="mCG_147787"
FT                   /product="mCG147787"
FT                   /note="gene_id=mCG147787.0 transcript_id=mCT188050.0
FT                   created on 13-JAN-2004"
FT   CDS             5884140..5884298
FT                   /codon_start=1
FT                   /locus_tag="mCG_147787"
FT                   /product="mCG147787"
FT                   /note="gene_id=mCG147787.0 transcript_id=mCT188050.0
FT                   protein_id=mCP109097.0"
FT                   /protein_id="EDL22971.1"
FT                   /translation="MGMLCWEWSPGLCVHSASILPLRCGPALKSLTSAVAICCLEESRR
FT                   LLCKSGK"
FT   assembly_gap    5914375..5914411
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(5921186..>5958782)
FT                   /locus_tag="mCG_144715"
FT                   /note="gene_id=mCG144715.0"
FT   mRNA            complement(join(5921186..5922626,5958331..5958389,
FT                   5958595..>5958782))
FT                   /locus_tag="mCG_144715"
FT                   /product="mCG144715"
FT                   /note="gene_id=mCG144715.0 transcript_id=mCT184139.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(5922183..>5922533)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144715"
FT                   /product="mCG144715"
FT                   /note="gene_id=mCG144715.0 transcript_id=mCT184139.0
FT                   protein_id=mCP105455.0"
FT                   /protein_id="EDL22972.1"
FT                   /translation="NTTPHPTNVLERRNNTSTKYCWTSTLECRNISLKAILSSTVPNEV
FT                   RSLPSRGLMCKTPTGCRHDYGSIHKPTKSQQHMLCGMLPRPLKGQGHPPQHWCSPRLVS
FT                   PLACLKGVSQLM"
FT   assembly_gap    5933931..5933950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5935507..5935531
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    5989862..5989881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6013853..6014066
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    6062400..6062474
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    6075765..6075915
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    6077511..6077530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6082976..6082995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6093655..6093822
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    6158757..6158776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6159786..6159805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6169029..6169297
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    6179977..6180055
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    6244457..6244476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6272145..6272164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6273357..6273376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6286795..6286814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6287892..6287911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6289046..6289770
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   assembly_gap    6300557..6300746
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    6305938..6305957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6320073..6320609
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    6328834..6328853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6338572..6338732
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    6347690..6349041
FT                   /estimated_length=1352
FT                   /gap_type="unknown"
FT   assembly_gap    6362780..6362799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6375842..6375861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6399036..6399110
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            <6399894..6409888
FT                   /locus_tag="mCG_145366"
FT                   /note="gene_id=mCG145366.0"
FT   mRNA            join(<6399894..6400055,6400248..6400319,6401020..6401216,
FT                   6401507..6401625,6407169..6407372,6409440..6409888)
FT                   /locus_tag="mCG_145366"
FT                   /product="mCG145366"
FT                   /note="gene_id=mCG145366.0 transcript_id=mCT184790.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6399901..6400055,6400248..6400319,6401020..6401216,
FT                   6401507..6401625,6407169..6407372,6409440..6409565)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145366"
FT                   /product="mCG145366"
FT                   /note="gene_id=mCG145366.0 transcript_id=mCT184790.0
FT                   protein_id=mCP105469.0"
FT                   /protein_id="EDL22973.1"
FT                   /translation="ELRQYLSNLADQCNSENNAVDMPLVIILDNLHHVSSLGEIFNGLL
FT                   NCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWVLCANHTEPVKGFLGRFLRRKLMETEI
FT                   SGRVRNAELVKIINWIPKVWHHLNRFLEAHSSSDVTIGPRLFLSCPIDVDGSRVWFTDL
FT                   WNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMDTYPWAASPQQHEWPPLLQLRPEDV
FT                   GFDGYSLPREGSTSKQVPPSDTEGDPLMNMLMRLQEAANYSSPQSYDSDSNSNSHHDDI
FT                   LDSSLESTL"
FT   assembly_gap    6418927..6418946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6424594..6424613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6429271..6429290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6436309..6441651)
FT                   /gene="Dbx1"
FT                   /locus_tag="mCG_1051028"
FT                   /note="gene_id=mCG1051028.0"
FT   mRNA            complement(join(6436309..6437593,6438303..6438505,
FT                   6440441..6440542,6441165..6441651))
FT                   /gene="Dbx1"
FT                   /locus_tag="mCG_1051028"
FT                   /product="developing brain homeobox 1"
FT                   /note="gene_id=mCG1051028.0 transcript_id=mCT194817.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(6437258..6437593,6438303..6438505,
FT                   6440441..6440542,6441165..6441531))
FT                   /codon_start=1
FT                   /gene="Dbx1"
FT                   /locus_tag="mCG_1051028"
FT                   /product="developing brain homeobox 1"
FT                   /note="gene_id=mCG1051028.0 transcript_id=mCT194817.0
FT                   protein_id=mCP115845.0"
FT                   /protein_id="EDL22974.1"
FT                   /translation="MMFPGLLAPPAGYPSLLRPTPTLTLPQSLQSAFSGHSSFLVEDLI
FT                   RISRPPTYLSRSIPAASLSPPSQEAPAALADSGTSDLGSPGSGSRRGSSPQTALSPASE
FT                   PTFLKFGVNAILSSAPRRETSPALLQSPPPKTFAFPYFEGSFQPFIRSSYFPASSSVVP
FT                   IPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKD
FT                   SQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGDEEEDNP
FT                   GARLAYHAPADPRHLLEGPLPASPAHSSSPGKPSDFSDSDEDEEGEEDEEITVS"
FT   assembly_gap    6442516..6442649
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    6445153..6445215
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    6456221..6456317
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    6457730..6458318
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    6477170..6477267
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    6478576..6478808
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    6538700..6538922
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   gene            6563994..6578781
FT                   /gene="Htatip2"
FT                   /locus_tag="mCG_142455"
FT                   /note="gene_id=mCG142455.1"
FT   mRNA            join(6563994..6564033,6564486..6564681,6566948..6567055,
FT                   6575591..6575728,6577357..6577418,6578082..6578781)
FT                   /gene="Htatip2"
FT                   /locus_tag="mCG_142455"
FT                   /product="HIV-1 tat interactive protein 2, homolog (human),
FT                   transcript variant mCT185311"
FT                   /note="gene_id=mCG142455.1 transcript_id=mCT185311.1
FT                   created on 02-JUN-2004"
FT   mRNA            join(6564010..6564199,6564430..6564681,6566948..6567055,
FT                   6575591..6575728,6577357..6577418,6578082..6578781)
FT                   /gene="Htatip2"
FT                   /locus_tag="mCG_142455"
FT                   /product="HIV-1 tat interactive protein 2, homolog (human),
FT                   transcript variant mCT180494"
FT                   /note="gene_id=mCG142455.1 transcript_id=mCT180494.2
FT                   created on 02-JUN-2004"
FT   mRNA            join(6564010..6564199,6564486..6564681,6566948..6567055,
FT                   6575591..6575728,6577357..6577418,6578082..6578781)
FT                   /gene="Htatip2"
FT                   /locus_tag="mCG_142455"
FT                   /product="HIV-1 tat interactive protein 2, homolog (human),
FT                   transcript variant mCT185309"
FT                   /note="gene_id=mCG142455.1 transcript_id=mCT185309.1
FT                   created on 02-JUN-2004"
FT   CDS             join(6564487..6564681,6566948..6567055,6575591..6575728,
FT                   6577357..6577418,6578082..6578307)
FT                   /codon_start=1
FT                   /gene="Htatip2"
FT                   /locus_tag="mCG_142455"
FT                   /product="HIV-1 tat interactive protein 2, homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142455.1 transcript_id=mCT180494.2
FT                   protein_id=mCP103416.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z2G9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:1859271"
FT                   /db_xref="PDB:2FMU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2G9"
FT                   /protein_id="EDL22975.1"
FT                   /translation="MADKEALPKLREDFKMQNKSVFILGASGETGKVLLKEILGQNLFS
FT                   KVTLIGRRKLTFEEEAYKNVNQEVVDFEKLDVYASAFQGHDVGFCCLGTTRSKAGAEGF
FT                   VRVDRDYVLKSAELAKAGGCKHFNLLSSRGADKSSSFLYLQVKGEVEAKVEELKFDRLS
FT                   VFRPGVLLCDRQESRPGEWLARKFFGSLPDSWASGYAVPVVTVVRAMLNNLVSPSSGQM
FT                   ELLENKAILHLGKDRDVPKL"
FT   CDS             join(6564487..6564681,6566948..6567055,6575591..6575728,
FT                   6577357..6577418,6578082..6578307)
FT                   /codon_start=1
FT                   /gene="Htatip2"
FT                   /locus_tag="mCG_142455"
FT                   /product="HIV-1 tat interactive protein 2, homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142455.1 transcript_id=mCT185309.1
FT                   protein_id=mCP106567.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z2G9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:1859271"
FT                   /db_xref="PDB:2FMU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2G9"
FT                   /protein_id="EDL22976.1"
FT                   /translation="MADKEALPKLREDFKMQNKSVFILGASGETGKVLLKEILGQNLFS
FT                   KVTLIGRRKLTFEEEAYKNVNQEVVDFEKLDVYASAFQGHDVGFCCLGTTRSKAGAEGF
FT                   VRVDRDYVLKSAELAKAGGCKHFNLLSSRGADKSSSFLYLQVKGEVEAKVEELKFDRLS
FT                   VFRPGVLLCDRQESRPGEWLARKFFGSLPDSWASGYAVPVVTVVRAMLNNLVSPSSGQM
FT                   ELLENKAILHLGKDRDVPKL"
FT   CDS             join(6564487..6564681,6566948..6567055,6575591..6575728,
FT                   6577357..6577418,6578082..6578307)
FT                   /codon_start=1
FT                   /gene="Htatip2"
FT                   /locus_tag="mCG_142455"
FT                   /product="HIV-1 tat interactive protein 2, homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG142455.1 transcript_id=mCT185311.1
FT                   protein_id=mCP106569.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z2G9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:1859271"
FT                   /db_xref="PDB:2FMU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2G9"
FT                   /protein_id="EDL22977.1"
FT                   /translation="MADKEALPKLREDFKMQNKSVFILGASGETGKVLLKEILGQNLFS
FT                   KVTLIGRRKLTFEEEAYKNVNQEVVDFEKLDVYASAFQGHDVGFCCLGTTRSKAGAEGF
FT                   VRVDRDYVLKSAELAKAGGCKHFNLLSSRGADKSSSFLYLQVKGEVEAKVEELKFDRLS
FT                   VFRPGVLLCDRQESRPGEWLARKFFGSLPDSWASGYAVPVVTVVRAMLNNLVSPSSGQM
FT                   ELLENKAILHLGKDRDVPKL"
FT   assembly_gap    6568483..6568502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6583078..6663363
FT                   /gene="Prmt3"
FT                   /locus_tag="mCG_145363"
FT                   /note="gene_id=mCG145363.0"
FT   mRNA            join(<6583078..6583233,6583313..6583445,6585043..6585125,
FT                   6586077..6586126,6586898..6587000,6591042..6591201,
FT                   6592318..6592459,6597039..6597104,6603372..6603493,
FT                   6611593..6611692,6623108..6623186,6631783..6631970,
FT                   6634019..6634105,6653553..6653603,6653795..6653882,
FT                   6662468..6663363)
FT                   /gene="Prmt3"
FT                   /locus_tag="mCG_145363"
FT                   /product="protein arginine N-methyltransferase 3"
FT                   /note="gene_id=mCG145363.0 transcript_id=mCT184787.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6583080..6583233,6583313..6583445,6585043..6585125,
FT                   6586077..6586126,6586898..6587000,6591042..6591201,
FT                   6592318..6592459,6597039..6597104,6603372..6603493,
FT                   6611593..6611692,6623108..6623186,6631783..6631970,
FT                   6634019..6634105,6653553..6653603,6653795..6653882,
FT                   6662468..6662577)
FT                   /codon_start=1
FT                   /gene="Prmt3"
FT                   /locus_tag="mCG_145363"
FT                   /product="protein arginine N-methyltransferase 3"
FT                   /note="gene_id=mCG145363.0 transcript_id=mCT184787.0
FT                   protein_id=mCP105466.0"
FT                   /protein_id="EDL22978.1"
FT                   /translation="VTRKRSPDGSRSACGSLWGLPRTRAARSRLRCRAVRPRAWSAAMC
FT                   SLAAGNGRGAELGPEPLELSDSGDDAGWEDEDADTEPAHGRQHTPCLFCDRLFASAEET
FT                   FSHCKLEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKDEYLK
FT                   PVLEDDLLLQFDVEDLYEPVSTPFSYPNGLSESASVVEKLKHMEARALSAEAALARARE
FT                   DLQKMKQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTE
FT                   SYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKVGAKKVIAVDQSEILYQAMDIIRLN
FT                   KLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVY
FT                   PDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCD
FT                   IKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNRVVFSTGPQSTK
FT                   THWKQTVFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYSLQ"
FT   assembly_gap    6591658..6592177
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    6654769..6654885
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            6715199..6766486
FT                   /gene="Slc6a5"
FT                   /locus_tag="mCG_142456"
FT                   /note="gene_id=mCG142456.1"
FT   mRNA            join(6715199..6715434,6716754..6717296,6719740..6719878,
FT                   6722256..6722387,6722620..6722793,6732611..6732760,
FT                   6735261..6735387,6741458..6741592,6743587..6743690,
FT                   6747021..6747145,6750761..6750873,6751782..6751913,
FT                   6753516..6753615,6756679..6756779,6761630..6761797,
FT                   6764512..6765299,6765480..6766486)
FT                   /gene="Slc6a5"
FT                   /locus_tag="mCG_142456"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, glycine), member 5, transcript variant
FT                   mCT185312"
FT                   /note="gene_id=mCG142456.1 transcript_id=mCT185312.0
FT                   created on 10-JUN-2003"
FT   CDS             join(6715432..6715434,6716754..6717296,6719740..6719878,
FT                   6722256..6722387,6722620..6722793,6732611..6732756)
FT                   /codon_start=1
FT                   /gene="Slc6a5"
FT                   /locus_tag="mCG_142456"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, glycine), member 5, isoform CRA_a"
FT                   /note="gene_id=mCG142456.1 transcript_id=mCT185312.0
FT                   protein_id=mCP106570.0 isoform=CRA_a"
FT                   /protein_id="EDL22979.1"
FT                   /translation="MDCSAPKEMNKQPANILEAAVPGHRDSPRAPRTSPEQDLPAEAPA
FT                   ATVQPPRVPRSASTGAQTFQSADARACEAQQSGVGFCNLSSPRAQATSAALRDLSEGHS
FT                   AQANPPSGPAGAGNALHCKIPALRGPEEDANVSVGKGTLEHNNTPAVGWVNMSQSTVVL
FT                   GTDGIASVLPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYL
FT                   AFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLII
FT                   SVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPK
FT                   IQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFK"
FT   mRNA            join(6715830..6715958,6716754..6717296,6719740..6719878,
FT                   6722256..6722387,6722620..6722793,6732611..6732760,
FT                   6735261..6735387,6741458..6741592,6743587..6743690,
FT                   6747021..6747145,6750761..6750873,6751782..6751913,
FT                   6753516..6753615,6756679..6756779,6761630..6761797,
FT                   6764512..6765299)
FT                   /gene="Slc6a5"
FT                   /locus_tag="mCG_142456"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, glycine), member 5, transcript variant
FT                   mCT180495"
FT                   /note="gene_id=mCG142456.1 transcript_id=mCT180495.1
FT                   created on 10-JUN-2003"
FT   CDS             join(6716775..6717296,6719740..6719878,6722256..6722387,
FT                   6722620..6722793,6732611..6732756)
FT                   /codon_start=1
FT                   /gene="Slc6a5"
FT                   /locus_tag="mCG_142456"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, glycine), member 5, isoform CRA_b"
FT                   /note="gene_id=mCG142456.1 transcript_id=mCT180495.1
FT                   protein_id=mCP103417.0 isoform=CRA_b"
FT                   /protein_id="EDL22980.1"
FT                   /translation="MNKQPANILEAAVPGHRDSPRAPRTSPEQDLPAEAPAATVQPPRV
FT                   PRSASTGAQTFQSADARACEAQQSGVGFCNLSSPRAQATSAALRDLSEGHSAQANPPSG
FT                   PAGAGNALHCKIPALRGPEEDANVSVGKGTLEHNNTPAVGWVNMSQSTVVLGTDGIASV
FT                   LPGSVATTTIPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGA
FT                   FLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYY
FT                   NVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTF
FT                   CMTAYPNLTMVNFTSQTNKTFVSGSEEYFK"
FT   assembly_gap    6718508..6718604
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    6733786..6734305
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    6735152..6735260
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    6745587..6745630
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    6761085..6761104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6765300..6765479
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    6766487..6766506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6778668..6778687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6779883..6779902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6780501..7070828
FT                   /locus_tag="mCG_145365"
FT                   /note="gene_id=mCG145365.0"
FT   mRNA            join(<6780501..6780876,6788170..6788298,6864956..6865106,
FT                   6922627..6922797,6978569..6978665,7016926..7016998,
FT                   7017598..7017680,7026148..7026212,7027512..7027614,
FT                   7039904..7039977,7048570..7048669,7070310..7070828)
FT                   /locus_tag="mCG_145365"
FT                   /product="mCG145365"
FT                   /note="gene_id=mCG145365.0 transcript_id=mCT184789.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6780765..6780876,6788170..6788298,6864956..6865106,
FT                   6922627..6922797,6978569..6978665,7016926..7016998,
FT                   7017598..7017680,7026148..7026212,7027512..7027614,
FT                   7039904..7039954)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145365"
FT                   /product="mCG145365"
FT                   /note="gene_id=mCG145365.0 transcript_id=mCT184789.0
FT                   protein_id=mCP105468.0"
FT                   /protein_id="EDL22981.1"
FT                   /translation="SIGFLLALVRPAWRGASGAMPMDVILVLWFCVCTARTVLGFGMDP
FT                   DLQMDIITELDLVNTTLGVTQVAGLHNASKAFLFQDVQREIHSAPHVSEKLIQLFRNKS
FT                   EFTFLATVQQKPSTSGVILSIRELEHSYFELESSGPREEIRYHYIHGGKPRTEALPYRM
FT                   ADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPETNLPPGSNLWLGQRNQKHGFFKGI
FT                   IQDGKIIFMPNGFITQCPNLNRTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLG
FT                   QLENCHCEKTCQVVVLWSAEGCPVPHSTVPQTHFLCIFLANVVKFADQNVSMEEKFLLR
FT                   ASGF"
FT   assembly_gap    6783751..6783770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6790949..6791216
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    6795789..6797507
FT                   /estimated_length=1719
FT                   /gap_type="unknown"
FT   assembly_gap    6816674..6816693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6817727..6817746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6821616..6821635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6840642..6840661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6841882..6841901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6843465..6843484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6851613..6851768
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    6853135..6853442
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    6888933..6889021
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    6913492..6915991
FT                   /estimated_length=2500
FT                   /gap_type="unknown"
FT   assembly_gap    6923253..6926990
FT                   /estimated_length=3738
FT                   /gap_type="unknown"
FT   assembly_gap    6928359..6928732
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    6937404..6937423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6950311..6950455
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    6980877..6980976
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    6989101..6989120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6994440..6994557
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    6996005..6996024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7007276..7008277
FT                   /estimated_length=1002
FT                   /gap_type="unknown"
FT   assembly_gap    7026213..7026232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7027890..7027909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7049464..7049809
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    7075919..7075938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7108667..7108686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7109765..7109784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7140370..7140389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7143760..7144141
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    7171922..7171968
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    7211225..7211244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7212478..7212592
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    7227235..7241234
FT                   /estimated_length=14000
FT                   /gap_type="unknown"
FT   assembly_gap    7256243..7256296
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    7260970..7261379
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    7261924..7262159
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    7271293..7271376
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    7273536..7273641
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    7277114..7277133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<7285135..>7343505)
FT                   /locus_tag="mCG_145995"
FT                   /note="gene_id=mCG145995.0"
FT   mRNA            complement(join(<7285135..7285314,7324940..7325022,
FT                   7330279..7330458,7343460..>7343505))
FT                   /locus_tag="mCG_145995"
FT                   /product="mCG145995"
FT                   /note="gene_id=mCG145995.0 transcript_id=mCT186103.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(<7285135..7285314,7324940..>7324975))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145995"
FT                   /product="mCG145995"
FT                   /note="gene_id=mCG145995.0 transcript_id=mCT186103.0
FT                   protein_id=mCP107392.0"
FT                   /protein_id="EDL22982.1"
FT                   /translation="RHNPQIEGFFSHEHHIGLTVVKTSCDLRKVKIILPCEEEKKPPET
FT                   RVSSVVVTSSCSILLDKQFFFNKNPEQ"
FT   assembly_gap    7291588..7296033
FT                   /estimated_length=4446
FT                   /gap_type="unknown"
FT   assembly_gap    7296837..7297205
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    7318452..7318740
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    7342506..7343115
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    7359167..7360079
FT                   /estimated_length=913
FT                   /gap_type="unknown"
FT   assembly_gap    7364921..7365059
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   gene            7366887..7368226
FT                   /gene="4933405O20Rik"
FT                   /locus_tag="mCG_142462"
FT                   /note="gene_id=mCG142462.0"
FT   mRNA            7366887..7368226
FT                   /gene="4933405O20Rik"
FT                   /locus_tag="mCG_142462"
FT                   /product="RIKEN cDNA 4933405O20"
FT                   /note="gene_id=mCG142462.0 transcript_id=mCT180501.0
FT                   created on 12-FEB-2003"
FT   CDS             7366918..7368108
FT                   /codon_start=1
FT                   /gene="4933405O20Rik"
FT                   /locus_tag="mCG_142462"
FT                   /product="RIKEN cDNA 4933405O20"
FT                   /note="gene_id=mCG142462.0 transcript_id=mCT180501.0
FT                   protein_id=mCP103423.0"
FT                   /db_xref="GOA:Q8BPC6"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="MGI:MGI:2142174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BPC6"
FT                   /protein_id="EDL22983.1"
FT                   /translation="MLAVTSCSMKTVLQYAVFLGHSREVVCELVTSFRSFCSHCAVPPS
FT                   PKYGGRHTVAMIPGDGIGPELMVHVKKIFRSNCVPVDFEEVWVTSTSNEEEINNALMAI
FT                   RRNRVALKGNIATNHNLPARYKSHNTKFRTILDLYASVVHFKTFPGVMTRHKDIDILVV
FT                   RENTEGEYTNLEHESVKGVVESLKIVTKTKSVRIADYAFKLAQKMGRKKVTVVHKANIM
FT                   KLGDGLFLQCCKDVAAHYPQITLESMIIDNTTMQLVSKPQQFDVMVMPNLYGNIINSIC
FT