spacer

EBI Dbfetch

ID   CH466600; SV 1; linear; genomic DNA; CON; MUS; 7793658 BP.
XX
AC   CH466600;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009773050 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7793658
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-7793658
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 022db997dbb209890d9627fd167ec622.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000213.
DR   Ensembl-Gn; ENSMUSG00000000600; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001467; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002297; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014529; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015653; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028970; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040274; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040302; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040473; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040584; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042476; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044674; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053178; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056004; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060938; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001507; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003717; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014673; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015797; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054294; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061008; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069538; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073471; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115365; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115424; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115426; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115427; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115515; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177258; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7793658
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            9787..11575
FT                   /pseudo
FT                   /locus_tag="mCG_1036367"
FT                   /note="gene_id=mCG1036367.0"
FT   mRNA            join(9787..9888,10518..10696,11414..11575)
FT                   /pseudo
FT                   /locus_tag="mCG_1036367"
FT                   /note="gene_id=mCG1036367.0 transcript_id=mCT154071.1
FT                   created on 07-MAY-2002"
FT   gene            <29904..>34234
FT                   /locus_tag="mCG_68102"
FT                   /note="gene_id=mCG68102.2"
FT   mRNA            join(<29904..29970,31034..31191,34003..>34234)
FT                   /locus_tag="mCG_68102"
FT                   /product="mCG68102"
FT                   /note="gene_id=mCG68102.2 transcript_id=mCT68287.2 created
FT                   on 07-MAY-2002"
FT   CDS             join(<29905..29970,31034..31191,34003..34234)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68102"
FT                   /product="mCG68102"
FT                   /note="gene_id=mCG68102.2 transcript_id=mCT68287.2
FT                   protein_id=mCP43398.2"
FT                   /protein_id="EDL14596.1"
FT                   /translation="GRMLTFHLRVMKDEGGGLGKCGTRRQTSSTAPDLSENEFKKEKER
FT                   LTTELHLITQKRNEQRDHLIAFKEGSMNKRTQRLQQELKFPQPKKKAYCRMSFHLRSPL
FT                   LNSIPNIHNLGLILLHSVHLCSVNSRKPVSQLIQGVIPFSVLVTPLE"
FT   gene            65185..73871
FT                   /pseudo
FT                   /locus_tag="mCG_1036354"
FT                   /note="gene_id=mCG1036354.1"
FT   mRNA            join(65185..65329,65955..66155,73735..73871)
FT                   /pseudo
FT                   /locus_tag="mCG_1036354"
FT                   /note="gene_id=mCG1036354.1 transcript_id=mCT154058.1
FT                   created on 07-MAY-2002"
FT   gene            147159..148487
FT                   /pseudo
FT                   /locus_tag="mCG_1036345"
FT                   /note="gene_id=mCG1036345.1"
FT   mRNA            join(147159..147320,147589..148487)
FT                   /pseudo
FT                   /locus_tag="mCG_1036345"
FT                   /note="gene_id=mCG1036345.1 transcript_id=mCT154049.1
FT                   created on 07-MAY-2002"
FT   gene            171128..171689
FT                   /locus_tag="mCG_6351"
FT                   /note="gene_id=mCG6351.2"
FT   mRNA            171128..171689
FT                   /locus_tag="mCG_6351"
FT                   /product="mCG6351"
FT                   /note="gene_id=mCG6351.2 transcript_id=mCT5653.2 created on
FT                   07-MAY-2002"
FT   CDS             171174..171611
FT                   /codon_start=1
FT                   /locus_tag="mCG_6351"
FT                   /product="mCG6351"
FT                   /note="gene_id=mCG6351.2 transcript_id=mCT5653.2
FT                   protein_id=mCP21997.1"
FT                   /db_xref="GOA:Q4FZH2"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FZH2"
FT                   /protein_id="EDL14597.1"
FT                   /translation="MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVR
FT                   SMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKV
FT                   VITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKMQE"
FT   gene            278939..457786
FT                   /gene="Cdk6"
FT                   /locus_tag="mCG_115258"
FT                   /note="gene_id=mCG115258.1"
FT   mRNA            join(278939..279598,325685..325820,364355..364522,
FT                   407958..408067,451015..451065,454920..455055,
FT                   456206..457786)
FT                   /gene="Cdk6"
FT                   /locus_tag="mCG_115258"
FT                   /product="cyclin-dependent kinase 6"
FT                   /note="gene_id=mCG115258.1 transcript_id=mCT116359.1
FT                   created on 07-MAY-2002"
FT   CDS             join(279366..279598,325685..325820,364355..364522,
FT                   407958..408067,451015..451065,454920..455055,
FT                   456206..456352)
FT                   /codon_start=1
FT                   /gene="Cdk6"
FT                   /locus_tag="mCG_115258"
FT                   /product="cyclin-dependent kinase 6"
FT                   /note="gene_id=mCG115258.1 transcript_id=mCT116359.1
FT                   protein_id=mCP87827.1"
FT                   /db_xref="GOA:Q0VBK8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028788"
FT                   /db_xref="MGI:MGI:1277162"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBK8"
FT                   /protein_id="EDL14598.1"
FT                   /translation="MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRV
FT                   RVQTSEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQD
FT                   LTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLAD
FT                   FGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGS
FT                   SDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCL
FT                   TFNPAKRISAYGALNHPYFQDLERYKDNLNSHLPSNQSTSELNTA"
FT   gene            462591..466569
FT                   /locus_tag="mCG_1036357"
FT                   /note="gene_id=mCG1036357.1"
FT   mRNA            462591..466569
FT                   /locus_tag="mCG_1036357"
FT                   /product="mCG1036357"
FT                   /note="gene_id=mCG1036357.1 transcript_id=mCT154061.1
FT                   created on 09-MAY-2002"
FT   CDS             463064..463351
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036357"
FT                   /product="mCG1036357"
FT                   /note="gene_id=mCG1036357.1 transcript_id=mCT154061.1
FT                   protein_id=mCP87830.1"
FT                   /protein_id="EDL14599.1"
FT                   /translation="MTGGGAAEPGQAGYCGRTSDLLHLSHLLCHLRKQGARETQSCPLS
FT                   YNNYSLLTRLASSGVEMQALYEMSPTQSFAGGWGLRCIIAGEILTLLFSI"
FT   gene            479775..506466
FT                   /locus_tag="mCG_6108"
FT                   /note="gene_id=mCG6108.2"
FT   mRNA            join(479775..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..495103,495550..495642,
FT                   496983..497033,500185..500271,501647..501698,
FT                   504931..506466)
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, transcript variant mCT168992"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT168992.0 created
FT                   on 07-MAY-2002"
FT   mRNA            join(479775..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..494637,495041..495103,
FT                   495550..495642,496983..497033,500185..500271,
FT                   501647..501698,504931..506466)
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, transcript variant mCT168991"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT168991.0 created
FT                   on 07-MAY-2002"
FT   mRNA            join(479775..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..496990)
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, transcript variant mCT4997"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT4997.1 created on
FT                   07-MAY-2002"
FT   mRNA            join(<479788..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..495103,495550..495642,
FT                   496983..497033,500185..500271,501647..501694,
FT                   504931..505754)
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, transcript variant mCT190820"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT190820.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<479840..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..494637,495041..495103,
FT                   495550..495642,496983..497033,500185..500271,
FT                   501647..501694,504931..505161)
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, transcript variant mCT190819"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT190819.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<479841..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..494637,495041..495103,
FT                   495550..495642,496983..497033,500185..500271,
FT                   501647..501694,504931..505017)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, isoform CRA_b"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT190819.0
FT                   protein_id=mCP111792.0 isoform=CRA_b"
FT                   /protein_id="EDL14601.1"
FT                   /translation="GFPRLQPATMGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNR
FT                   PRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLLSGNESSSKKRQKKK
FT                   KEKKKSGRYSSSSSSSSDSSSSSSDSEDEDKKQTKRRKKKKSRCHKSPESSGSDSASDS
FT                   KDGSKKKKKSKDVTEREKDTKGLSKKRKMYEDKPLSSESLSESDCGEVQAKRKKSGEER
FT                   ERTTDKAKKRRKHKKHSKKKKKKAASSSSDSP"
FT   CDS             join(479868..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..494637,495041..495103,
FT                   495550..495642,496983..497033,500185..500271,
FT                   501647..501698,504931..504959)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, isoform CRA_a"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT168991.0
FT                   protein_id=mCP91865.0 isoform=CRA_a"
FT                   /protein_id="EDL14600.1"
FT                   /translation="MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVK
FT                   EQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLLSGNESSSKKRQKKKKEKKKSGRY
FT                   SSSSSSSSDSSSSSSDSEDEDKKQTKRRKKKKSRCHKSPESSGSDSASDSKDGSKKKKK
FT                   SKDVTEREKDTKGLSKKRKMYEDKPLSSESLSESDCGEVQAKRKKSGEERERTTARQSQ
FT                   KEKEA"
FT   CDS             join(479868..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..494676)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, isoform CRA_d"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT4997.1
FT                   protein_id=mCP6554.1 isoform=CRA_d"
FT                   /protein_id="EDL14603.1"
FT                   /translation="MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVK
FT                   EQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLLSGNESSSKKRQKKKKEKKKSGRV
FT                   SKSFLFSKCYS"
FT   CDS             join(479868..479891,490583..490680,493688..493766,
FT                   494417..494491,494605..494676)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, isoform CRA_d"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT168992.0
FT                   protein_id=mCP91874.0 isoform=CRA_d"
FT                   /protein_id="EDL14604.1"
FT                   /translation="MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVK
FT                   EQLEKKKKGSKALAEFEEKMNENWKKELEKHREKLLSGNESSSKKRQKKKKEKKKSGRV
FT                   SKSFLFSKCYS"
FT   CDS             join(<494954..495103,495550..495642,496983..497033,
FT                   500185..500271,501647..501694,504931..505017)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6108"
FT                   /product="mCG6108, isoform CRA_c"
FT                   /note="gene_id=mCG6108.2 transcript_id=mCT190820.0
FT                   protein_id=mCP111793.0 isoform=CRA_c"
FT                   /protein_id="EDL14602.1"
FT                   /translation="IEFTKCLRDLVKETNSCISQALIVLCLVKYSSSSSSSSDSSSSSS
FT                   DSEDEDKKQTKRRKKKKSRCHKSPESSGSDSASDSKDGSKKKKKSKDVTEREKDTKGLS
FT                   KKRKMYEDKPLSSESLSESDCGEVQAKRKKSGEERERTTDKAKKRRKHKKHSKKKKKKA
FT                   ASSSSDSP"
FT   gene            <507090..520654
FT                   /locus_tag="mCG_6119"
FT                   /note="gene_id=mCG6119.1"
FT   mRNA            join(<507090..507754,511567..511722,513184..513288,
FT                   516349..516500,518209..518313,520300..520654)
FT                   /locus_tag="mCG_6119"
FT                   /product="mCG6119, transcript variant mCT4983"
FT                   /note="gene_id=mCG6119.1 transcript_id=mCT4983.1 created on
FT                   07-MAY-2002"
FT   mRNA            join(<507510..507754,511567..511722,513184..513288,
FT                   516397..516500,518209..518313,520300..520401)
FT                   /locus_tag="mCG_6119"
FT                   /product="mCG6119, transcript variant mCT190828"
FT                   /note="gene_id=mCG6119.1 transcript_id=mCT190828.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<507682..507754,511567..511722,513184..513288,
FT                   516349..516500,518209..518313,520300..520356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6119"
FT                   /product="mCG6119, isoform CRA_b"
FT                   /note="gene_id=mCG6119.1 transcript_id=mCT4983.1
FT                   protein_id=mCP6564.1 isoform=CRA_b"
FT                   /protein_id="EDL14606.1"
FT                   /translation="AEANVMEQRALKKMVESIRKTVKSFKKFEVECLIRLFYSLVGCPV
FT                   GKMDNTGLDCNTFRGVLQNIFGMTNDMLMNRVFFVFDKDGDGYVNLEEWIKGLAVFLRG
FT                   TFEEKMRFCFEVYYLNGDAYISQEKIFDMLKSSLFQHSPEEENEEGVKDLVEISLKKMD
FT                   YDNDGKISFADFEKAVKEDGLLLEAFGPCLPDAKFCFHFEALVFKNNPPASL"
FT   CDS             join(<507682..507754,511567..511722,513184..513288,
FT                   516397..516398)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6119"
FT                   /product="mCG6119, isoform CRA_a"
FT                   /note="gene_id=mCG6119.1 transcript_id=mCT190828.0
FT                   protein_id=mCP111797.0 isoform=CRA_a"
FT                   /protein_id="EDL14605.1"
FT                   /translation="AEANVMEQRALKKMVESIRKTVKSFKKFEVECLIRLFYSLVGCPV
FT                   GKMDNTGLDCNTFRGVLQNIFGMTNDMLMNRVFFVFDKDGDGYVNLEEWIKGLAVFLRG
FT                   TFEEKMR"
FT   gene            complement(519785..532608)
FT                   /gene="C030048B08Rik"
FT                   /locus_tag="mCG_6120"
FT                   /note="gene_id=mCG6120.2"
FT   mRNA            complement(join(519785..520867,526283..526863,
FT                   527730..527875,531315..531505,532026..532607))
FT                   /gene="C030048B08Rik"
FT                   /locus_tag="mCG_6120"
FT                   /product="RIKEN cDNA C030048B08, transcript variant
FT                   mCT4991"
FT                   /note="gene_id=mCG6120.2 transcript_id=mCT4991.2 created on
FT                   09-MAY-2002"
FT   CDS             complement(join(520781..520867,526283..526863,
FT                   527730..527875,531315..531505,532026..532262))
FT                   /codon_start=1
FT                   /gene="C030048B08Rik"
FT                   /locus_tag="mCG_6120"
FT                   /product="RIKEN cDNA C030048B08, isoform CRA_a"
FT                   /note="gene_id=mCG6120.2 transcript_id=mCT4991.2
FT                   protein_id=mCP6553.2 isoform=CRA_a"
FT                   /db_xref="GOA:H9H9R8"
FT                   /db_xref="MGI:MGI:2442653"
FT                   /db_xref="UniProtKB/TrEMBL:H9H9R8"
FT                   /protein_id="EDL14607.1"
FT                   /translation="MIVDGVDPSANPSTPGPSCSLIGLRGARLADVVLARGTRAGKMAS
FT                   SDGKPGGVFDHHVQTAVCDSRAKYREGRRPRAVKVYTINLESQYLLIQGVPAVGAMKEL
FT                   VERFALYGAIEQYNALDEYPAEDFTEVYLIKFVKLQSARVAKKKMDEQSFFGGLLHVCY
FT                   APEFETVEETRKKLQERKAYITRVTKNQDCYMAKKKPVPEQKGTKDSRQGFHPPMPGFG
FT                   TAALNTSPESPPENSSSCLPYSCEFPLSCFASKSTCSRGEHVDRVSDSCNSARNHGELS
FT                   RHRDHSAFSPKLQMNTYKNSVPCSSVQEAIATSQAVGRFMPRTTQLQERKRRRDCDREL
FT                   GTLLETHTSSNEVLIGPKLPGIPTVDLQDDSLNTTATLIRRKLKEVISSVPKPPEDNIK
FT                   DVCTSHPGKQRRRI"
FT   mRNA            complement(join(527543..527875,531315..531505,
FT                   532026..532608))
FT                   /gene="C030048B08Rik"
FT                   /locus_tag="mCG_6120"
FT                   /product="RIKEN cDNA C030048B08, transcript variant
FT                   mCT168994"
FT                   /note="gene_id=mCG6120.2 transcript_id=mCT168994.0 created
FT                   on 09-MAY-2002"
FT   CDS             complement(join(527710..527875,531315..531505,
FT                   532026..532262))
FT                   /codon_start=1
FT                   /gene="C030048B08Rik"
FT                   /locus_tag="mCG_6120"
FT                   /product="RIKEN cDNA C030048B08, isoform CRA_b"
FT                   /note="gene_id=mCG6120.2 transcript_id=mCT168994.0
FT                   protein_id=mCP91867.0 isoform=CRA_b"
FT                   /protein_id="EDL14608.1"
FT                   /translation="MIVDGVDPSANPSTPGPSCSLIGLRGARLADVVLARGTRAGKMAS
FT                   SDGKPGGVFDHHVQTAVCDSRAKYREGRRPRAVKVYTINLESQYLLIQGVPAVGAMKEL
FT                   VERFALYGAIEQYNALDEYPAEDFTEVYLIKFVKLQSARVAKKKMDEQSFFGGLLHVCY
FT                   APEFETVEETRKKLQERKAYITRVTKNQGMESVC"
FT   gene            <532449..572778
FT                   /gene="Pex1"
FT                   /locus_tag="mCG_115272"
FT                   /note="gene_id=mCG115272.0"
FT   mRNA            join(<532449..532577,539292..539435,540856..540939,
FT                   541494..541608,541707..542470,543727..543846,
FT                   545914..546037,546239..546348,548428..548510,
FT                   550622..550754,554364..554460,556142..556312,
FT                   557780..557934,559488..559677,559967..560133,
FT                   561548..561682,563066..563130,565518..565660,
FT                   565737..565840,567137..567313,569264..569494,
FT                   570863..571060,571328..571458,572319..572778)
FT                   /gene="Pex1"
FT                   /locus_tag="mCG_115272"
FT                   /product="peroxisome biogenesis factor 1"
FT                   /note="gene_id=mCG115272.0 transcript_id=mCT116373.1
FT                   created on 07-MAY-2002"
FT   CDS             join(532449..532577,539292..539435,540856..540939,
FT                   541494..541608,541707..542470,543727..543846,
FT                   545914..546037,546239..546348,548428..548510,
FT                   550622..550754,554364..554460,556142..556312,
FT                   557780..557934,559488..559677,559967..560133,
FT                   561548..561682,563066..563130,565518..565660,
FT                   565737..565840,567137..567313,569264..569494,
FT                   570863..571060,571328..571458,572319..572403)
FT                   /codon_start=1
FT                   /gene="Pex1"
FT                   /locus_tag="mCG_115272"
FT                   /product="peroxisome biogenesis factor 1"
FT                   /note="gene_id=mCG115272.0 transcript_id=mCT116373.1
FT                   protein_id=mCP87802.1"
FT                   /protein_id="EDL14609.1"
FT                   /translation="MWSSDRLAGAGSGGAVVTVAFTNARDCFLHLPRRLVAQLHLLQNQ
FT                   AIEVASDHQPTYLSWVEGRHFNDQSENVAEINRQVGQKLGLSSGDQVFLRPCSHVVSCQ
FT                   QVEVEPLSADDWEILELHAISLEQHLLDQIRIVFPKAVVPIWVDQQTYIFIQIVTLMPA
FT                   APYGRLETNTKLLIQPKTRQAKESTFPKEGDAHGQVHSYGREQKGLSKELQTRQLHTNS
FT                   EGITASNGRDPKVPGGPLKPSWWAVLGSMLSFGPDSKQESAWGSLELGAFKNMQSQAAP
FT                   LEGTFRVCQVQPPSARTTTATSVFHKHCTAHVFPWDQEYFDVEPSFTVTYGKLVKLHSP
FT                   KQQQDKSKQGVLLPDKEKQLSKSPDHKQISSNRSEEAAEACVLKVVWNGLEELKNATEF
FT                   TESLELLHRGKVWIPDDLRKRLNIEMHAVVRITPLETTPKIPRSLKLQPRENLPKDVNE
FT                   ETIKTVFSSWVQQSATTMLPLVISKEERIKLEIKDGLREFSLSTVHSQEKEKEEGKTVF
FT                   VLSSILLQKISVQVLLEPMIKEEQSAEIDFLLPSLTLSSLGGVSALGASAMEHITHSLL
FT                   GRPLSRQLMALVAGLRNGALLITGGKGSGKSTFAKAICKEAQDTLDARVETVDCKALRG
FT                   KRLESIQKALEVAFSEAAWRQPSVILLDDLDLIAGLPSVPEQEHSPEAVQSQRLAHALN
FT                   DMIKEFVSTGSLVALIATSQLQQSLHPSLVSAQGIHTFQCVQHLQPPNPEQRCEILHSV
FT                   VKNKLGCDISNFPDLDLQCIAKDTEAFVARDFTVLVDRAIHSSLSRQHSSSREDLTLTT
FT                   SDFQKALRGFLPASLRNVNLHKPRDLGWDKIGGLHEVRQILMDTIQLPAKYPELFANLP
FT                   IRQRTGILLYGPPGTGKTLLAGVVARESGMNFISIKGPELLSKYIGASEQAVRDVFIRA
FT                   QAAKPCILFFDEFESIAPRRGHDNTGVTDRVVNQLLTQLDGVEGLQGVYVLAATSRPDL
FT                   IDPALLRPGRLDKCVYCPPPDQVSRLEILTVLSKSLALADDVDLQHVASVTDSFTGADL
FT                   KALLYNAQLEALQGRLLPSGLPDGGSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLEQ
FT                   SLLSLEMSEILPDESKFNMYRLYFGSSYESELGNGTPSDLSSHCLSAPSSVTQDLPAAP
FT                   GKDPLFTQHPVFRTPSQEGCQDLTQEQRDQLRAEISIIKGRYRSQSGEDESLNQPGPIK
FT                   TTFAISQAHLMTALAHTRPSISEDEGKEFAELYENFQNPKKRKNQSGTVFRTGQKVTLA
FT                   "
FT   gene            complement(575512..583506)
FT                   /gene="Gatad1"
FT                   /locus_tag="mCG_115266"
FT                   /note="gene_id=mCG115266.1"
FT   mRNA            complement(join(575512..577128,579106..579289,
FT                   580429..580488,582332..582457,582928..583505))
FT                   /gene="Gatad1"
FT                   /locus_tag="mCG_115266"
FT                   /product="GATA zinc finger domain containing 1, transcript
FT                   variant mCT116367"
FT                   /note="gene_id=mCG115266.1 transcript_id=mCT116367.1
FT                   created on 09-MAY-2002"
FT   CDS             complement(join(576938..577128,579106..579289,
FT                   580429..580488,582332..582457,582928..583167))
FT                   /codon_start=1
FT                   /gene="Gatad1"
FT                   /locus_tag="mCG_115266"
FT                   /product="GATA zinc finger domain containing 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG115266.1 transcript_id=mCT116367.1
FT                   protein_id=mCP87779.1 isoform=CRA_b"
FT                   /protein_id="EDL14611.1"
FT                   /translation="MPLGLKPTCSMCKTTSSSMWKKSPQGEILCHHCTGRGGGGAGVAG
FT                   GTGGGGGAGGGSGPPSFATTSAGPSQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAE
FT                   KKVSTKGKGRRHIFKLKNPIKAPESVSTIVTAESIFYKGVYYQIGDVVSVIDEQDGKPY
FT                   YAQIRGFIQDQYCEKSAALTWLIPTLASPRDQFDPASYIIGPEEDLPRKMEYLEFVCHA
FT                   PSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKETVANHL"
FT   mRNA            complement(join(578695..579289,580429..580488,
FT                   582332..582457,582928..583506))
FT                   /gene="Gatad1"
FT                   /locus_tag="mCG_115266"
FT                   /product="GATA zinc finger domain containing 1, transcript
FT                   variant mCT168976"
FT                   /note="gene_id=mCG115266.1 transcript_id=mCT168976.0
FT                   created on 09-MAY-2002"
FT   CDS             complement(join(579059..579289,580429..580488,
FT                   582332..582457,582928..583167))
FT                   /codon_start=1
FT                   /gene="Gatad1"
FT                   /locus_tag="mCG_115266"
FT                   /product="GATA zinc finger domain containing 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115266.1 transcript_id=mCT168976.0
FT                   protein_id=mCP91861.0 isoform=CRA_a"
FT                   /protein_id="EDL14610.1"
FT                   /translation="MPLGLKPTCSMCKTTSSSMWKKSPQGEILCHHCTGRGGGGAGVAG
FT                   GTGGGGGAGGGSGPPSFATTSAGPSQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAE
FT                   KKVSTKGKGRRHIFKLKNPIKAPESVSTIVTAESIFYKGVYYQIGDVVSVIDEQDGKPY
FT                   YAQIRGFIQDQYCEKSAALTWLIPTLASPRDQFDPASYIIGEAQHLRFTSFFSAL"
FT   gene            592823..615439
FT                   /gene="4930511M11Rik"
FT                   /locus_tag="mCG_6106"
FT                   /note="gene_id=mCG6106.2"
FT   mRNA            join(592823..593083,593218..593346,597557..597831,
FT                   600055..600133,601078..601131,602593..602683,
FT                   605713..605750,605832..605919,608993..609082,
FT                   612174..612221,614912..615438)
FT                   /gene="4930511M11Rik"
FT                   /locus_tag="mCG_6106"
FT                   /product="RIKEN cDNA 4930511M11, transcript variant
FT                   mCT4996"
FT                   /note="gene_id=mCG6106.2 transcript_id=mCT4996.2 created on
FT                   07-MAY-2002"
FT   mRNA            join(592824..593083,593218..593346,597557..597639,
FT                   600055..600133,601078..601131,602635..602683,
FT                   605713..605750,605832..605919,608993..609082,
FT                   612174..612221,614912..615439)
FT                   /gene="4930511M11Rik"
FT                   /locus_tag="mCG_6106"
FT                   /product="RIKEN cDNA 4930511M11, transcript variant
FT                   mCT168990"
FT                   /note="gene_id=mCG6106.2 transcript_id=mCT168990.0 created
FT                   on 07-MAY-2002"
FT   mRNA            join(592824..593083,593218..593346,597557..597831,
FT                   600055..600133,601078..601131,602635..603012)
FT                   /gene="4930511M11Rik"
FT                   /locus_tag="mCG_6106"
FT                   /product="RIKEN cDNA 4930511M11, transcript variant
FT                   mCT168989"
FT                   /note="gene_id=mCG6106.2 transcript_id=mCT168989.0 created
FT                   on 07-MAY-2002"
FT   CDS             join(593345..593346,597557..597831,600055..600133,
FT                   601078..601131,602593..602683,605713..605750,
FT                   605832..605919,608993..609082,612174..612221,
FT                   614912..615055)
FT                   /codon_start=1
FT                   /gene="4930511M11Rik"
FT                   /locus_tag="mCG_6106"
FT                   /product="RIKEN cDNA 4930511M11, isoform CRA_c"
FT                   /note="gene_id=mCG6106.2 transcript_id=mCT4996.2
FT                   protein_id=mCP6560.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D592"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1922305"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D592"
FT                   /protein_id="EDL14614.1"
FT                   /translation="MKIDLEVSEPVNFSSGDHQHLVHTAAIKGNTGRLDQPFTASSGDR
FT                   VQEAVQYSHPRNRDGANTYAVQVSEDVTPSNETVNQSIPFENTSIRNDFIMKVFVVLSI
FT                   QLFITAVIIGIFVFCEPVRKWVIAKPWFLYALLPAVMILIFVLACCRDIRRQVPANYIL
FT                   LAFFTILEGLLLGSLSVFYRAEEILWAAGATTMVTLVLTLFALQTKWDFTLLNGVMFVF
FT                   TSVLLIYGIIALVIRSYWLHLVYSALGTLLFSIYLVMDVQMMVGGRYHYEINPEEYIFA
FT                   ALNIYVDIISLFIFILDLIGR"
FT   CDS             join(593345..593346,597557..597639,600055..600133,
FT                   601078..601131,602635..602683,605713..605750,
FT                   605832..605919,608993..609082,612174..612221,
FT                   614912..615055)
FT                   /codon_start=1
FT                   /gene="4930511M11Rik"
FT                   /locus_tag="mCG_6106"
FT                   /product="RIKEN cDNA 4930511M11, isoform CRA_a"
FT                   /note="gene_id=mCG6106.2 transcript_id=mCT168990.0
FT                   protein_id=mCP91869.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D561"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1922305"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D561"
FT                   /protein_id="EDL14612.1"
FT                   /translation="MKIDLEVSEPVNFSSGDHQHLVHTAAIKDFIMKVFVVLSIQLFIT
FT                   AVIIGIFVFCEPVRKWVIAKPWFLYALLDIRRQVPANYILLAFFTILEGLLLGSLSVFY
FT                   RAEEILWAAGATTMVTLVLTLFALQTKWDFTLLNGVMFVFTSVLLIYGIIALVIRSYWL
FT                   HLVYSALGTLLFSIYLVMDVQMMVGGRYHYEINPEEYIFAALNIYVDIISLFIFILDLI
FT                   GR"
FT   CDS             join(593345..593346,597557..597831,600055..600133,
FT                   601078..601131,602635..602752)
FT                   /codon_start=1
FT                   /gene="4930511M11Rik"
FT                   /locus_tag="mCG_6106"
FT                   /product="RIKEN cDNA 4930511M11, isoform CRA_b"
FT                   /note="gene_id=mCG6106.2 transcript_id=mCT168989.0
FT                   protein_id=mCP91859.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z122"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1922305"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z122"
FT                   /protein_id="EDL14613.1"
FT                   /translation="MKIDLEVSEPVNFSSGDHQHLVHTAAIKGNTGRLDQPFTASSGDR
FT                   VQEAVQYSHPRNRDGANTYAVQVSEDVTPSNETVNQSIPFENTSIRNDFIMKVFVVLSI
FT                   QLFITAVIIGIFVFCEPVRKWVIAKPWFLYALLDIRRQVPANYILLAFFVSNSPWQVLW
FT                   LSSDTFVVLLHC"
FT   gene            complement(625895..739412)
FT                   /gene="Ankib1"
FT                   /locus_tag="mCG_6107"
FT                   /note="gene_id=mCG6107.3"
FT   mRNA            complement(join(625895..629391,629667..629800,
FT                   630674..630770,636251..636302,637700..637878,
FT                   638787..638932,640421..640487,640683..640769,
FT                   642084..642218,649032..649162,658470..658558,
FT                   663414..663580,665560..665704,668465..668553,
FT                   669901..670109,682946..683063,691519..691701,
FT                   705044..705344,708132..708402,738884..>739212))
FT                   /gene="Ankib1"
FT                   /locus_tag="mCG_6107"
FT                   /product="ankyrin repeat and IBR domain containing 1,
FT                   transcript variant mCT190817"
FT                   /note="gene_id=mCG6107.3 transcript_id=mCT190817.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(625900..629391,629667..629800,
FT                   630674..630788,636251..636302,637700..637878,
FT                   638787..638932,640421..640487,640683..640769,
FT                   642084..642218,649032..649162,658470..658558,
FT                   663414..663580,665560..665704,668465..668553,
FT                   669901..670109,682946..683063,691519..691701,
FT                   705044..705344,708132..708402,738884..739071,
FT                   739307..739412))
FT                   /gene="Ankib1"
FT                   /locus_tag="mCG_6107"
FT                   /product="ankyrin repeat and IBR domain containing 1,
FT                   transcript variant mCT4995"
FT                   /note="gene_id=mCG6107.3 transcript_id=mCT4995.2 created on
FT                   09-MAY-2002"
FT   CDS             complement(join(628651..629391,629667..629800,
FT                   630674..630770,636251..636302,637700..637878,
FT                   638787..638932,640421..640487,640683..640769,
FT                   642084..642218,649032..649162,658470..658558,
FT                   663414..663580,665560..665704,668465..668553,
FT                   669901..670109,682946..683063,691519..691701,
FT                   705044..705344,708132..>708325))
FT                   /codon_start=1
FT                   /gene="Ankib1"
FT                   /locus_tag="mCG_6107"
FT                   /product="ankyrin repeat and IBR domain containing 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6107.3 transcript_id=mCT190817.0
FT                   protein_id=mCP111790.0 isoform=CRA_a"
FT                   /protein_id="EDL14615.1"
FT                   /translation="QNMGNTTTKFRKALINGDENLACQIYENNPQLKESLDPNISYGEP
FT                   YQHNTPLHYAARHGMNRILGTFLFGRDGNPNKRNVHNETSMHLLCMGPQIMISEGTLHP
FT                   RLARPVEDDFRRADCLQMILQWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKAC
FT                   VELLVKHGGDLFAENENRDTPCDCAEKQQHKDLALSLESQMVFSRDPEAEEIEAEYAAL
FT                   DKREPYEGLRPQDLRRLKDMLIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPE
FT                   NCCQRSGVQMPTPPPSGYNAWDTLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICM
FT                   CSISVFEDPVDMPCGHDFCRGCWEAFLNLKIQEGEAHNIFCPAYECFQLVPVDVIESVV
FT                   SKEMDKRYLQFDIKAFVENNPAIKWCPTAGCERAVRLTKQGSNPSGSDTLSFPLLRAPA
FT                   VDCGKGHLFCWECLGEAHEPCDCQTWKNWLQKITEMKPEELVGVSEAYEDAANCLWLLT
FT                   NSKPCANCKSPIQKNEGCNHMQCAKCKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQH
FT                   VEEQSKEMTVEAEKKHKRFQELDRFMHYYTRYKNHEHSYQLEQRLLKTAKEKMEQLSRA
FT                   LKETEGGCPDTTFIEDAVHVLLKTRRILKCSYPYGFFLEPKSTKKEIFELMQTDLEMVT
FT                   EDLAQKVNRPYLRTPRHKIIRAACLVQQKRQEFLASVARGVAPADSPDAPRRSFAGGTW
FT                   DWEYLGFASPEYRRRHRQQRRRGDVHSLLSNPTDLDEPSESTFDLPEGSSGRRPGASVV
FT                   SSASMSVLHSSSLRDYSPASRSANQDSLQALSSLDEDDPNILLAIQLSLQESGLDMDEE
FT                   TRDFLSNETSLGAIGSSLPSRLDSVPRSTESPRAALSSSELLELGDSLMRLGADSDPFS
FT                   TDTLSSRPLSETRSDFCPSSSDLDSAGQDPSANDNLLGNIMAWFHDMNPQSIALIPPAA
FT                   TTEISAEPQLPCIRDGSEGVRDMELVPPEDSVSKDTGVHEGERAQMEENPLEENILARE
FT                   ELSQAGDSSNEAVGRGDRPDAASQTPQTSSDWLEQVHSV"
FT   CDS             complement(join(628651..629391,629667..629800,
FT                   630674..630788,636251..636302,637700..637878,
FT                   638787..638932,640421..640487,640683..640769,
FT                   642084..642218,649032..649162,658470..658558,
FT                   663414..663580,665560..665704,668465..668553,
FT                   669901..670109,682946..683063,691519..691701,
FT                   705044..705344,708132..708319))
FT                   /codon_start=1
FT                   /gene="Ankib1"
FT                   /locus_tag="mCG_6107"
FT                   /product="ankyrin repeat and IBR domain containing 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG6107.3 transcript_id=mCT4995.2
FT                   protein_id=mCP6548.2 isoform=CRA_c"
FT                   /protein_id="EDL14617.1"
FT                   /translation="MGNTTTKFRKALINGDENLACQIYENNPQLKESLDPNISYGEPYQ
FT                   HNTPLHYAARHGMNRILGTFLFGRDGNPNKRNVHNETSMHLLCMGPQIMISEGTLHPRL
FT                   ARPVEDDFRRADCLQMILQWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKACVE
FT                   LLVKHGGDLFAENENRDTPCDCAEKQQHKDLALSLESQMVFSRDPEAEEIEAEYAALDK
FT                   REPYEGLRPQDLRRLKDMLIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPENC
FT                   CQRSGVQMPTPPPSGYNAWDTLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICMCS
FT                   ISVFEDPVDMPCGHDFCRGCWEAFLNLKIQEGEAHNIFCPAYECFQLVPVDVIESVVSK
FT                   EMDKRYLQFDIKAFVENNPAIKWCPTAGCERAVRLTKQGSNPSGSDTLSFPLLRAPAVD
FT                   CGKGHLFCWECLGEAHEPCDCQTWKNWLQKITEMKPEELVGVSEAYEDAANCLWLLTNS
FT                   KPCANCKSPIQKNEGCNHMQCAKCKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQHVE
FT                   EQSKEMTVEAEKKHKRFQELDRFMHYYTRYKNHEHSYQLEQRLLKTAKEKMEQLSRALK
FT                   ETEGGCPDTTFIEDAVHVLLKTRRILKCSYPYGFFLEPKSTKKEIFELMQTDLEMVTED
FT                   LAQKVNRPYLRTPRHKIIRAACLVQQKRQEFLASVARGVAPADSPDAPRRSFAGGTWDW
FT                   EYLGFASPEEYAEFQYRRRHRQQRRRGDVHSLLSNPTDLDEPSESTFDLPEGSSGRRPG
FT                   ASVVSSASMSVLHSSSLRDYSPASRSANQDSLQALSSLDEDDPNILLAIQLSLQESGLD
FT                   MDEETRDFLSNETSLGAIGSSLPSRLDSVPRSTESPRAALSSSELLELGDSLMRLGADS
FT                   DPFSTDTLSSRPLSETRSDFCPSSSDLDSAGQDPSANDNLLGNIMAWFHDMNPQSIALI
FT                   PPAATTEISAEPQLPCIRDGSEGVRDMELVPPEDSVSKDTGVHEGERAQMEENPLEENI
FT                   LAREELSQAGDSSNEAVGRGDRPDAASQTPQTSSDWLEQVHSV"
FT   mRNA            complement(join(<629775..629800,630674..630788,
FT                   636251..636302,637700..637878,638787..638932,
FT                   640421..640487,640683..640769,642084..642218,
FT                   649032..649162,658470..658558,663414..663580,
FT                   665560..665704,668465..668553,669901..670109,
FT                   682946..683063,691519..691701,705044..705344,
FT                   708132..708402,731716..>731777))
FT                   /gene="Ankib1"
FT                   /locus_tag="mCG_6107"
FT                   /product="ankyrin repeat and IBR domain containing 1,
FT                   transcript variant mCT190818"
FT                   /note="gene_id=mCG6107.3 transcript_id=mCT190818.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<629775..629800,630674..630788,
FT                   636251..636302,637700..637878,638787..638932,
FT                   640421..640487,640683..640769,642084..642218,
FT                   649032..649162,658470..658558,663414..663580,
FT                   665560..665704,668465..668553,669901..670109,
FT                   682946..683063,691519..691701,705044..705344,
FT                   708132..>708325))
FT                   /codon_start=1
FT                   /gene="Ankib1"
FT                   /locus_tag="mCG_6107"
FT                   /product="ankyrin repeat and IBR domain containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6107.3 transcript_id=mCT190818.0
FT                   protein_id=mCP111791.0 isoform=CRA_b"
FT                   /protein_id="EDL14616.1"
FT                   /translation="QNMGNTTTKFRKALINGDENLACQIYENNPQLKESLDPNISYGEP
FT                   YQHNTPLHYAARHGMNRILGTFLFGRDGNPNKRNVHNETSMHLLCMGPQIMISEGTLHP
FT                   RLARPVEDDFRRADCLQMILQWKGAKLDQGEYERAAIDAVDNKKNTPLHYAAASGMKAC
FT                   VELLVKHGGDLFAENENRDTPCDCAEKQQHKDLALSLESQMVFSRDPEAEEIEAEYAAL
FT                   DKREPYEGLRPQDLRRLKDMLIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMSNPE
FT                   NCCQRSGVQMPTPPPSGYNAWDTLPSPRTPRTTRSSVTSPDEISLSPGDLDTSLCDICM
FT                   CSISVFEDPVDMPCGHDFCRGCWEAFLNLKIQEGEAHNIFCPAYECFQLVPVDVIESVV
FT                   SKEMDKRYLQFDIKAFVENNPAIKWCPTAGCERAVRLTKQGSNPSGSDTLSFPLLRAPA
FT                   VDCGKGHLFCWECLGEAHEPCDCQTWKNWLQKITEMKPEELVGVSEAYEDAANCLWLLT
FT                   NSKPCANCKSPIQKNEGCNHMQCAKCKYDFCWICLEEWKKHSSSTGGYYRCTRYEVIQH
FT                   VEEQSKEMTVEAEKKHKRFQELDRFMHYYTRYKNHEHSYQLEQRLLKTAKEKMEQLSRA
FT                   LKETEGGCPDTTFIEDAVHVLLKTRRILKCSYPYGFFLEPKSTKKEIFELMQTDLEMVT
FT                   EDLAQKVNRPYLRTPRHKIIRAACLVQQKRQEFLASVARGVAPADSPDAPRRSFAGGTW
FT                   DWEYLGFASPEEYAEFQYRRRHRQQRRRGDVHSLLSNPTDLDEPSESTFDLPEGSSGR"
FT   gene            <739470..777733
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /note="gene_id=mCG6109.3"
FT   mRNA            join(<739470..739770,742706..742855,743586..743745,
FT                   745923..746015,747543..747672,748619..748862,
FT                   749029..749144,749338..749481,754814..754970,
FT                   755598..755705,758375..760073,766894..767060,
FT                   767784..767871,768308..768514,773067..773183,
FT                   777163..777573)
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, transcript
FT                   variant mCT190825"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT190825.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(739476..739770,742706..742855,743586..743745,
FT                   745923..746015,747543..747672,748619..748862,
FT                   749029..749144,749338..749481,754814..754970,
FT                   755598..755705,758375..758531,759922..760073,
FT                   766894..767060,767784..767871,768308..768514,
FT                   773067..773183,777163..777733)
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, transcript
FT                   variant mCT4993"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT4993.2 created on
FT                   07-MAY-2002"
FT   mRNA            join(739476..739770,742752..742855,743586..743745,
FT                   745923..746015,747543..747672,748619..748862,
FT                   749029..749144,749338..749481,754814..754970,
FT                   755598..755705,758375..758531,759922..760073,
FT                   766894..767060,767784..767871,768308..768514,
FT                   773067..773183,777163..777733)
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, transcript
FT                   variant mCT168993"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT168993.0 created
FT                   on 07-MAY-2002"
FT   mRNA            join(<739476..739887,742752..742855,743586..743745,
FT                   745923..746015,747543..747672,748619..748862,
FT                   749029..749144,749338..749481,749559..749706,
FT                   754814..754970,755598..755705,758375..758531,
FT                   759922..760073,766894..767060,767784..767871,
FT                   768308..768514,773067..773183,777163..777646)
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, transcript
FT                   variant mCT190827"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT190827.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<739729..739770,742706..742855,743586..743745,
FT                   745923..746015,747543..747672,748619..748862,
FT                   749029..749144,749338..749481,754814..754970,
FT                   755598..755705,758375..758545)
FT                   /codon_start=1
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, isoform CRA_b"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT190825.0
FT                   protein_id=mCP111794.0 isoform=CRA_b"
FT                   /protein_id="EDL14619.1"
FT                   /translation="LGCSGSGEDPPPARLCHFLFQGTFCLFYKAMGNPENIEDAYVAVI
FT                   RPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQSNSEIAQGILDYVVE
FT                   TTKPISPANQGIKGKRVVLMRKFPLDGEKTGREAALFIVPSVVKDNTKYAYTPGCPIFY
FT                   CLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRPSPLERIKTNVIN
FT                   PAYAAELGQVDNSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQYTNRVDKVVINP
FT                   YFGLGAPDYSKIQIPKQEKWQRSMSSVVEDKERQWVDDFPLHRNACEGDSELLSHLLDK
FT                   GLSVNQLDNDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLHFAAGGGHAE
FT                   IVQILLTHPDIDRHITDQQGRSPLNVCEENKQNNWEEAAKLLKDAINKPYEKVRIYRMD
FT                   GSYRSVELKHGNNTTAQQIMEGMRLSQETQRYFTIWICSENLSKKT"
FT   mRNA            join(<742751..742855,743586..743745,745923..746015,
FT                   747543..747672,748619..748862,749029..749144,
FT                   749338..749481,754814..754970,755598..755705,
FT                   758375..758531,759922..760073,766894..767060,
FT                   767784..767871,768308..768514,777163..777251)
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, transcript
FT                   variant mCT190826"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT190826.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<742751..742855,743586..743745,745923..746015,
FT                   747543..747672,748619..748862,749029..749144,
FT                   749338..749481,754814..754970,755598..755705,
FT                   758375..758531,759922..760073,766894..767060,
FT                   767784..767871,768308..768514,777163..777231)
FT                   /codon_start=1
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, isoform CRA_c"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT190826.0
FT                   protein_id=mCP111795.0 isoform=CRA_c"
FT                   /protein_id="EDL14620.1"
FT                   /translation="AMGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEG
FT                   QKKKRKKVLLETKLQSNSEIAQGILDYVVETTKPISPANQGIKGKRVVLMRKFPLDGEK
FT                   TGREAALFIVPSVVKDNTKYAYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDK
FT                   WLDERHAQSHFIPALFRPSPLERIKTNVINPAYAAELGQVDNSLHMGYSALEIKSKMLA
FT                   LEKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVVE
FT                   DKERQWVDDFPLHRNACEGDSELLSHLLDKGLSVNQLDNDHWAPIHYACWYGKVEATRI
FT                   LLEKGKCNPNLLNGQLSSPLHFAAGGGHAEIVQILLTHPDIDRHITDQQGRSPLNVCEE
FT                   NKQNNWEEAAKLLKDAINKPYEKVRIYRMDGSYRSVELKHGNNTTAQQIMEGMRLSQET
FT                   QRYFTIWICSENLSLQFKPYHKPLQQVHDWPEILAELTNLDPQRETPQLFLRRDVGLPL
FT                   EVEKKIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGF
FT                   LNEETLKSIVPITKLKSKAPHWINRILHEYKNLSLSEGVSKEMHHLQRMFLQNCWEIPT
FT                   YGAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKAGLVVKLLMKLNGQLMPS
FT                   ERNS"
FT   CDS             join(742754..742855,743586..743745,745923..746015,
FT                   747543..747672,748619..748862,749029..749144,
FT                   749338..749481,754814..754970,755598..755705,
FT                   758375..758531,759922..760073,766894..767060,
FT                   767784..767871,768308..768514,773067..773183,
FT                   777163..777231)
FT                   /codon_start=1
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, isoform CRA_a"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT168993.0
FT                   protein_id=mCP91858.0 isoform=CRA_a"
FT                   /db_xref="GOA:B2RUA8"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1930618"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUA8"
FT                   /protein_id="EDL14618.1"
FT                   /translation="MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQ
FT                   KKKRKKVLLETKLQSNSEIAQGILDYVVETTKPISPANQGIKGKRVVLMRKFPLDGEKT
FT                   GREAALFIVPSVVKDNTKYAYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKW
FT                   LDERHAQSHFIPALFRPSPLERIKTNVINPAYAAELGQVDNSLHMGYSALEIKSKMLAL
FT                   EKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVVED
FT                   KERQWVDDFPLHRNACEGDSELLSHLLDKGLSVNQLDNDHWAPIHYACWYGKVEATRIL
FT                   LEKGKCNPNLLNGQLSSPLHFAAGGGHAEIVQILLTHPDIDRHITDQQGRSPLNVCEEN
FT                   KQNNWEEAAKLLKDAINKPYEKVRIYRMDGSYRSVELKHGNNTTAQQIMEGMRLSQETQ
FT                   RYFTIWICSENLSLQFKPYHKPLQQVHDWPEILAELTNLDPQRETPQLFLRRDVGLPLE
FT                   VEKKIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFL
FT                   NEETLKSIVPITKLKSKAPHWINRILHEYKNLSLSEGVSKEMHHLQRMFLQNCWEIPTY
FT                   GAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYCCFTWQLGDAG
FT                   TCFQIHSMENKMSFIVHTKQAGLVVKLLMKLNGQLMPSERNS"
FT   CDS             join(742754..742855,743586..743745,745923..746015,
FT                   747543..747672,748619..748862,749029..749144,
FT                   749338..749481,754814..754970,755598..755705,
FT                   758375..758531,759922..760073,766894..767060,
FT                   767784..767871,768308..768514,773067..773183,
FT                   777163..777231)
FT                   /codon_start=1
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, isoform CRA_a"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT4993.2
FT                   protein_id=mCP6552.2 isoform=CRA_a"
FT                   /db_xref="GOA:B2RUA8"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1930618"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUA8"
FT                   /protein_id="EDL14622.1"
FT                   /translation="MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQ
FT                   KKKRKKVLLETKLQSNSEIAQGILDYVVETTKPISPANQGIKGKRVVLMRKFPLDGEKT
FT                   GREAALFIVPSVVKDNTKYAYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKW
FT                   LDERHAQSHFIPALFRPSPLERIKTNVINPAYAAELGQVDNSLHMGYSALEIKSKMLAL
FT                   EKADTCIYNPLFGSDLQYTNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVVED
FT                   KERQWVDDFPLHRNACEGDSELLSHLLDKGLSVNQLDNDHWAPIHYACWYGKVEATRIL
FT                   LEKGKCNPNLLNGQLSSPLHFAAGGGHAEIVQILLTHPDIDRHITDQQGRSPLNVCEEN
FT                   KQNNWEEAAKLLKDAINKPYEKVRIYRMDGSYRSVELKHGNNTTAQQIMEGMRLSQETQ
FT                   RYFTIWICSENLSLQFKPYHKPLQQVHDWPEILAELTNLDPQRETPQLFLRRDVGLPLE
FT                   VEKKIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFL
FT                   NEETLKSIVPITKLKSKAPHWINRILHEYKNLSLSEGVSKEMHHLQRMFLQNCWEIPTY
FT                   GAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYCCFTWQLGDAG
FT                   TCFQIHSMENKMSFIVHTKQAGLVVKLLMKLNGQLMPSERNS"
FT   CDS             join(<749603..749706,754814..754970,755598..755705,
FT                   758375..758531,759922..760073,766894..767060,
FT                   767784..767871,768308..768514,773067..773183,
FT                   777163..777231)
FT                   /codon_start=1
FT                   /gene="Krit1"
FT                   /locus_tag="mCG_6109"
FT                   /product="KRIT1, ankyrin repeat containing, isoform CRA_d"
FT                   /note="gene_id=mCG6109.3 transcript_id=mCT190827.0
FT                   protein_id=mCP111796.0 isoform=CRA_d"
FT                   /protein_id="EDL14621.1"
FT                   /translation="SFDYCVYAAVRNCQICPEESTRSLLYKPYREIANRYGKVEATRIL
FT                   LEKGKCNPNLLNGQLSSPLHFAAGGGHAEIVQILLTHPDIDRHITDQQGRSPLNVCEEN
FT                   KQNNWEEAAKLLKDAINKPYEKVRIYRMDGSYRSVELKHGNNTTAQQIMEGMRLSQETQ
FT                   RYFTIWICSENLSLQFKPYHKPLQQVHDWPEILAELTNLDPQRETPQLFLRRDVGLPLE
FT                   VEKKIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFL
FT                   NEETLKSIVPITKLKSKAPHWINRILHEYKNLSLSEGVSKEMHHLQRMFLQNCWEIPTY
FT                   GAAFFTGQIFTKASPSNHKVIPVYVGVNIKGLHLLNMETKALLISLKYCCFTWQLGDAG
FT                   TCFQIHSMENKMSFIVHTKQAGLVVKLLMKLNGQLMPSERNS"
FT   gene            794918..802953
FT                   /locus_tag="mCG_115269"
FT                   /note="gene_id=mCG115269.0"
FT   mRNA            join(794918..795116,800119..800280,801954..802071,
FT                   802652..802953)
FT                   /locus_tag="mCG_115269"
FT                   /product="mCG115269"
FT                   /note="gene_id=mCG115269.0 transcript_id=mCT116370.0
FT                   created on 07-MAY-2002"
FT   CDS             join(794948..795116,800119..800280,801954..802071,
FT                   802652..802835)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115269"
FT                   /product="mCG115269"
FT                   /note="gene_id=mCG115269.0 transcript_id=mCT116370.0
FT                   protein_id=mCP87793.1"
FT                   /protein_id="EDL14623.1"
FT                   /translation="MTQLKILNISNNAIKDIPKNIGELRSLVSFYASNNQISSLPSSFL
FT                   SLEVLQSLDLRGNNMTALPSGIYKLSSLKEINFDDNPLMRPPMEICKGKEMHMITCYLQ
FT                   RADERDEKILEKIFNIVANSITETNFEFLQQKLNMASSANNMPVRPTTPLNERIYQALI
FT                   KWKAEKDVQFTATALRDKLFRALNMIGAYDIMDKITALNLYTSAIKL"
FT   gene            811761..812645
FT                   /pseudo
FT                   /locus_tag="mCG_6110"
FT                   /note="gene_id=mCG6110.0"
FT   mRNA            811761..812645
FT                   /pseudo
FT                   /locus_tag="mCG_6110"
FT                   /note="gene_id=mCG6110.0 transcript_id=mCT4994.0 created on
FT                   07-MAY-2002"
FT   gene            complement(826887..830233)
FT                   /locus_tag="mCG_6121"
FT                   /note="gene_id=mCG6121.1"
FT   mRNA            complement(join(826887..828203,830181..830233))
FT                   /locus_tag="mCG_6121"
FT                   /product="mCG6121"
FT                   /note="gene_id=mCG6121.1 transcript_id=mCT4979.2 created on
FT                   09-MAY-2002"
FT   CDS             complement(827033..828178)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6121"
FT                   /product="mCG6121"
FT                   /note="gene_id=mCG6121.1 transcript_id=mCT4979.2
FT                   protein_id=mCP6546.2"
FT                   /protein_id="EDL14624.1"
FT                   /translation="MIMASRNIWCVRRNFLFDLRDWMLQYSAEVFLKSISFRPFSAECD
FT                   SKDKESLEEEREDLLSNLVTMGVDIDMARRRQPGVFNKAVTNEQELKLFLLSKGASDKV
FT                   IGSIISRYPRAITRTPESLSKRWDLWRKIMASDLEIVNILERSPESFFRSNNNLNLENN
FT                   IKFLCSVGLTHKCLCRLLTNAPRTFSNSLNLNKQMVEFLQETGMSLGHNDPRDFVRKII
FT                   SKNPSILIQSTKRVKTNIEFLQSTFNLNKRDLLLLICGPGARILDLSNDCTKKNYTNIR
FT                   ERLLSLGCSEEEVQRFVLSYLNMVFLSEKKFNDKIDCLIEEKISASQIIENPRILDSSI
FT                   NTLKTRIRELSHAGYDLSTSSIALLSWSQRRYEAKLKRLCG"
FT   gene            864590..1010277
FT                   /gene="Akap9"
FT                   /locus_tag="mCG_140324"
FT                   /note="gene_id=mCG140324.1"
FT   mRNA            join(864590..864797,884915..885130,887923..887967,
FT                   890630..890683,891024..891194,892390..892545,
FT                   893857..894033,896335..898680,904622..904835,
FT                   906706..906779,907944..908079,908798..908883,
FT                   911639..911750,912168..912366,917160..917256,
FT                   921052..921144,930437..930790,932593..932814,
FT                   933835..933975,934442..934545,937376..937581,
FT                   942886..943115,957430..957592,958895..959107,
FT                   961736..961968,963146..963265,966927..967103,
FT                   967637..967741,972305..972457,973186..973365,
FT                   974285..975328,977922..978059,978542..979030,
FT                   979423..979486,979597..979697,985215..985406,
FT                   985646..985822,988504..988648,990350..990563,
FT                   991206..991356,994139..994807,995249..995454,
FT                   995873..995978,997820..998002,999092..999292,
FT                   1000384..1000616,1002696..1002781,1007269..1007398,
FT                   1007911..1008050,1009732..1010273)
FT                   /gene="Akap9"
FT                   /locus_tag="mCG_140324"
FT                   /product="A kinase (PRKA) anchor protein (yotiao) 9,
FT                   transcript variant mCT168975"
FT                   /note="gene_id=mCG140324.1 transcript_id=mCT168975.0
FT                   created on 07-MAY-2002"
FT   mRNA            join(<864597..864797,884915..885130,887923..887967,
FT                   891024..891194,892390..892545,893857..894033,
FT                   896335..898680,904622..904835,906706..906779,
FT                   907944..908079,908798..908883,911639..911750,
FT                   912168..912366,917160..917256,921052..921144,
FT                   930437..930790,932593..932814,933835..933975,
FT                   934442..934545,937376..937581,942886..943115,
FT                   957430..957592,958895..959107,961736..961968,
FT                   963146..963265,966927..967103,967637..967741,
FT                   972305..972457,973186..973365,974285..975328,
FT                   978542..979030,979423..979486,979597..979697,
FT                   985215..985406,985646..985822,988504..988648,
FT                   990350..990563,991206..991356,994139..994807,
FT                   995249..995454,995873..995978,997820..998002,
FT                   999092..999292,1000384..1000616,1002696..1002781,
FT                   1007269..1007398,1007911..1008050,1009732..1010277)
FT                   /gene="Akap9"
FT                   /locus_tag="mCG_140324"
FT                   /product="A kinase (PRKA) anchor protein (yotiao) 9,
FT                   transcript variant mCT190839"
FT                   /note="gene_id=mCG140324.1 transcript_id=mCT190839.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<864654..864797,884915..885130,887923..887967,
FT                   891024..891194,892390..892545,893857..894033,
FT                   896335..898680,904622..904835,906706..906779,
FT                   907944..908079,908798..908883,911639..911750,
FT                   912168..912366,917160..917256,921052..921144,
FT                   930437..930790,932593..932814,933835..933975,
FT                   934442..934545,937376..937581,942886..943115,
FT                   957430..957592,958895..959107,961736..961968,
FT                   963146..963265,966927..967103,967637..967741,
FT                   972305..972457,973186..973365,974285..975328,
FT                   978542..979030,979423..979486,979597..979697,
FT                   985215..985406,985646..985822,988504..988648,
FT                   990350..990563,991206..991356,994139..994807,
FT                   995249..995454,995873..995978,997820..998002,
FT                   999092..999292,1000384..1000616,1002696..1002781,
FT                   1007269..1007398,1007911..1008050,1009732..1009769)
FT                   /codon_start=1
FT                   /gene="Akap9"
FT                   /locus_tag="mCG_140324"
FT                   /product="A kinase (PRKA) anchor protein (yotiao) 9,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG140324.1 transcript_id=mCT190839.0
FT                   protein_id=mCP111779.0 isoform=CRA_b"
FT                   /protein_id="EDL14626.1"
FT                   /translation="APSVSRVATELCPPLSKQIFPLHCVPAYPADAMEDEERQRKLAAG
FT                   KAKLARFRQRKAQYDGDIPKKQKKKRTSSSKHDSSLHTDQQSGELCSESSQRVDLAGNP
FT                   DCSGPERKHGQVFSAEPESEISTTADECSSEEEEFSLDDSSSEQGAQSSQTCLQMVEKE
FT                   LAEKQHDIEELTQELEEMRASFGTEGLKQLQEFEAAIKQRDGIITQLTANLQQARREKD
FT                   DTMVEFLELTEQSQKLQIQFQHLQANETLQNSTLSRTATDLLQAKRQIFTQQQQLQDYQ
FT                   KKEEDLQAQISFLQEKLRAFEMEKDRKIENLNAKEIQEKQALIDELNTRVVEEEKKTVE
FT                   LKNKVTTADELLGGLHEQLTQRNQEIQSLKLELGNSQQNERKCSEEIKELMRTVEELQK
FT                   RNLKDSWLETSAVRRVEQETQRKLSHLQAELDEMYGKQIVQMKQELINQHMSQIEELKS
FT                   QHKREMENTLKSDTNAAISKEQVNLMNAAINELNVRLQETHAQKEELKGELGVVLGEKS
FT                   ALQSQSNDLLEEVRFLREQVQKARQTIAEQENRLSEARKSLSTVEDLKAEIVAASESRK
FT                   ELELKHEAEITNYKIKLEMLEKEKNAVLDRMAESQEAELERLRTQLLFSHEEELSKLKE
FT                   DLEVEHRINIEKLKDNLGIHYKQQIDGLQNEMNRKMESMQCETDNLITQQNQLILENSK
FT                   LRDLQECLVNSKSEEMNLQINELQKEIEILKQEEKEKGTLEQEVQELQLKTEQLEKQLK
FT                   EKEDDLQEKCAQLDAENNILKEEKRVLEDKLKMYSPSEQEERSIAVDPSTSKSADSRWQ
FT                   KEVAMLRKETEDLQQQCLYLNEEIEKQRNTFAFAEKNFEVNYQELQREYTCLLKIRDDL
FT                   EATQTKQALEYESKLRALEEELLSKRGNPAAPKGKSSGIFPSETLEIGEVVEKDTTELM
FT                   EKLEVTKREKLELSEKVSGLSEQLKQTHCTINSLSAEVRALKQEKEQLLLRCGELELLA
FT                   NPSGTENAAVCPVQMSSYQAGLVMGKVGDSGGSISKISKDLAEESKPMIEDKIPFKESG
FT                   REQLLLPTRAQKPSHATVEPCESEKLQQELHALKAEQDDLRLQMEAQRICLFVVYSTHA
FT                   DQVRAHMEKEREEALCSLKDELISAQQKKIDELHKMHQCQLQNFKIQETGDEPLQVLIE
FT                   RLQQAVSEKCFHISKTLNNVFDECYTPLKCEMNIEEKENSGVYTSQNQSPELQEYRYEV
FT                   QDFQESMQVLLGKVTEECRKLSGLQTRLGKIHEQQTDGVALEFAEQNAAEEEAGLLSGC
FT                   SQSALQSTDVSLESKVSSLPASEKNRECERQVQELQSPVAAGQLQLTETEANHRAEIEC
FT                   LQQRLEAVSEAPVQPSLSIDSVVFKGSGAQKPVYCGSCLREYVDGTAKFSDRFEVRQET
FT                   NMVNLMEKQYQERLEEEIAKVIVSMSIAFAQQTELSRLSEGKENTIQSEQAHTLCSQNK
FT                   HQLNDITSQSQVGLQTFEATDKNFKEEFKPLSKELGEYRKAVPLSSHDDLDDILKSEEH
FT                   GLAISEEIFSKDETFIVRKSMHDEVLVSSMDTSRQLILNEQLEDMRQELVRQYEEHQQA
FT                   TEMLRQAHMQQMERQREDQEQLQEEIKRLNEQLTQKSSIDTEHVVSERERVLLEELEAL
FT                   KQLPLAGRKELCCELRHSSTQTQDGHDDQEVEEQTLKDKTLERSPEDALLDRNLSNERY
FT                   ALKKANNRLLKILLEVVKTTSAAEETIGRHVLGILDRSSKGQTASSLLWRSEADASATT
FT                   CAPEDCARAMDESIPSYPGTAIATHDSIWSKVTEEGAELSQRLVRSGFAGPVIDPENEE
FT                   LMLNISSRLQAAVEKLLEAISETNTQLEHAKVTQTELMRESFRQKQEATESLHCLEELR
FT                   ERLQEESRAREQLAEELNKAESVIDGYSDEKTLFERQIQEKTDIIEHLEQEVLCMNNRL
FT                   QELESDQRRVEEERQLLCRQREAMRAEAGPVEQQFLQETEKLMKEKLEVQCQAEKVRGD
FT                   LQKQVKALEIDVEEQVSRFIELEQEKNAELTDLRQQSQALEKQLEKMRKFLDEQAIDRE
FT                   HERDVFQQEIQKLEHQLKAAPRIQPVSEHQAREVEQLTNHLKEKTDRCSELLLSKEQLQ
FT                   RDIQERNEEIEKLECRVRELEQALLASAEPFPKVEDQKRSGAVEADPELSLEVQLQVER
FT                   DATDRKQKEITNLEEQLEQFREELENKNDEVQELLMQLEIQRKESTTRLQELQQENRLF
FT                   KDEIEKLGFAMKESDSVSTRDQPMLFGKFAQLIQEKEIEIDRLNEQFIKLQQQLKLTTD
FT                   NKVIEEQKEQIQDLETQIERLMSEREHEKKQREEEVEQLTGVVEKLQQEVVSTEQQREG
FT                   ARTLPEDEESFKHQLDKVTAEKLVLEQQVETTNQVMTHMNNVLKEINFKMDQITQLLCN
FT                   LNKECASNEELPSLPKESVHMTVHELGSDNLQPEDAPAQDVTKPLEKQTSLTRLQKSPE
FT                   ASRTQEIESLASSVGAKDVELTQCREQTETIQEQAQSETDRLQKKLTDLQRSLEKFAAA
FT                   LVSQVQMEAAQEYVPFHQEKQPVSSAPGSTDIQNANGLTGASTESLIPTVTLRLAEVES
FT                   RVAEVHSGTMSEKLVGIVGGNASETEKRVIELQKLLEEAEERPEEGGEQSSRDGEVRES
FT                   YMTSLQKDLGQVKDPLTEAKEKLSYSLEKEKRTGEQESREAPIPEPPSVEVGGCSGLTE
FT                   RTDKVSSSGNQTLQILLRDAAIQTDLQSESSQEEVRDTINQLTKKMEHIQELHAAEILD
FT                   MESRHILETESLKKEHYVAIQLLTKECETLKEMTQCLRCKEGSSIPELADSVAYQSREV
FT                   YSSDSESDWGQSQGFDTAIEGREEGETSADLFPKKIKGLVKAVHSEGMQVLSLSSPLCD
FT                   DGEDRSIQQLSESWLKERQAYLNTISSLKDLISKMQVRRETEVYDRCHLSDWRGELLLA
FT                   CQRVFIKERSVLLATFQTELTSLSTRDVDGLLNSLEQRIQEQGIEYHTAMDCLQKADRR
FT                   SLLAEIEDLRAQINGGKMTLEREQGTEKSSQELLDCSMQQKQSLEMQLELSSLRDRAAE
FT                   LQEQLSSEKMVVAELKSELAQAKLELGTTLKAQHKRLKELEAFRSEVKEKTDEIHFLSD
FT                   TLAREQKNSLELQWALEKEKARSGHHEEREKEELEDLKFSLEDQKRRNTQLNLLLEQQK
FT                   QLLNESQQKIESQKMLHDAQLSEEQGRNLGLQALLESEQVRIQEMKSTLDKERELYAQL
FT                   QSREDGGQPPPALPSEDLLKELQKQLEEKHSRIVELLSETEKYKLDSLQTRQQMEKDRQ
FT                   VHQKTLQTEQEANTQGQKKMQELQSKVEELQRQLQEKRQQVYKLDLEGKRLQGLMQEFQ
FT                   KQELEPEEKPGSRGLVDQNLNEPATWNFTDDRTRNWVLQQKMGEAKDRNFTKLIEINGG
FT                   ELDHNHDLEMIRQTLQHVASKLQHVAQKACSRLQFETAGDDAFIWIQENIDGIILQLQK
FT                   LTGQPGDEHSLGPPSSSCGSLTESLMRQNTELTRLINQLTEEKNTLRSIVIKLEELNRC
FT                   YWHTGASRDCCSRFSFIDPADIEAIIASEKEVWNREKLSLQKALKRAEAKVYKLKAELR
FT                   NDALLRNLGPDTDHAALQKIYNKYLRASSFRKALIYQKKYLLLLLGGFQECEDVTLGVL
FT                   ARMGGHLALKDSKTITNHPKAFSRFRSAVRVSIAISRMKFLVRRWQQVTSTSSININRD
FT                   GFGLSPGIEKTDPFYHSPGGLQLYGEPRHTMYRSRFDLDYPRSLLPLQNRYPGTPGDLN
FT                   SISMASSQLHQYNPDKSLTDYVTRLEALRRRLGAIQSGSTTQFHFGMRR"
FT   CDS             join(864750..864797,884915..885130,887923..887967,
FT                   890630..890683,891024..891194,892390..892545,
FT                   893857..894033,896335..898680,904622..904835,
FT                   906706..906779,907944..908079,908798..908883,
FT                   911639..911750,912168..912366,917160..917256,
FT                   921052..921144,930437..930790,932593..932814,
FT                   933835..933975,934442..934545,937376..937581,
FT                   942886..943115,957430..957592,958895..959107,
FT                   961736..961968,963146..963265,966927..967103,
FT                   967637..967741,972305..972457,973186..973365,
FT                   974285..975328,977922..978059,978542..979030,
FT                   979423..979486,979597..979697,985215..985406,
FT                   985646..985822,988504..988648,990350..990563,
FT                   991206..991356,994139..994807,995249..995454,
FT                   995873..995978,997820..998002,999092..999292,
FT                   1000384..1000616,1002696..1002781,1007269..1007398,
FT                   1007911..1008050,1009732..1009769)
FT                   /codon_start=1
FT                   /gene="Akap9"
FT                   /locus_tag="mCG_140324"
FT                   /product="A kinase (PRKA) anchor protein (yotiao) 9,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG140324.1 transcript_id=mCT168975.0
FT                   protein_id=mCP91873.0 isoform=CRA_a"
FT                   /protein_id="EDL14625.1"
FT                   /translation="MEDEERQRKLAAGKAKLARFRQRKAQYDGDIPKKQKKKRTSSSKH
FT                   DSSLHTDQQSGELCSESSQRVDLAGNPDCSGPERKHGQVFSAEPESEISTTADECSSEI
FT                   NGCNSVMKPRKPTDPLREEEFSLDDSSSEQGAQSSQTCLQMVEKELAEKQHDIEELTQE
FT                   LEEMRASFGTEGLKQLQEFEAAIKQRDGIITQLTANLQQARREKDDTMVEFLELTEQSQ
FT                   KLQIQFQHLQANETLQNSTLSRTATDLLQAKRQIFTQQQQLQDYQKKEEDLQAQISFLQ
FT                   EKLRAFEMEKDRKIENLNAKEIQEKQALIDELNTRVVEEEKKTVELKNKVTTADELLGG
FT                   LHEQLTQRNQEIQSLKLELGNSQQNERKCSEEIKELMRTVEELQKRNLKDSWLETSAVR
FT                   RVEQETQRKLSHLQAELDEMYGKQIVQMKQELINQHMSQIEELKSQHKREMENTLKSDT
FT                   NAAISKEQVNLMNAAINELNVRLQETHAQKEELKGELGVVLGEKSALQSQSNDLLEEVR
FT                   FLREQVQKARQTIAEQENRLSEARKSLSTVEDLKAEIVAASESRKELELKHEAEITNYK
FT                   IKLEMLEKEKNAVLDRMAESQEAELERLRTQLLFSHEEELSKLKEDLEVEHRINIEKLK
FT                   DNLGIHYKQQIDGLQNEMNRKMESMQCETDNLITQQNQLILENSKLRDLQECLVNSKSE
FT                   EMNLQINELQKEIEILKQEEKEKGTLEQEVQELQLKTEQLEKQLKEKEDDLQEKCAQLD
FT                   AENNILKEEKRVLEDKLKMYSPSEQEERSIAVDPSTSKSADSRWQKEVAMLRKETEDLQ
FT                   QQCLYLNEEIEKQRNTFAFAEKNFEVNYQELQREYTCLLKIRDDLEATQTKQALEYESK
FT                   LRALEEELLSKRGNPAAPKGKSSGIFPSETLEIGEVVEKDTTELMEKLEVTKREKLELS
FT                   EKVSGLSEQLKQTHCTINSLSAEVRALKQEKEQLLLRCGELELLANPSGTENAAVCPVQ
FT                   MSSYQAGLVMGKVGDSGGSISKISKDLAEESKPMIEDKIPFKESGREQLLLPTRAQKPS
FT                   HATVEPCESEKLQQELHALKAEQDDLRLQMEAQRICLFVVYSTHADQVRAHMEKEREEA
FT                   LCSLKDELISAQQKKIDELHKMHQCQLQNFKIQETGDEPLQVLIERLQQAVSEKCFHIS
FT                   KTLNNVFDECYTPLKCEMNIEEKENSGVYTSQNQSPELQEYRYEVQDFQESMQVLLGKV
FT                   TEECRKLSGLQTRLGKIHEQQTDGVALEFAEQNAAEEEAGLLSGCSQSALQSTDVSLES
FT                   KVSSLPASEKNRECERQVQELQSPVAAGQLQLTETEANHRAEIECLQQRLEAVSEAPVQ
FT                   PSLSIDSVVFKGSGAQKPVYCGSCLREYVDGTAKFSDRFEVRQETNMVNLMEKQYQERL
FT                   EEEIAKVIVSMSIAFAQQTELSRLSEGKENTIQSEQAHTLCSQNKHQLNDITSQSQVGL
FT                   QTFEATDKNFKEEFKPLSKELGEYRKAVPLSSHDDLDDILKSEEHGLAISEEIFSKDET
FT                   FIVRKSMHDEVLVSSMDTSRQLILNEQLEDMRQELVRQYEEHQQATEMLRQAHMQQMER
FT                   QREDQEQLQEEIKRLNEQLTQKSSIDTEHVVSERERVLLEELEALKQLPLAGRKELCCE
FT                   LRHSSTQTQDGHDDQEVEEQTLKDKTLERSPEDALLDRNLSNERYALKKANNRLLKILL
FT                   EVVKTTSAAEETIGRHVLGILDRSSKGQTASSLLWRSEADASATTCAPEDCARAMDESI
FT                   PSYPGTAIATHDSIWSKVTEEGAELSQRLVRSGFAGPVIDPENEELMLNISSRLQAAVE
FT                   KLLEAISETNTQLEHAKVTQTELMRESFRQKQEATESLHCLEELRERLQEESRAREQLA
FT                   EELNKAESVIDGYSDEKTLFERQIQEKTDIIEHLEQEVLCMNNRLQELESDQRRVEEER
FT                   QLLCRQREAMRAEAGPVEQQFLQETEKLMKEKLEVQCQAEKVRGDLQKQVKALEIDVEE
FT                   QVSRFIELEQEKNAELTDLRQQSQALEKQLEKMRKFLDEQAIDREHERDVFQQEIQKLE
FT                   HQLKAAPRIQPVSEHQAREVEQLTNHLKEKTDRCSELLLSKEQLQRDIQERNEEIEKLE
FT                   CRVRELEQALLASAEPFPKVEDQKRSGAVEADPELSLEVQLQVERDATDRKQKEITNLE
FT                   EQLEQFREELENKNDEVQELLMQLEIQRKESTTRLQELQQENRLFKDEIEKLGFAMKES
FT                   DSVSTRDQPMLFGKFAQLIQEKEIEIDRLNEQFIKLQQQLKLTTDNKVIEEQKEQIQDL
FT                   ETQIERLMSEREHEKKQREEEVEQLTGVVEKLQQEVVSTEQQREGARTLPEDEESFKHQ
FT                   LDKVTAEKLVLEQQVETTNQVMTHMNNVLKEINFKMDQITQLLCNLNKECASNEELPSL
FT                   PKESVHMTVHELGSDNLQPEDAPAQDVTKPLEKQTSLTRLQKSPEASRTQEIESLASSV
FT                   GAKDVELTQCREQTETIQEQAQSETDRLQKKLTDLQRSLEKFAAALVSQVQMEAAQEYV
FT                   PFHQEKQPVSSAPGSTDIQNANGLTGASTESLIPTVTLRLAEVESRVAEVHSGTMSEKL
FT                   VGIVGGNASETEKRVIELQKLLEEAEERPEEGGEQSSRDGETTVNLTHASGDRGVLGGP
FT                   EALEAESIATSELASYKERTEKLEEDLFVRESYMTSLQKDLGQVKDPLTEAKEKLSYSL
FT                   EKEKRTGEQESREAPIPEPPSVEVGGCSGLTERTDKVSSSGNQTLQILLRDAAIQTDLQ
FT                   SESSQEEVRDTINQLTKKMEHIQELHAAEILDMESRHILETESLKKEHYVAIQLLTKEC
FT                   ETLKEMTQCLRCKEGSSIPELADSVAYQSREVYSSDSESDWGQSQGFDTAIEGREEGET
FT                   SADLFPKKIKGLVKAVHSEGMQVLSLSSPLCDDGEDRSIQQLSESWLKERQAYLNTISS
FT                   LKDLISKMQVRRETEVYDRCHLSDWRGELLLACQRVFIKERSVLLATFQTELTSLSTRD
FT                   VDGLLNSLEQRIQEQGIEYHTAMDCLQKADRRSLLAEIEDLRAQINGGKMTLEREQGTE
FT                   KSSQELLDCSMQQKQSLEMQLELSSLRDRAAELQEQLSSEKMVVAELKSELAQAKLELG
FT                   TTLKAQHKRLKELEAFRSEVKEKTDEIHFLSDTLAREQKNSLELQWALEKEKARSGHHE
FT                   EREKEELEDLKFSLEDQKRRNTQLNLLLEQQKQLLNESQQKIESQKMLHDAQLSEEQGR
FT                   NLGLQALLESEQVRIQEMKSTLDKERELYAQLQSREDGGQPPPALPSEDLLKELQKQLE
FT                   EKHSRIVELLSETEKYKLDSLQTRQQMEKDRQVHQKTLQTEQEANTQGQKKMQELQSKV
FT                   EELQRQLQEKRQQVYKLDLEGKRLQGLMQEFQKQELEPEEKPGSRGLVDQNLNEPATWN
FT                   FTDDRTRNWVLQQKMGEAKDRNFTKLIEINGGELDHNHDLEMIRQTLQHVASKLQHVAQ
FT                   KACSRLQFETAGDDAFIWIQENIDGIILQLQKLTGQPGDEHSLGPPSSSCGSLTESLMR
FT                   QNTELTRLINQLTEEKNTLRSIVIKLEELNRCYWHTGASRDCCSRFSFIDPADIEAIIA
FT                   SEKEVWNREKLSLQKALKRAEAKVYKLKAELRNDALLRNLGPDTDHAALQKIYNKYLRA
FT                   SSFRKALIYQKKYLLLLLGGFQECEDVTLGVLARMGGHLALKDSKTITNHPKAFSRFRS
FT                   AVRVSIAISRMKFLVRRWQQVTSTSSININRDGFGLSPGIEKTDPFYHSPGGLQLYGEP
FT                   RHTMYRSRFDLDYPRSLLPLQNRYPGTPGDLNSISMASSQLHQYNPDKSLTDYVTRLEA
FT                   LRRRLGAIQSGSTTQFHFGMRR"
FT   gene            complement(1011222..1034811)
FT                   /gene="Cyp51"
FT                   /locus_tag="mCG_6112"
FT                   /note="gene_id=mCG6112.2"
FT   mRNA            complement(join(1011222..1013374,1016531..1016699,
FT                   1017849..1017944,1021917..1022112,1022460..1022579,
FT                   1029189..1029363,1030210..1030336,1031243..1031419,
FT                   1032993..1033091,1034199..1034811))
FT                   /gene="Cyp51"
FT                   /locus_tag="mCG_6112"
FT                   /product="cytochrome P450, family 51"
FT                   /note="gene_id=mCG6112.2 transcript_id=mCT4986.2 created on
FT                   09-MAY-2002"
FT   CDS             complement(join(1013196..1013374,1016531..1016699,
FT                   1017849..1017944,1021917..1022112,1022460..1022579,
FT                   1029189..1029363,1030210..1030336,1031243..1031419,
FT                   1032993..1033091,1034199..1034372))
FT                   /codon_start=1
FT                   /gene="Cyp51"
FT                   /locus_tag="mCG_6112"
FT                   /product="cytochrome P450, family 51"
FT                   /note="gene_id=mCG6112.2 transcript_id=mCT4986.2
FT                   protein_id=mCP6556.2"
FT                   /db_xref="GOA:Q8K0C4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:106040"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K0C4"
FT                   /protein_id="EDL14627.1"
FT                   /translation="MVLLGLLQSGGWVLGQAMEQVTGGNLLSTLLIACAFTLSLVYLFR
FT                   LAVGHMVQLPAGAKSPPHIYSPIPFLGHAIAFGKSPIEFLENAYEKYGPVFSFTMVGKT
FT                   FTYLLGSDAAALLFNSKNEDLNAEEVYGRLTTPVFGKGVAYDVPNAIFLEQKKIIKSGL
FT                   NIAHFKQYVPIIEKEAKEYFQSWGESGERNVFEALSELIILTASHCLHGKEIRSQLNEK
FT                   VAQLYADLDGGFTHAAWLLPAWLPLPSFRRRDRAHREIKNIFYKAIQKRRLSKEPAEDI
FT                   LQTLLDSTYKDGRPLTDEEISGMLIGLLLAGQHTSSTTSAWMGFFLAKDKPLQEKCYLE
FT                   QKAVCGEDLPPLTYDQLKDLNLLDRCIKETLRLRPPIMTMMRMAKTPQTVAGYTIPPGH
FT                   QVCVSPTVNQRLKDSWAERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCVGENFAYVQ
FT                   IKTIWSTMLRLYEFDLINGYFPTVNYTTMIHTPENPVIRYKRRSK"
FT   gene            complement(1029429..1030186)
FT                   /locus_tag="mCG_147504"
FT                   /note="gene_id=mCG147504.0"
FT   mRNA            complement(1029429..1030186)
FT                   /locus_tag="mCG_147504"
FT                   /product="mCG147504"
FT                   /note="gene_id=mCG147504.0 transcript_id=mCT187767.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1029877..1030032)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147504"
FT                   /product="mCG147504"
FT                   /note="gene_id=mCG147504.0 transcript_id=mCT187767.0
FT                   protein_id=mCP109535.0"
FT                   /protein_id="EDL14628.1"
FT                   /translation="MSVPAAVSASRPVRSQAAGCHLPRLAISPCRRCRQTPTADVTNVF
FT                   TSLKRS"
FT   gene            complement(1048655..1051416)
FT                   /locus_tag="mCG_1036346"
FT                   /note="gene_id=mCG1036346.0"
FT   mRNA            complement(join(1048655..1048888,1049458..1049573,
FT                   1051290..1051416))
FT                   /locus_tag="mCG_1036346"
FT                   /product="mCG1036346"
FT                   /note="gene_id=mCG1036346.0 transcript_id=mCT154050.0
FT                   created on 09-MAY-2002"
FT   CDS             complement(join(1048705..1048888,1049458..1049492))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036346"
FT                   /product="mCG1036346"
FT                   /note="gene_id=mCG1036346.0 transcript_id=mCT154050.0
FT                   protein_id=mCP87806.1"
FT                   /protein_id="EDL14629.1"
FT                   /translation="MASSANNMPVRPTTSLNERIYQALIKWKAEKDVQFTATALRDKLF
FT                   RALNMIGAYDIMDKITALNLYTSAIKL"
FT   gene            1112697..1117950
FT                   /locus_tag="mCG_113542"
FT                   /note="gene_id=mCG113542.1"
FT   mRNA            join(1112697..1112750,1116635..1117950)
FT                   /locus_tag="mCG_113542"
FT                   /product="mCG113542, transcript variant mCT168974"
FT                   /note="gene_id=mCG113542.1 transcript_id=mCT168974.0
FT                   created on 08-MAY-2002"
FT   mRNA            join(1115926..1116499,1116635..1117949)
FT                   /locus_tag="mCG_113542"
FT                   /product="mCG113542, transcript variant mCT114626"
FT                   /note="gene_id=mCG113542.1 transcript_id=mCT114626.0
FT                   created on 08-MAY-2002"
FT   CDS             1116666..1117805
FT                   /codon_start=1
FT                   /locus_tag="mCG_113542"
FT                   /product="mCG113542, isoform CRA_a"
FT                   /note="gene_id=mCG113542.1 transcript_id=mCT114626.0
FT                   protein_id=mCP87840.1 isoform=CRA_a"
FT                   /db_xref="GOA:B9EJ57"
FT                   /db_xref="InterPro:IPR003690"
FT                   /db_xref="MGI:MGI:3704243"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9EJ57"
FT                   /protein_id="EDL14630.1"
FT                   /translation="MASRNIWCVRRNFLFDLRGWMLQYSAEVFLKSISFRTFSVECDSK
FT                   DKESLEEEREDLLSNLVTMGVDIDMARRRQPGVFNKAVTNEQELKIFLLSKGASDKVIG
FT                   SIISRYPRAITRTPESLSKRWDLWRKIMASDLEIVNILERSPESFFRSNNNLNLENNIK
FT                   FLCSVGLTHKCLCRLLTNAPRTFSNSLNLNKQMVEFLQETGMSLGHNDPRDFVRKIISK
FT                   NPSILIQSTKRVKTNIEFLQSTFNLNKQDLLLLICGPGARILDLSNDCTKKNYTNIRER
FT                   LLSLGCSEEEVQRFVLSYLNMVFLSEKKFNDKIDCLIEEKISASQIIENPRILDSSINT
FT                   LKTRIRELSHAGYDLSTSSIALLSWSQRRYEAKLKRLCG"
FT   CDS             1116666..1117805
FT                   /codon_start=1
FT                   /locus_tag="mCG_113542"
FT                   /product="mCG113542, isoform CRA_a"
FT                   /note="gene_id=mCG113542.1 transcript_id=mCT168974.0
FT                   protein_id=mCP91875.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EJ57"
FT                   /db_xref="InterPro:IPR003690"
FT                   /db_xref="MGI:MGI:3704243"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9EJ57"
FT                   /protein_id="EDL14631.1"
FT                   /translation="MASRNIWCVRRNFLFDLRGWMLQYSAEVFLKSISFRTFSVECDSK
FT                   DKESLEEEREDLLSNLVTMGVDIDMARRRQPGVFNKAVTNEQELKIFLLSKGASDKVIG
FT                   SIISRYPRAITRTPESLSKRWDLWRKIMASDLEIVNILERSPESFFRSNNNLNLENNIK
FT                   FLCSVGLTHKCLCRLLTNAPRTFSNSLNLNKQMVEFLQETGMSLGHNDPRDFVRKIISK
FT                   NPSILIQSTKRVKTNIEFLQSTFNLNKQDLLLLICGPGARILDLSNDCTKKNYTNIRER
FT                   LLSLGCSEEEVQRFVLSYLNMVFLSEKKFNDKIDCLIEEKISASQIIENPRILDSSINT
FT                   LKTRIRELSHAGYDLSTSSIALLSWSQRRYEAKLKRLCG"
FT   gene            <1122957..>1178526
FT                   /locus_tag="mCG_1036372"
FT                   /note="gene_id=mCG1036372.1"
FT   mRNA            join(<1122957..1123057,1178230..>1178526)
FT                   /locus_tag="mCG_1036372"
FT                   /product="mCG1036372"
FT                   /note="gene_id=mCG1036372.1 transcript_id=mCT154076.1
FT                   created on 08-MAY-2002"
FT   CDS             <1178295..>1178526
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036372"
FT                   /product="mCG1036372"
FT                   /note="gene_id=mCG1036372.1 transcript_id=mCT154076.1
FT                   protein_id=mCP87818.1"
FT                   /protein_id="EDL14632.1"
FT                   /translation="NHFQNIWEKTKTKKNKTNLVPLLKEKSPYDIAGVYRKAKEVPLYI
FT                   PETTEHFCGYTPKPVITKCEILIKFSMKSSEC"
FT   gene            1379913..1387035
FT                   /pseudo
FT                   /locus_tag="mCG_56130"
FT                   /note="gene_id=mCG56130.2"
FT   mRNA            1379913..1387035
FT                   /pseudo
FT                   /locus_tag="mCG_56130"
FT                   /note="gene_id=mCG56130.2 transcript_id=mCT56313.2 created
FT                   on 08-MAY-2002"
FT   gene            complement(1685033..1689687)
FT                   /gene="Fzd1"
FT                   /locus_tag="mCG_2957"
FT                   /note="gene_id=mCG2957.1"
FT   mRNA            complement(1685033..1689687)
FT                   /gene="Fzd1"
FT                   /locus_tag="mCG_2957"
FT                   /product="frizzled homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG2957.1 transcript_id=mCT2111.1 created on
FT                   18-SEP-2002"
FT   CDS             complement(1686841..1688769)
FT                   /codon_start=1
FT                   /gene="Fzd1"
FT                   /locus_tag="mCG_2957"
FT                   /product="frizzled homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG2957.1 transcript_id=mCT2111.1
FT                   protein_id=mCP6475.0"
FT                   /db_xref="GOA:O70421"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026548"
FT                   /db_xref="MGI:MGI:1196625"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70421"
FT                   /protein_id="EDL14633.1"
FT                   /translation="MAEEAAPSESRAAGRLSLELCAEALPGRREEVGHEDTASHRRPRA
FT                   DPRRWASGLLLLLWLLEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGIS
FT                   IPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFF
FT                   LCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELC
FT                   VGQNTSDKGTPTPSLLPEFWTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYL
FT                   NYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDM
FT                   RRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTI
FT                   LFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITIL
FT                   ALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH
FT                   DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPC
FT                   PHLQGGGGVPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNS
FT                   KQGETTV"
FT   gene            1696003..1696919
FT                   /pseudo
FT                   /locus_tag="mCG_2955"
FT                   /note="gene_id=mCG2955.1"
FT   mRNA            join(1696003..1696283,1696490..1696919)
FT                   /pseudo
FT                   /locus_tag="mCG_2955"
FT                   /note="gene_id=mCG2955.1 transcript_id=mCT2118.2 created on
FT                   08-MAY-2002"
FT   gene            complement(1715978..>1730322)
FT                   /locus_tag="mCG_145227"
FT                   /note="gene_id=mCG145227.0"
FT   mRNA            complement(join(1715978..1717639,1729455..1729624,
FT                   1730006..>1730322))
FT                   /locus_tag="mCG_145227"
FT                   /product="mCG145227"
FT                   /note="gene_id=mCG145227.0 transcript_id=mCT184651.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1717248..>1717556)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145227"
FT                   /product="mCG145227"
FT                   /note="gene_id=mCG145227.0 transcript_id=mCT184651.0
FT                   protein_id=mCP106061.0"
FT                   /protein_id="EDL14634.1"
FT                   /translation="TLRHARFQRPFLSSSQRSGLKGGSRIVGYSGKASCDSGQVLTPLS
FT                   SQFSFLGINNITASKWQQVFSCCCVRGKGYYLHLLSKVVGYFVIIFCFPPNESKIFS"
FT   gene            complement(1734949..>2327151)
FT                   /gene="Pftk1"
FT                   /locus_tag="mCG_140323"
FT                   /note="gene_id=mCG140323.0"
FT   mRNA            complement(join(1734949..1737948,1820097..1820240,
FT                   1825300..1825439,1854873..1854921,1882162..1882225,
FT                   1943444..1943537,1969057..1969177,2025694..2025817,
FT                   2063536..2063630,2124341..2124420,2168480..2168574,
FT                   2191353..2191598,2320239..2320270,2326822..2326946,
FT                   2327129..>2327151))
FT                   /gene="Pftk1"
FT                   /locus_tag="mCG_140323"
FT                   /product="PFTAIRE protein kinase 1"
FT                   /note="gene_id=mCG140323.0 transcript_id=mCT168973.0
FT                   created on 09-MAY-2002"
FT   CDS             complement(join(1820125..1820240,1825300..1825439,
FT                   1854873..1854921,1882162..1882225,1943444..1943537,
FT                   1969057..1969177,2025694..2025817,2063536..2063630,
FT                   2124341..2124420,2168480..2168574,2191353..2191598,
FT                   2320239..2320270,2326822..2326946,2327129..2327151))
FT                   /codon_start=1
FT                   /gene="Pftk1"
FT                   /locus_tag="mCG_140323"
FT                   /product="PFTAIRE protein kinase 1"
FT                   /note="gene_id=mCG140323.0 transcript_id=mCT168973.0
FT                   protein_id=mCP91860.0"
FT                   /protein_id="EDL14635.1"
FT                   /translation="MAAAPGTTFAKLPGPYAAQMCDLIEPQPAEKIGKMKKLRRTLSES
FT                   FSRIALKKEDTTFDEICVTKMSTRNCQGTDSVIKHLDTIPEDKKVRVQRTQSTFDPFEK
FT                   PANQVKRVHSENNACINFKSSSAGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEG
FT                   SYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIREASLLKGLKHANIVLLHDIIHTK
FT                   ETLTLVFEYVLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSV
FT                   PSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQL
FT                   ERIFLVLGTPNEDTWPGVHSLPHFKPERFTVYSSKSLRQAWNKLSYVNHAEDLASKLLQ
FT                   CSPKNRLSAQAALSHEYFSDLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSY
FT                   GKSLSNSKH"
FT   gene            complement(2384882..>2426321)
FT                   /locus_tag="mCG_64622"
FT                   /note="gene_id=mCG64622.3"
FT   mRNA            complement(join(2384882..2384972,2397687..2397733,
FT                   2399084..2399146,2402976..2403069,2404364..2404457,
FT                   2413711..2413757,2426107..>2426254))
FT                   /locus_tag="mCG_64622"
FT                   /product="mCG64622, transcript variant mCT64805"
FT                   /note="gene_id=mCG64622.3 transcript_id=mCT64805.1 created
FT                   on 09-MAY-2002"
FT   mRNA            complement(join(2384887..2384972,2397687..2397733,
FT                   2399088..2399146,2402976..2403069,2404364..2404457,
FT                   2413711..2413757,2422261..2422668,2426107..>2426321))
FT                   /locus_tag="mCG_64622"
FT                   /product="mCG64622, transcript variant mCT190840"
FT                   /note="gene_id=mCG64622.3 transcript_id=mCT190840.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2397723..2397733,2399088..2399146,
FT                   2402976..2403069,2404364..2404457,2413711..2413757,
FT                   2422261..>2422291))
FT                   /codon_start=1
FT                   /locus_tag="mCG_64622"
FT                   /product="mCG64622, isoform CRA_a"
FT                   /note="gene_id=mCG64622.3 transcript_id=mCT190840.0
FT                   protein_id=mCP111798.0 isoform=CRA_a"
FT                   /protein_id="EDL14636.1"
FT                   /translation="TRDFPQNEAEECAQKETCPVCTRDKRCIWCREEKVCKKYCFPYSD
FT                   CKFNSIFWANCNVDLFGIVMLILIVILALAFLWYCLAYYFYMQQHMALYARHGQVPVYN
FT                   WDAPGDW"
FT   CDS             complement(join(2397730..2397733,2399084..2399146,
FT                   2402976..2403069,2404364..2404457,2413711..2413757,
FT                   2426107..2426254))
FT                   /codon_start=1
FT                   /locus_tag="mCG_64622"
FT                   /product="mCG64622, isoform CRA_b"
FT                   /note="gene_id=mCG64622.3 transcript_id=mCT64805.1
FT                   protein_id=mCP28994.1 isoform=CRA_b"
FT                   /protein_id="EDL14637.1"
FT                   /translation="MCWLRAWSHILLPVFLSVALIQLIFNLSDHKTKTHHHWKRKIEAK
FT                   YVEKECAQKETCPVCTRDKRCIWCREEKVCKKYCFPYSDCKFNSIFWANCNVDLFGIVM
FT                   LILIVILALAFLWYCLAYYFYMQQHMALYARHGQVPVYNWDAPGK"
FT   gene            complement(2452871..2462999)
FT                   /gene="Cldn12"
FT                   /locus_tag="mCG_2953"
FT                   /note="gene_id=mCG2953.1"
FT   mRNA            complement(join(2452871..2456213,2459152..2459203,
FT                   2461243..2461332,2462849..2462999))
FT                   /gene="Cldn12"
FT                   /locus_tag="mCG_2953"
FT                   /product="claudin 12, transcript variant mCT2113"
FT                   /note="gene_id=mCG2953.1 transcript_id=mCT2113.1 created on
FT                   09-MAY-2002"
FT   mRNA            complement(join(2452872..2453433,2455106..2456213,
FT                   2459152..2459203,2461243..2461332,2462712..2462861))
FT                   /gene="Cldn12"
FT                   /locus_tag="mCG_2953"
FT                   /product="claudin 12, transcript variant mCT168984"
FT                   /note="gene_id=mCG2953.1 transcript_id=mCT168984.0 created
FT                   on 09-MAY-2002"
FT   mRNA            complement(join(2452982..2456213,2459152..2459203,
FT                   2461243..2461332,2462712..>2462816))
FT                   /gene="Cldn12"
FT                   /locus_tag="mCG_2953"
FT                   /product="claudin 12, transcript variant mCT190841"
FT                   /note="gene_id=mCG2953.1 transcript_id=mCT190841.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(2455450..>2456208)
FT                   /codon_start=1
FT                   /gene="Cldn12"
FT                   /locus_tag="mCG_2953"
FT                   /product="claudin 12, isoform CRA_a"
FT                   /note="gene_id=mCG2953.1 transcript_id=mCT190841.0
FT                   protein_id=mCP111788.0 isoform=CRA_a"
FT                   /protein_id="EDL14638.1"
FT                   /translation="PYSSSPPAMGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLR
FT                   LITFNRNEKNLTIYTGLWVKCARYDGSSDCLMYDRTWYLSVDQLDLRVLQFALPLSIVI
FT                   AMGALLLCLIGMCNTAFNSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWAI
FT                   FYNSHLNRKFEPVFTFDYAVFVTIASSGGLFMTALLLFVWYCACKSLSSPFWQPLYSHA
FT                   PGMHTYSQPYSSRSRLSAIEIDIPVVSHST"
FT   CDS             complement(2455450..2456184)
FT                   /codon_start=1
FT                   /gene="Cldn12"
FT                   /locus_tag="mCG_2953"
FT                   /product="claudin 12, isoform CRA_b"
FT                   /note="gene_id=mCG2953.1 transcript_id=mCT2113.1
FT                   protein_id=mCP6471.1 isoform=CRA_b"
FT                   /protein_id="EDL14639.1"
FT                   /translation="MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNE
FT                   KNLTIYTGLWVKCARYDGSSDCLMYDRTWYLSVDQLDLRVLQFALPLSIVIAMGALLLC
FT                   LIGMCNTAFNSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWAIFYNSHLNR
FT                   KFEPVFTFDYAVFVTIASSGGLFMTALLLFVWYCACKSLSSPFWQPLYSHAPGMHTYSQ
FT                   PYSSRSRLSAIEIDIPVVSHST"
FT   CDS             complement(2455450..2456184)
FT                   /codon_start=1
FT                   /gene="Cldn12"
FT                   /locus_tag="mCG_2953"
FT                   /product="claudin 12, isoform CRA_b"
FT                   /note="gene_id=mCG2953.1 transcript_id=mCT168984.0
FT                   protein_id=mCP91862.0 isoform=CRA_b"
FT                   /protein_id="EDL14640.1"
FT                   /translation="MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNE
FT                   KNLTIYTGLWVKCARYDGSSDCLMYDRTWYLSVDQLDLRVLQFALPLSIVIAMGALLLC
FT                   LIGMCNTAFNSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWAIFYNSHLNR
FT                   KFEPVFTFDYAVFVTIASSGGLFMTALLLFVWYCACKSLSSPFWQPLYSHAPGMHTYSQ
FT                   PYSSRSRLSAIEIDIPVVSHST"
FT   gene            complement(2484148..2506220)
FT                   /gene="BC034507"
FT                   /locus_tag="mCG_2961"
FT                   /note="gene_id=mCG2961.1"
FT   mRNA            complement(join(2484148..2486135,2488986..2489109,
FT                   2489975..2490052,2490750..2490857,2493038..2493090,
FT                   2494612..2494685,2501923..2502067,2502750..2502841,
FT                   2503898..2504091,2506118..2506220))
FT                   /gene="BC034507"
FT                   /locus_tag="mCG_2961"
FT                   /product="cDNA sequence BC034507, transcript variant
FT                   mCT2105"
FT                   /note="gene_id=mCG2961.1 transcript_id=mCT2105.2 created on
FT                   09-MAY-2002"
FT   mRNA            complement(join(2484148..2486135,2488944..2489109,
FT                   2489975..2490052,2490750..2490857,2493038..2493090,
FT                   2494612..2494685,2501923..2502067,2502750..2502841,
FT                   2503898..2504091,2506118..2506220))
FT                   /gene="BC034507"
FT                   /locus_tag="mCG_2961"
FT                   /product="cDNA sequence BC034507, transcript variant
FT                   mCT168985"
FT                   /note="gene_id=mCG2961.1 transcript_id=mCT168985.0 created
FT                   on 09-MAY-2002"
FT   CDS             complement(join(2485936..2486135,2488986..2489109,
FT                   2489975..2490052,2490750..2490857,2493038..2493090,
FT                   2494612..2494685,2501923..2502067,2502750..2502841,
FT                   2503898..2504091,2506118..2506150))
FT                   /codon_start=1
FT                   /gene="BC034507"
FT                   /locus_tag="mCG_2961"
FT                   /product="cDNA sequence BC034507, isoform CRA_b"
FT                   /note="gene_id=mCG2961.1 transcript_id=mCT2105.2
FT                   protein_id=mCP6479.2 isoform=CRA_b"
FT                   /protein_id="EDL14642.1"
FT                   /translation="MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDV
FT                   WVVAHKNMTLKQLKNKYPQKRFVAGGGANSRVSALQGSKGKDCEVPAPVGISVTDENGQ
FT                   VLGELNKEEDRVLVAKGGLGGKLHTNFLPLKGQKRIVHLDLKVIADVGLVGFPNAGKSS
FT                   LLSRVSHATPVIADYAFTTLRPELGKIMYNDFKQISVADLPGLIEGAHMNKGMGHKFLK
FT                   HLERTRQLLFVVDISGFQLSSVTPYRTAFETIILLTKELELYKEELQTKPALLAINKMD
FT                   LPDAQVKLQELMKQLLSPEDFLHLFETKMIPEKALEFQHIVPISTVTGEGIAELKSCIR
FT                   KALDEQDGKESDAHRSKQLLNLQSSS"
FT   CDS             complement(join(2485936..2486135,2488944..2489109,
FT                   2489975..2490052,2490750..2490857,2493038..2493090,
FT                   2494612..2494685,2501923..2502067,2502750..2502841,
FT                   2503898..2504091,2506118..2506150))
FT                   /codon_start=1
FT                   /gene="BC034507"
FT                   /locus_tag="mCG_2961"
FT                   /product="cDNA sequence BC034507, isoform CRA_a"
FT                   /note="gene_id=mCG2961.1 transcript_id=mCT168985.0
FT                   protein_id=mCP91863.0 isoform=CRA_a"
FT                   /protein_id="EDL14641.1"
FT                   /translation="MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDV
FT                   WVVAHKNMTLKQLKNKYPQKRFVAGGGANSRVSALQGSKGKDCEVPAPVGISVTDENGQ
FT                   VLGELNKEEDRVLVAKGGLGGKLHTNFLPLKGQKRIVHLDLKVIADVGLVGFPNAGKSS
FT                   LLSRVSHATPVIADYAFTTLRPELGKIMYNDFKQISVADLPGLIEGAHMNKGMGHKFLK
FT                   HLERTRQLLFVVDISGFQLSSVTPYRTAFETIILLTKELELYKEELQTKPALLAINKMD
FT                   LPDAQVKLQELMKQLLSPEGKAAVRFHLVRSAGHFLHLFETKMIPEKALEFQHIVPIST
FT                   VTGEGIAELKSCIRKALDEQDGKESDAHRSKQLLNLQSSS"
FT   gene            2514013..2514424
FT                   /pseudo
FT                   /locus_tag="mCG_50017"
FT                   /note="gene_id=mCG50017.2"
FT   mRNA            2514013..2514424
FT                   /pseudo
FT                   /locus_tag="mCG_50017"
FT                   /note="gene_id=mCG50017.2 transcript_id=mCT50200.2 created
FT                   on 08-MAY-2002"
FT   gene            complement(2527663..2605669)
FT                   /gene="A330021E22Rik"
FT                   /locus_tag="mCG_145768"
FT                   /note="gene_id=mCG145768.0"
FT   mRNA            complement(join(2527663..2528047,2528585..2528689,
FT                   2529123..2529209,2531330..2531527,2533035..2533111,
FT                   2533820..2533957,2535799..2535991,2540451..2540532,
FT                   2542600..2542718,2550156..2550274,2560999..2561163,
FT                   2564484..2564700,2566817..2566938,2567036..2567084,
FT                   2569789..2569912,2573614..2573791,2573873..2574022,
FT                   2581560..2581658,2585855..2585931,2588367..2588476,
FT                   2591221..2591286,2599218..2599277,2605337..2605663))
FT                   /gene="A330021E22Rik"
FT                   /locus_tag="mCG_145768"
FT                   /product="RIKEN cDNA A330021E22, transcript variant
FT                   mCT185842"
FT                   /note="gene_id=mCG145768.0 transcript_id=mCT185842.0
FT                   created on 18-JUN-2003"
FT   CDS             complement(join(2527877..2528047,2528585..2528689,
FT                   2529123..2529209,2531330..2531527,2533035..2533111,
FT                   2533820..2533957,2535799..2535991,2540451..2540532,
FT                   2542600..2542718,2550156..2550274,2560999..2561163,
FT                   2564484..2564700,2566817..2566938,2567036..2567084,
FT                   2569789..2569912,2573614..2573791,2573873..2574022,
FT                   2581560..2581658,2585855..2585931,2588367..2588476,
FT                   2591221..2591286,2599218..2599277,2605337..2605459))
FT                   /codon_start=1
FT                   /gene="A330021E22Rik"
FT                   /locus_tag="mCG_145768"
FT                   /product="RIKEN cDNA A330021E22, isoform CRA_c"
FT                   /note="gene_id=mCG145768.0 transcript_id=mCT185842.0
FT                   protein_id=mCP107099.0 isoform=CRA_c"
FT                   /protein_id="EDL14645.1"
FT                   /translation="MSTAEASATTADAAEAGGRTKTGSPRTIPVFGVAIPDGEMQGIFK
FT                   PMDLNRIIKVLEEEDKDVSEEKQLNYIKKLIHCYQNGFPLRDLAQIFKILSLCAEKIEK
FT                   QPCFVEPASDIIKLCGLPFLKKKVSDEITYTEDTANSFALLGELMKIPSSALRIQICKC
FT                   IVDFYHAEPLKKHIPGYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVL
FT                   QHLSTSGVNCTLMVKAQAASGICAHLNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQL
FT                   SNLECLLALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQNPGAPMIECGFTRDLILF
FT                   ATFNEVKSQNPLVKSLKLFNCYEDFELKKLLFNIIVILCKDLATVQLLIDGKVILALFT
FT                   YVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCGHE
FT                   DSYFIHGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEIFK
FT                   TMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRKEMFGTEGVDIVLHVMKTDPKNLQ
FT                   RGLGYNVLLFSTLDSIWCCILGCYDSEDYFLEKEGIFLLLDILALNQKKFCNLILGIMV
FT                   EFCDNPKTSAHVNAWRGKKDLTAASLLIKLWRKEEKELGVKRDRNGKIVDTKRPLFTSF
FT                   QEEQKTMPLPANCPSIAVMDVAENIRAKIYAVLDKLDFENLPGLSAEDFVTLCIIHRYF
FT                   DFKIGEIWNEVSEEIKLEKLRLVTTDEKSLNSIIAATENIGKMVASLQSEMIENQALQD
FT                   VQNEQRVYAKIQATHKQREQANKSWENFLARTSNAKTLKKAKKLQEKAIESSRYTERPQ
FT                   NATFHQTVIKGLNTTVPSGRVVTVQSTPTRLLGGPLADTDIALKKLPIRGGALQRVKVK
FT                   PPLNDPKKSIPT"
FT   mRNA            complement(join(<2535854..2535892,2540451..2540532,
FT                   2542600..2542718,2550156..2550274,2560999..2561163,
FT                   2564484..2564700,2569789..2569912,2573614..2573791,
FT                   2573873..2574022,2581560..2581658,2585855..2585931,
FT                   2588367..2588476,2591221..2591286,2599218..2599277,
FT                   2605337..2605669))
FT                   /gene="A330021E22Rik"
FT                   /locus_tag="mCG_145768"
FT                   /product="RIKEN cDNA A330021E22, transcript variant
FT                   mCT185841"
FT                   /note="gene_id=mCG145768.0 transcript_id=mCT185841.0
FT                   created on 18-JUN-2003"
FT   CDS             complement(join(<2535854..2535892,2540451..2540532,
FT                   2542600..2542718,2550156..2550274,2560999..2561163,
FT                   2564484..2564700,2569789..2569912,2573614..2573791,
FT                   2573873..2574022,2581560..2581658,2585855..2585931,
FT                   2588367..2588476,2591221..2591286,2599218..2599277,
FT                   2605337..2605459))
FT                   /codon_start=1
FT                   /gene="A330021E22Rik"
FT                   /locus_tag="mCG_145768"
FT                   /product="RIKEN cDNA A330021E22, isoform CRA_a"
FT                   /note="gene_id=mCG145768.0 transcript_id=mCT185841.0
FT                   protein_id=mCP107100.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X999"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:2443778"
FT                   /db_xref="UniProtKB/TrEMBL:G3X999"
FT                   /protein_id="EDL14643.1"
FT                   /translation="MSTAEASATTADAAEAGGRTKTGSPRTIPVFGVAIPDGEMQGIFK
FT                   PMDLNRIIKVLEEEDKDVSEEKQLNYIKKLIHCYQNGFPLRDLAQIFKILSLCAEKIEK
FT                   QPCFVEPASDIIKLCGLPFLKKKVSDEITYTEDTANSFALLGELMKIPSSALRIQICKC
FT                   IVDFYHAEPLKKHIPGYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVEKLWVLKVL
FT                   QHLSTSGVNCTLMVKAQAASGICAHLNDPDPSGQLLFRSSEVLWNLLEKSSKEEIIQQL
FT                   SNLECLLALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQNPGAPMILLIDGKVILAL
FT                   FTYVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILAFLEWCG
FT                   HEDSYFIHGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVIHQLIEI
FT                   FKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRKEMFGTEGVDIVLHVMKTDPKN
FT                   LQRGLGYNVLLFSTLDSIWCCILGCYDSEDYFLEKEGIFLLLDILAKDLTAASLLIKLW
FT                   "
FT   mRNA            complement(join(2540327..2540532,2542600..2542718,
FT                   2550156..2550274,2560999..2561163,2564484..2564700,
FT                   2566817..2566938,2567036..2567084,2569789..2569912,
FT                   2573614..2573791,2573873..2574022,2581560..2581658,
FT                   2585855..2585931,2588367..2588476,2591221..2591286,
FT                   2599218..2599277,2605337..>2605663))
FT                   /gene="A330021E22Rik"
FT                   /locus_tag="mCG_145768"
FT                   /product="RIKEN cDNA A330021E22, transcript variant
FT                   mCT190834"
FT                   /note="gene_id=mCG145768.0 transcript_id=mCT190834.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(2540427..2540532,2542600..2542718,
FT                   2550156..2550274,2560999..2561163,2564484..2564700,
FT                   2566817..2566938,2567036..2567084,2569789..2569912,
FT                   2573614..2573791,2573873..2574022,2581560..2581658,
FT                   2585855..2585931,2588367..2588476,2591221..2591286,
FT                   2599218..2599277,2605337..>2605483))
FT                   /codon_start=1
FT                   /gene="A330021E22Rik"
FT                   /locus_tag="mCG_145768"
FT                   /product="RIKEN cDNA A330021E22, isoform CRA_b"
FT                   /note="gene_id=mCG145768.0 transcript_id=mCT190834.0
FT                   protein_id=mCP111780.0 isoform=CRA_b"
FT                   /protein_id="EDL14644.1"
FT                   /translation="DLRLPPRTMSTAEASATTADAAEAGGRTKTGSPRTIPVFGVAIPD
FT                   GEMQGIFKPMDLNRIIKVLEEEDKDVSEEKQLNYIKKLIHCYQNGFPLRDLAQIFKILS
FT                   LCAEKIEKQPCFVEPASDIIKLCGLPFLKKKVSDEITYTEDTANSFALLGELMKIPSSA
FT                   LRIQICKCIVDFYHAEPLKKHIPGYQQVSSSYKIKMVEVGGLAKAMVQSALLLENQLVE
FT                   KLWVLKVLQHLSTSGVNCTLMVKAQAASGICAHLNDPDPSGQLLFRSSEVLWNLLEKSS
FT                   KEEIIQQLSNLECLLALKEVFKNLFVRGHSHYERQLRNDILVITTIIAQNPGAPMIECG
FT                   FTRDLILFATFNEVKSQNPLVKSLKLFNCYEDFELKKLLFNIIVILCKDLATVQLLIDG
FT                   KVILALFTYVKKPERLKIMEWSAAQYEELQLHAIATLSSVAPLLIEEYMSCHGNSRILA
FT                   FLEWCGHEDSYFIHGNSFHGTGGRGNKFAQMRYTLRLLRAMVYLEDETVNKDLCERGVI
FT                   HQLIEIFKTMMSRPAEKEEAIALEIQSDTLLILSGLCENYIQRKEMFGTEGVDIVLHVM
FT                   KTDPKNLQRGLGYNVLLFSTLDSIWCCILGCYDSEDYFLEKEGIFLLLDILAVSNIHLL
FT                   "
FT   gene            complement(2607445..2636033)
FT                   /locus_tag="mCG_2960"
FT                   /note="gene_id=mCG2960.3"
FT   mRNA            complement(join(2607445..2609596,2617319..2617483,
FT                   2618795..2619322,2624012..2624533,2635441..2635546))
FT                   /locus_tag="mCG_2960"
FT                   /product="mCG2960, transcript variant mCT185854"
FT                   /note="gene_id=mCG2960.3 transcript_id=mCT185854.0 created
FT                   on 18-JUN-2003"
FT   CDS             complement(join(2609570..2609596,2617319..2617483,
FT                   2618795..2619322,2624012..2624500))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2960"
FT                   /product="mCG2960, isoform CRA_a"
FT                   /note="gene_id=mCG2960.3 transcript_id=mCT185854.0
FT                   protein_id=mCP107112.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3YUM6"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="MGI:MGI:1921301"
FT                   /db_xref="UniProtKB/TrEMBL:D3YUM6"
FT                   /protein_id="EDL14646.1"
FT                   /translation="MESISMMGSPKSLETFLPNGINGIKDARQVTVGVIGSGDFAKSLT
FT                   IRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLR
FT                   HLLVGKILIDVSNNMRVNQYPESNAEYLASLFPDSLIVKGFNVISAWALQLGPKDASRQ
FT                   VYICSNNIQARQQVIELARQLNFIPVDLGSLSSAKEIENLPLRLFTLWRGPVVVAISLA
FT                   TFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQL
FT                   YYGTKYRRFPPWLDTWLQCRKQLGLLSFFFAVVHVAYSLCLPMRRSERYLFLNMAYQQV
FT                   HANIENAWNEEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQWPRAA
FT                   LSS"
FT   mRNA            complement(join(2612416..2615174,2617319..2617483,
FT                   2618795..2619322,2624012..2624533,2624775..2624900,
FT                   2635086..2635244))
FT                   /locus_tag="mCG_2960"
FT                   /product="mCG2960, transcript variant mCT185855"
FT                   /note="gene_id=mCG2960.3 transcript_id=mCT185855.0 created
FT                   on 18-JUN-2003"
FT   mRNA            complement(join(2613202..2615174,2617319..2617483,
FT                   2618795..2619322,2624012..2624533,2624775..2624900,
FT                   2635863..2636033))
FT                   /locus_tag="mCG_2960"
FT                   /product="mCG2960, transcript variant mCT2104"
FT                   /note="gene_id=mCG2960.3 transcript_id=mCT2104.2 created on
FT                   18-JUN-2003"
FT   CDS             complement(join(2614887..2615174,2617319..2617483,
FT                   2618795..2619322,2624012..2624500))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2960"
FT                   /product="mCG2960, isoform CRA_b"
FT                   /note="gene_id=mCG2960.3 transcript_id=mCT185855.0
FT                   protein_id=mCP107113.0 isoform=CRA_b"
FT                   /db_xref="GOA:B2RX33"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="MGI:MGI:1921301"
FT                   /db_xref="UniProtKB/TrEMBL:B2RX33"
FT                   /protein_id="EDL14647.1"
FT                   /translation="MESISMMGSPKSLETFLPNGINGIKDARQVTVGVIGSGDFAKSLT
FT                   IRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLR
FT                   HLLVGKILIDVSNNMRVNQYPESNAEYLASLFPDSLIVKGFNVISAWALQLGPKDASRQ
FT                   VYICSNNIQARQQVIELARQLNFIPVDLGSLSSAKEIENLPLRLFTLWRGPVVVAISLA
FT                   TFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQL
FT                   YYGTKYRRFPPWLDTWLQCRKQLGLLSFFFAVVHVAYSLCLPMRRSERYLFLNMAYQQV
FT                   HANIENAWNEEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGY
FT                   VALLITTFHVLIYGWKRAFAEEYYRFYTPPNFVLALVLPSIVILGKMILLLPCISRKLK
FT                   RIKKGWEKSQFLDEGMGGAVPHLSPERVTVM"
FT   CDS             complement(join(2614887..2615174,2617319..2617483,
FT                   2618795..2619322,2624012..2624500))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2960"
FT                   /product="mCG2960, isoform CRA_b"
FT                   /note="gene_id=mCG2960.3 transcript_id=mCT2104.2
FT                   protein_id=mCP6478.1 isoform=CRA_b"
FT                   /db_xref="GOA:B2RX33"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="MGI:MGI:1921301"
FT                   /db_xref="UniProtKB/TrEMBL:B2RX33"
FT                   /protein_id="EDL14649.1"
FT                   /translation="MESISMMGSPKSLETFLPNGINGIKDARQVTVGVIGSGDFAKSLT
FT                   IRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLR
FT                   HLLVGKILIDVSNNMRVNQYPESNAEYLASLFPDSLIVKGFNVISAWALQLGPKDASRQ
FT                   VYICSNNIQARQQVIELARQLNFIPVDLGSLSSAKEIENLPLRLFTLWRGPVVVAISLA
FT                   TFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQL
FT                   YYGTKYRRFPPWLDTWLQCRKQLGLLSFFFAVVHVAYSLCLPMRRSERYLFLNMAYQQV
FT                   HANIENAWNEEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGY
FT                   VALLITTFHVLIYGWKRAFAEEYYRFYTPPNFVLALVLPSIVILGKMILLLPCISRKLK
FT                   RIKKGWEKSQFLDEGMGGAVPHLSPERVTVM"
FT   mRNA            complement(join(<2614987..2615174,2617319..2617483,
FT                   2618795..2619322,2624012..2624533,2624775..2624900,
FT                   2635769..2635809))
FT                   /locus_tag="mCG_2960"
FT                   /product="mCG2960, transcript variant mCT185856"
FT                   /note="gene_id=mCG2960.3 transcript_id=mCT185856.0 created
FT                   on 18-JUN-2003"
FT   CDS             complement(join(<2614987..2615174,2617319..2617483,
FT                   2618795..2619322,2624012..2624500))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2960"
FT                   /product="mCG2960, isoform CRA_c"
FT                   /note="gene_id=mCG2960.3 transcript_id=mCT185856.0
FT                   protein_id=mCP107114.0 isoform=CRA_c"
FT                   /protein_id="EDL14648.1"
FT                   /translation="MESISMMGSPKSLETFLPNGINGIKDARQVTVGVIGSGDFAKSLT
FT                   IRLIRCGYHVVIGSRNPKFASEFFPHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLR
FT                   HLLVGKILIDVSNNMRVNQYPESNAEYLASLFPDSLIVKGFNVISAWALQLGPKDASRQ
FT                   VYICSNNIQARQQVIELARQLNFIPVDLGSLSSAKEIENLPLRLFTLWRGPVVVAISLA
FT                   TFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAYQL
FT                   YYGTKYRRFPPWLDTWLQCRKQLGLLSFFFAVVHVAYSLCLPMRRSERYLFLNMAYQQV
FT                   HANIENAWNEEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGY
FT                   VALLITTFHVLIYGWKRAFAEEYYRFYTPPNFVLALVLPSIVILGKMILLLPCISRKL"
FT   gene            complement(2677812..2690794)
FT                   /gene="Steap1"
FT                   /locus_tag="mCG_2958"
FT                   /note="gene_id=mCG2958.1"
FT   mRNA            complement(join(2677812..2678164,2681281..2681445,
FT                   2681835..2682347,2684311..2684425,2690730..2690794))
FT                   /gene="Steap1"
FT                   /locus_tag="mCG_2958"
FT                   /product="six transmembrane epithelial antigen of the
FT                   prostate 1"
FT                   /note="gene_id=mCG2958.1 transcript_id=mCT2112.1 created on
FT                   09-MAY-2002"
FT   CDS             complement(join(2677907..2678164,2681281..2681445,
FT                   2681835..2682347,2684311..2684394))
FT                   /codon_start=1
FT                   /gene="Steap1"
FT                   /locus_tag="mCG_2958"
FT                   /product="six transmembrane epithelial antigen of the
FT                   prostate 1"
FT                   /note="gene_id=mCG2958.1 transcript_id=mCT2112.1
FT                   protein_id=mCP6476.2"
FT                   /protein_id="EDL14650.1"
FT                   /translation="MEISDDVTNPEQLWKMKPKGNLEDDSYSTKDSGETSMLKRPGLSH
FT                   LQHAVHVDAFDCPSELQHTQEFFPNWRLPVKVAAIISSLTFLYTLLREIIYPLVTSREQ
FT                   YFYKIPILVINKVLPMVAITLLALVYLPGELAAVVQLRNGTKYKKFPPWLDRWMLARKQ
FT                   FGLLSFFFAVLHAVYSLSYPMRRSYRYKLLNWAYKQVQQNKEDAWVEHDVWRMEIYVSL
FT                   GIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTVHALVFAWNKWVDVS
FT                   QFVWYMPPTFMIAVFLPTLVLICKIALCLPCLRKKILKIRCGWEDVSKINRTEMASRL"
FT   gene            <3348364..3361036
FT                   /locus_tag="mCG_140326"
FT                   /note="gene_id=mCG140326.0"
FT   mRNA            join(<3348364..3348452,3359744..3359806,3359893..3359951,
FT                   3360667..3361036)
FT                   /locus_tag="mCG_140326"
FT                   /product="mCG140326"
FT                   /note="gene_id=mCG140326.0 transcript_id=mCT168983.0
FT                   created on 08-MAY-2002"
FT   gene            complement(3360227..>3363206)
FT                   /locus_tag="mCG_2949"
FT                   /note="gene_id=mCG2949.2"
FT   mRNA            complement(join(3360227..3363085,3363133..>3363206))
FT                   /locus_tag="mCG_2949"
FT                   /product="mCG2949"
FT                   /note="gene_id=mCG2949.2 transcript_id=mCT1173.2 created on
FT                   09-MAY-2002"
FT   CDS             <3360805..3360957
FT                   /codon_start=1
FT                   /locus_tag="mCG_140326"
FT                   /product="mCG140326"
FT                   /note="gene_id=mCG140326.0 transcript_id=mCT168983.0
FT                   protein_id=mCP91876.0"
FT                   /protein_id="EDL14651.1"
FT                   /translation="KYEIMMMAVRMDSRRICRRDSQDSMWKAKSGEQVTLRNEFADGEQ
FT                   SVQSA"
FT   CDS             complement(join(3361317..3363085,3363133..>3363205))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2949"
FT                   /product="mCG2949"
FT                   /note="gene_id=mCG2949.2 transcript_id=mCT1173.2
FT                   protein_id=mCP21661.2"
FT                   /protein_id="EDL14652.1"
FT                   /translation="EATLQEQPGLPGSPRSRPRGPCTKALLSRDTNFLQEINRKQEAAP
FT                   TGTRHKAKSQGLVTFGDVVVVFSQEASEWLNSEQRSLYWKVMLDNYRNLVSLGLCASKP
FT                   DMITSLEQGRDPWMMKRKMRKGQRLDLKAMQETKEFPPEDLSKETLSQSVLRKQLLPHR
FT                   PKCSMVRAAWEGGAVFTIHRGLKTNSGLAKDSPAQLVSSQRSFCKNVTWENCGDRGSLG
FT                   QQSVQEAQDLFPRQDSHAEWVTGRTWSTKLECSTFRDQDSECMFERNEQETVTPNRAFS
FT                   EGRDGMCIESGRWFHLNSSDERSHNCDSGKSFSPNPVVVKETGIYSGKKLFQCNECKKT
FT                   FTQSSSLTVHQRIHTGEKPYKCNECGKAFSDGSSFARHQRCHIGKKPYECPECGKAFIQ
FT                   NTLLVRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYTCEVCHKSFRYGS
FT                   SLTVHQRIHTGEKPYECEICRKAFSHHASLTQHQQVHSGEKPFKCKECGKAFRQNIHLA
FT                   SHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCRKAFTQKAHLAQHQ
FT                   KTHTGGEAIRVQGMWQGLQPDHSPHSTPEGSYWREAL"
FT   gene            3600181..3602256
FT                   /locus_tag="mCG_54179"
FT                   /note="gene_id=mCG54179.2"
FT   mRNA            3600181..3602256
FT                   /locus_tag="mCG_54179"
FT                   /product="mCG54179, transcript variant mCT168987"
FT                   /note="gene_id=mCG54179.2 transcript_id=mCT168987.0 created
FT                   on 08-MAY-2002"
FT   mRNA            join(3600181..3600837,3601060..3602256)
FT                   /locus_tag="mCG_54179"
FT                   /product="mCG54179, transcript variant mCT54362"
FT                   /note="gene_id=mCG54179.2 transcript_id=mCT54362.2 created
FT                   on 08-MAY-2002"
FT   CDS             3600551..3601396
FT                   /codon_start=1
FT                   /locus_tag="mCG_54179"
FT                   /product="mCG54179, isoform CRA_a"
FT                   /note="gene_id=mCG54179.2 transcript_id=mCT168987.0
FT                   protein_id=mCP91868.0 isoform=CRA_a"
FT                   /protein_id="EDL14653.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYYLNREAVKTGQKILIEQQ
FT                   ESMSEKEKGLKRKRKKKGDTVLSGGQKGQDNRVEAEEEGELASAPPPYASSSAIYGQTF
FT                   CPEVWKEDRFSLLGCPIFTDQAKFAWDRDMLLGQGRFAQQQTGYPLQVFKQVNQIAIRA
FT                   RKLLPNRGEANENLTFILTSQMVTQVIEVMVSSPRGIVSILPGDQVDQVLTWARGSVCV
FT                   FPQDQTEPLWVPERLVRRCKNERPDPVAPVDVVDDPTSTKDGAEMRDPFGIPEADTSST
FT                   "
FT   CDS             join(3600551..3600837,3601060..3601396)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54179"
FT                   /product="mCG54179, isoform CRA_b"
FT                   /note="gene_id=mCG54179.2 transcript_id=mCT54362.2
FT                   protein_id=mCP41733.2 isoform=CRA_b"
FT                   /protein_id="EDL14654.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYYLNREAVKTGQKILIEQQ
FT                   ESMSEKEKGLKRKRKKKGDTVLSGGQKGQDNRVEAEEEGELASAPPPYASSGEANENLT
FT                   FILTSQMVTQVIEVMVSSPRGIVSILPGDQVDQVLTWARGSVCVFPQDQTEPLWVPERL
FT                   VRRCKNERPDPVAPVDVVDDPTSTKDGAEMRDPFGIPEADTSST"
FT   gene            complement(<3702198..>3711732)
FT                   /locus_tag="mCG_140322"
FT                   /note="gene_id=mCG140322.0"
FT   mRNA            complement(join(<3702198..3705846,3711602..>3711732))
FT                   /locus_tag="mCG_140322"
FT                   /product="mCG140322"
FT                   /note="gene_id=mCG140322.0 transcript_id=mCT168968.0
FT                   created on 09-MAY-2002"
FT   CDS             complement(join(3702198..3705846,3711602..>3711732))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140322"
FT                   /product="mCG140322"
FT                   /note="gene_id=mCG140322.0 transcript_id=mCT168968.0
FT                   protein_id=mCP91877.0"
FT                   /protein_id="EDL14655.1"
FT                   /translation="RLKELKHREFARNVASKSWKDEKKQEKALKRLHQLAELRQQSECV
FT                   SGNGPAYKTPRIAMEKQLQQGIFPVKNGRKVSCMKSAVFKGKNVPRSSMDKERSAMPNR
FT                   HQLQSDRRHLFGNMITQTSSDLSNANHRTGVSFSFSKKAYLKLESSASVFSENTDDTHD
FT                   CSKSPTYKVKRTVENCKCGRFASNDADLMKEEAVLSASNLEGFLNTSSMNSKISQNKHE
FT                   SINGRLKDAAGIHMAFSKSHFHVSERDCTLSSREKEIRNALKDTSENCINHPCQANESS
FT                   SPLNIYKHSDSRWCECLDEFLPSGPSEKKTQAHRIPNSRMEARAKSSDESERVGKNVQR
FT                   HCKEDCPHDLKSKPLPFLRVQSKDGHTTLQWPTELLFFTRTEPCISYGCNPLYFDFKLS
FT                   RNTKDECNSENVQTELEKKALEIKTKPESQVTDLIKEQEKLTQDNQSLKPKMSVANLDW
FT                   EKFQRKYNLDYNDSDSSVSEHASLRDLEMKSPEVPAYLKLSLKDGLGNNNVDDIELMEP
FT                   SNIHWQSCKRTVHNNALGGLSFSPHISRTKNHKLNPCSMQSEFEEENQHIWNFSPYTSG
FT                   DHSEYGKDRGVSLNTCNINMARRASTSGEPSYERYSPVSPLRAHPRTVDESSRNMSSWR
FT                   NTCTSHRSKGSNSSHKLCFCKRECDSVERHTWKHRKHNCLYMADVRLSSNCPQSETQKD
FT                   KNGKISDSFKTKKRSKHRDCHCRERYKLGKNQQFSEPKPPGIFHCDSGSQVSIDGNGGK
FT                   TFNGQESQHNKLKSYLRQRAYCLNKNNKSQKSLASLHFGDVGKVKCRQCNSSTANYLLR
FT                   SCRGGPSEATQSNIAVGEGPSLTAKGLLERVKAKKCQEQSTKFEISSNSCLKEFHTHSQ
FT                   IQCTTPPGPPCCRRTVLPFSKKRQHIGKRKNEKGNKVHKTSDNDKGKNLQKINSTILTD
FT                   TECDNYLSKGINGLVTDSQSLSRKNNQTTKEKSKSSVIEVQPFLQSYDPVPNDFLGAFS
FT                   SNRYTGVTDSTETKEDQINLDLEDVSMSVNHVEGNINSYYDRAVQKHDKMEDELEVCHK
FT                   SLSPPLIQQPITFSPDEIDKYRLLQLQAQQHVQKQLLARPLRVLPAAGPTAFSPASAVQ
FT                   TVPVHQHTSITTIHHTFLQHFAVSASISSHSSPLPIAHLHPLSQPHFTPISFSTIAPTI
FT                   IPGHPTFLGHPLHLVAAAPFHPSHMTLQPLPSAAFIPTLFGPHLNPATTSIFHLNPLIQ
FT                   PVLQGQDLYHHSCSSQMQQLNSVKEALNMAVHLN"
FT   gene            3724040..3724940
FT                   /pseudo
FT                   /locus_tag="mCG_1036389"
FT                   /note="gene_id=mCG1036389.1"
FT   mRNA            3724040..3724940
FT                   /pseudo
FT                   /locus_tag="mCG_1036389"
FT                   /note="gene_id=mCG1036389.1 transcript_id=mCT154093.1
FT                   created on 08-MAY-2002"
FT   gene            complement(3845001..3845636)
FT                   /pseudo
FT                   /locus_tag="mCG_1036348"
FT                   /note="gene_id=mCG1036348.1"
FT   mRNA            complement(3845001..3845636)
FT                   /pseudo
FT                   /locus_tag="mCG_1036348"
FT                   /note="gene_id=mCG1036348.1 transcript_id=mCT154052.1
FT                   created on 09-MAY-2002"
FT   gene            4106258..4107803
FT                   /locus_tag="mCG_49614"
FT                   /note="gene_id=mCG49614.2"
FT   mRNA            join(4106258..4106703,4107450..4107803)
FT                   /locus_tag="mCG_49614"
FT                   /product="mCG49614, transcript variant mCT168986"
FT                   /note="gene_id=mCG49614.2 transcript_id=mCT168986.0 created
FT                   on 08-MAY-2002"
FT   mRNA            4106274..4107803
FT                   /locus_tag="mCG_49614"
FT                   /product="mCG49614, transcript variant mCT49797"
FT                   /note="gene_id=mCG49614.2 transcript_id=mCT49797.2 created
FT                   on 08-MAY-2002"
FT   CDS             4106325..4107659
FT                   /codon_start=1
FT                   /locus_tag="mCG_49614"
FT                   /product="mCG49614, isoform CRA_b"
FT                   /note="gene_id=mCG49614.2 transcript_id=mCT49797.2
FT                   protein_id=mCP41728.2 isoform=CRA_b"
FT                   /protein_id="EDL14657.1"
FT                   /translation="MREIVHLQAGQCSNQIGAKFWEVISDEHGIDTTGTYHGDSDLQLE
FT                   RINVYYNEATGGKYVPRAVLVDLEPCTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKG
FT                   HYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLISKIREEYPDRIM
FT                   NTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDDEALYDICFRTLKLTTPTYG
FT                   DLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR
FT                   ALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYF
FT                   VEWIPNNVKTAVCDIPPRGLKMSTTFIGNSTAIQELFKRISEQFTAMFPRKTFLHWYTG
FT                   EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEYEEEAEEEVA"
FT   CDS             join(4106325..4106703,4107450..4107523)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49614"
FT                   /product="mCG49614, isoform CRA_a"
FT                   /note="gene_id=mCG49614.2 transcript_id=mCT168986.0
FT                   protein_id=mCP91866.0 isoform=CRA_a"
FT                   /protein_id="EDL14656.1"
FT                   /translation="MREIVHLQAGQCSNQIGAKFWEVISDEHGIDTTGTYHGDSDLQLE
FT                   RINVYYNEATGGKYVPRAVLVDLEPCTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKG
FT                   HYTEGAELVDSVLDVVRKEAESSVQTHLRAVHSHVPTQDLPTLVHG"
FT   gene            4232857..4240202
FT                   /gene="4921511H03Rik"
FT                   /locus_tag="mCG_56260"
FT                   /note="gene_id=mCG56260.1"
FT   mRNA            join(4232857..4232905,4233168..4234313,4240035..4240202)
FT                   /gene="4921511H03Rik"
FT                   /locus_tag="mCG_56260"
FT                   /product="RIKEN cDNA 4921511H03, transcript variant
FT                   mCT168988"
FT                   /note="gene_id=mCG56260.1 transcript_id=mCT168988.0 created
FT                   on 08-MAY-2002"
FT   mRNA            join(4232857..4232905,4233168..4234520)
FT                   /gene="4921511H03Rik"
FT                   /locus_tag="mCG_56260"
FT                   /product="RIKEN cDNA 4921511H03, transcript variant
FT                   mCT56443"
FT                   /note="gene_id=mCG56260.1 transcript_id=mCT56443.1 created
FT                   on 08-MAY-2002"
FT   mRNA            join(<4232874..4232905,4233467..4234313,4240035..4240202)
FT                   /gene="4921511H03Rik"
FT                   /locus_tag="mCG_56260"
FT                   /product="RIKEN cDNA 4921511H03, transcript variant
FT                   mCT190838"
FT                   /note="gene_id=mCG56260.1 transcript_id=mCT190838.0 created
FT                   on 08-MAR-2004"
FT   CDS             <4233505..4234293
FT                   /codon_start=1
FT                   /gene="4921511H03Rik"
FT                   /locus_tag="mCG_56260"
FT                   /product="RIKEN cDNA 4921511H03, isoform CRA_b"
FT                   /note="gene_id=mCG56260.1 transcript_id=mCT190838.0
FT                   protein_id=mCP111789.0 isoform=CRA_b"
FT                   /protein_id="EDL14659.1"
FT                   /translation="SSKKEIRFIMSFMVHNRKGSKKQFQVDPLLLPKVPRTNYLHLQEE
FT                   KHRLQLKKFLLHRMFLVGYIQGNTEKKDISEYYEQLFQSILKHHLGESVTGLMLIYPST
FT                   FLHILESSNGTLFRILLDYVAHEKSETEFMLQNMKIVVASHNIPTRLFMQWHISAIKVP
FT                   VLYLDDESQSPSIEEVTTEFLTMTHKLALQLYKTVKLGAKGPGDNLHQLAPELILPEQI
FT                   IKYLCKAEEFMDPASFLSMYNRPIHVTLDSDIVWPAPSRF"
FT   CDS             4233532..4234293
FT                   /codon_start=1
FT                   /gene="4921511H03Rik"
FT                   /locus_tag="mCG_56260"
FT                   /product="RIKEN cDNA 4921511H03, isoform CRA_a"
FT                   /note="gene_id=mCG56260.1 transcript_id=mCT168988.0
FT                   protein_id=mCP91878.0 isoform=CRA_a"
FT                   /protein_id="EDL14658.1"
FT                   /translation="MSFMVHNRKGSKKQFQVDPLLLPKVPRTNYLHLQEEKHRLQLKKF
FT                   LLHRMFLVGYIQGNTEKKDISEYYEQLFQSILKHHLGESVTGLMLIYPSTFLHILESSN
FT                   GTLFRILLDYVAHEKSETEFMLQNMKIVVASHNIPTRLFMQWHISAIKVPVLYLDDESQ
FT                   SPSIEEVTTEFLTMTHKLALQLYKTVKLGAKGPGDNLHQLAPELILPEQIIKYLCKAEE
FT                   FMDPASFLSMYNRPIHVTLDSDIVWPAPSRF"
FT   CDS             4233532..4234293
FT                   /codon_start=1
FT                   /gene="4921511H03Rik"
FT                   /locus_tag="mCG_56260"
FT                   /product="RIKEN cDNA 4921511H03, isoform CRA_a"
FT                   /note="gene_id=mCG56260.1 transcript_id=mCT56443.1
FT                   protein_id=mCP41731.1 isoform=CRA_a"
FT                   /protein_id="EDL14660.1"
FT                   /translation="MSFMVHNRKGSKKQFQVDPLLLPKVPRTNYLHLQEEKHRLQLKKF
FT                   LLHRMFLVGYIQGNTEKKDISEYYEQLFQSILKHHLGESVTGLMLIYPSTFLHILESSN
FT                   GTLFRILLDYVAHEKSETEFMLQNMKIVVASHNIPTRLFMQWHISAIKVPVLYLDDESQ
FT                   SPSIEEVTTEFLTMTHKLALQLYKTVKLGAKGPGDNLHQLAPELILPEQIIKYLCKAEE
FT                   FMDPASFLSMYNRPIHVTLDSDIVWPAPSRF"
FT   gene            complement(4328207..4329151)
FT                   /pseudo
FT                   /locus_tag="mCG_6125"
FT                   /note="gene_id=mCG6125.2"
FT   mRNA            complement(4328207..4329151)
FT                   /pseudo
FT                   /locus_tag="mCG_6125"
FT                   /note="gene_id=mCG6125.2 transcript_id=mCT5486.2 created on
FT                   09-MAY-2002"
FT   gene            complement(4359240..>4364333)
FT                   /locus_tag="mCG_6124"
FT                   /note="gene_id=mCG6124.2"
FT   mRNA            complement(join(4359240..4359453,4363939..>4364333))
FT                   /locus_tag="mCG_6124"
FT                   /product="mCG6124"
FT                   /note="gene_id=mCG6124.2 transcript_id=mCT5485.2 created on
FT                   09-MAY-2002"
FT   CDS             complement(join(4359294..4359453,4363939..>4364195))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6124"
FT                   /product="mCG6124"
FT                   /note="gene_id=mCG6124.2 transcript_id=mCT5485.2
FT                   protein_id=mCP21659.2"
FT                   /protein_id="EDL14661.1"
FT                   /translation="YNFRTVSVCTRPSSLSTPHLVIRRRSPRDPRITGPAGRVKWCPTW
FT                   STRYDCPPDNGLRIKEVPRRQRNSGTVHRHFTRVSSTDVGSGDQKAVLSPQKRRNLRAA
FT                   TYKQIKKLYLHHGLQQGVPTWCQLKIQTTKKADS"
FT   gene            4789437..4790327
FT                   /pseudo
FT                   /locus_tag="mCG_10393"
FT                   /note="gene_id=mCG10393.1"
FT   mRNA            4789437..4790327
FT                   /pseudo
FT                   /locus_tag="mCG_10393"
FT                   /note="gene_id=mCG10393.1 transcript_id=mCT10410.1 created
FT                   on 08-MAY-2002"
FT   gene            4894146..4915887
FT                   /gene="Steap4"
FT                   /locus_tag="mCG_10394"
FT                   /note="gene_id=mCG10394.2"
FT   mRNA            join(4894146..4894218,4909116..4909573,4910172..4910699,
FT                   4912085..4912249,4913972..4915887)
FT                   /gene="Steap4"
FT                   /locus_tag="mCG_10394"
FT                   /product="STEAP family member 4"
FT                   /note="gene_id=mCG10394.2 transcript_id=mCT10411.2 created
FT                   on 08-MAY-2002"
FT   CDS             join(4909118..4909573,4910172..4910699,4912085..4912249,
FT                   4913972..4914235)
FT                   /codon_start=1
FT                   /gene="Steap4"
FT                   /locus_tag="mCG_10394"
FT                   /product="STEAP family member 4"
FT                   /note="gene_id=mCG10394.2 transcript_id=mCT10411.2
FT                   protein_id=mCP15156.2"
FT                   /protein_id="EDL14662.1"
FT                   /translation="MEKAHADEFPLTTDSSEKQGVVCIFGTGDFGKSLGLKMLQCGYSI
FT                   VFGSRNPQVSSLLPRGAEVLSYSEAASKSDIIILAMHREHYDSLTELVDYLKGKVLVDV
FT                   SNNRKINQYPESNAEYLAQLEPGAHVVKAFNTISAWALQSGTLDASRQVFVCGNDSKAK
FT                   QRVMDIARTLGLTPLDQGSLMAASEIENYPLQLFPMWRFPFYLSSVLCVFFFVYCAIRE
FT                   VIYPYVNGKTDATYRLAISIPNRVFPITALILLALVYLPGILAAILQLYRGTKYRRFPN
FT                   WLDHWMLCRKQLGLVALGFAFLHVIYTLVIPIRYYVRWRLRNATITQALTNKDSPFITS
FT                   YAWINDSYLALGILGFFLFLLLGITSLPSVSNMVNWREFRFVQSKLGYLTLVLCTAHTL
FT                   VYGGKRFLSPSILRWSLPSAYILALVIPCAVLVLKCILIMPCIDKTLTRIRQGWERNSK
FT                   YTQSALNGKSDI"
FT   gene            complement(4970732..>4986145)
FT                   /locus_tag="mCG_144651"
FT                   /note="gene_id=mCG144651.0"
FT   mRNA            complement(join(4970732..4971723,4971745..4972318,
FT                   4972920..4973019,4973419..4973622,4975043..4975091,
FT                   4975411..4975537,4986017..>4986145))
FT                   /locus_tag="mCG_144651"
FT                   /product="mCG144651"
FT                   /note="gene_id=mCG144651.0 transcript_id=mCT184075.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4973470..4973622,4975043..4975091,
FT                   4975411..>4975484))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144651"
FT                   /product="mCG144651"
FT                   /note="gene_id=mCG144651.0 transcript_id=mCT184075.0
FT                   protein_id=mCP106060.0"
FT                   /protein_id="EDL14663.1"
FT                   /translation="IENALALGNIPDQRQSRRPLLTTCQLSSGPLCLLTRCCTSELRNT
FT                   FPGKQQQPLMLSSLGAREMDQWSTALSALPEVYGWIPSTHMEAHKI"
FT   gene            4979515..5002798
FT                   /gene="Sri"
FT                   /locus_tag="mCG_10392"
FT                   /note="gene_id=mCG10392.2"
FT   mRNA            join(4979515..4979653,4990975..4991058,4992790..4992859,
FT                   4995821..4995864,4996697..4996844,4997074..4997187,
FT                   4997995..4998053,5001013..5002798)
FT                   /gene="Sri"
FT                   /locus_tag="mCG_10392"
FT                   /product="sorcin"
FT                   /note="gene_id=mCG10392.2 transcript_id=mCT10409.2 created
FT                   on 08-MAY-2002"
FT   CDS             join(4979648..4979653,4990975..4991058,4992790..4992859,
FT                   4995821..4995864,4996697..4996844,4997074..4997187,
FT                   4997995..4998053,5001013..5001039)
FT                   /codon_start=1
FT                   /gene="Sri"
FT                   /locus_tag="mCG_10392"
FT                   /product="sorcin"
FT                   /note="gene_id=mCG10392.2 transcript_id=mCT10409.2
FT                   protein_id=mCP15154.2"
FT                   /protein_id="EDL14664.1"
FT                   /translation="MQYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQ
FT                   SGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGT
FT                   VDPQELQKALTTMGFRLSPQTVNSVAKRYSTSGKITFDDYIACCVKLRALTDSFRRRDS
FT                   GQQGVVNFSYDDFIQCVMTV"
FT   gene            4988519..4989015
FT                   /locus_tag="mCG_10391"
FT                   /note="gene_id=mCG10391.2"
FT   mRNA            4988519..4989015
FT                   /locus_tag="mCG_10391"
FT                   /product="mCG10391"
FT                   /note="gene_id=mCG10391.2 transcript_id=mCT10408.2 created
FT                   on 09-MAY-2002"
FT   CDS             4988576..4988935
FT                   /codon_start=1
FT                   /locus_tag="mCG_10391"
FT                   /product="mCG10391"
FT                   /note="gene_id=mCG10391.2 transcript_id=mCT10408.2
FT                   protein_id=mCP15153.1"
FT                   /protein_id="EDL14665.1"
FT                   /translation="MGKFMKPGKVLLVLAGCYSGRKAVIVKNIDHGFLDRPYSHALVAG
FT                   IDRYPQKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLNKTVVNKDVFRDP
FT                   ALKQTQGQAGGQGQV"
FT   gene            complement(5025798..>5298610)
FT                   /gene="Adam22"
FT                   /locus_tag="mCG_123115"
FT                   /note="gene_id=mCG123115.1"
FT   mRNA            complement(join(5025798..5025944,5026269..5026369,
FT                   5040194..5040211,5045053..5045143,5049703..5049817,
FT                   5050747..5050915,5054206..5054325,5060485..5060590,
FT                   5063367..5063430,5063643..5063693,5065557..5065637,
FT                   5067670..5067762,5067971..5068042,5069964..5070063,
FT                   5074877..5074928,5076200..5076290,5077379..5077463,
FT                   5078711..5078877,5079613..5079684,5082366..5082440,
FT                   5085537..5085607,5091985..5092054,5093929..5093992,
FT                   5100519..5100601,5165586..5165652,5261803..5261879,
FT                   5297734..5297894,5298409..5298610))
FT                   /gene="Adam22"
FT                   /locus_tag="mCG_123115"
FT                   /product="a disintegrin and metallopeptidase domain 22,
FT                   transcript variant mCT168977"
FT                   /note="gene_id=mCG123115.1 transcript_id=mCT168977.0
FT                   created on 09-MAY-2002"
FT   mRNA            complement(join(5025798..5025944,5026269..5026369,
FT                   5028611..5028718,5045049..5045143,5049703..5049817,
FT                   5050747..5050915,5054206..5054325,5060485..5060590,
FT                   5063367..5063430,5063643..5063693,5065557..5065637,
FT                   5067670..5067762,5067971..5068042,5069964..5070063,
FT                   5074877..5074928,5076200..5076290,5077379..5077463,
FT                   5078711..5078877,5079613..5079684,5082366..5082440,
FT                   5085537..5085607,5091985..5092054,5093929..5093992,
FT                   5100519..5100601,5165586..5165652,5261803..5261879,
FT                   5297734..5297894,5298409..>5298610))
FT                   /gene="Adam22"
FT                   /locus_tag="mCG_123115"
FT                   /product="a disintegrin and metallopeptidase domain 22,
FT                   transcript variant mCT190833"
FT                   /note="gene_id=mCG123115.1 transcript_id=mCT190833.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(5025798..5025944,5026269..5026369,
FT                   5028611..5028718,5040194..5040211,5045053..5045143,
FT                   5049703..5049817,5050747..5050915,5054206..5054325,
FT                   5060485..5060590,5063367..5063430,5063643..5063693,
FT                   5065557..5065637,5067670..5067762,5067971..5068042,
FT                   5069964..5070063,5074877..5074928,5076200..5076290,
FT                   5077379..5077463,5078711..5078877,5079613..5079684,
FT                   5082366..5082440,5085537..5085607,5091985..5092054,
FT                   5093929..5093992,5100519..5100601,5165586..5165652,
FT                   5261803..5261879,5297734..5297894,5298409..5298609))
FT                   /gene="Adam22"
FT                   /locus_tag="mCG_123115"
FT                   /product="a disintegrin and metallopeptidase domain 22,
FT                   transcript variant mCT124344"
FT                   /note="gene_id=mCG123115.1 transcript_id=mCT124344.1
FT                   created on 09-MAY-2002"
FT   CDS             complement(join(5025874..5025944,5026269..5026369,
FT                   5040194..5040211,5045053..5045143,5049703..5049817,
FT                   5050747..5050915,5054206..5054325,5060485..5060590,
FT                   5063367..5063430,5063643..5063693,5065557..5065637,
FT                   5067670..5067762,5067971..5068042,5069964..5070063,
FT                   5074877..5074928,5076200..5076290,5077379..5077463,
FT                   5078711..5078877,5079613..5079684,5082366..5082440,
FT                   5085537..5085607,5091985..5092054,5093929..5093992,
FT                   5100519..5100601,5165586..5165652,5261803..5261879,
FT                   5297734..5297894,5298409..5298487))
FT                   /codon_start=1
FT                   /gene="Adam22"
FT                   /locus_tag="mCG_123115"
FT                   /product="a disintegrin and metallopeptidase domain 22,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123115.1 transcript_id=mCT168977.0
FT                   protein_id=mCP91879.0 isoform=CRA_b"
FT                   /protein_id="EDL14667.1"
FT                   /translation="MQAAAAASFWLLCVLGTCPLARCGRAGVASLKGLERGKENRFLER
FT                   QSIIPLRLIYRLGGEDETQHNQLDTRVRGDPGGPQLTHVDKASFRVDAFGTSFVLDVLL
FT                   NHELLSSGYVERQIEHGGKVVENKGGEHCYYQGQIRGNPVSFVALSTCHGLHGMFYDGN
FT                   HTYLIEPEENEKSQESSHCHSVYKSRQFEFPLDDLPSEFQRVNITPPQFILKPRLKRRK
FT                   RQLLRFPRNVEEETKYIELMIVNDHLMFKKHRLSVVYTNTYAKSVVNMADVIYKDQLKT
FT                   RIVLVAMETWAADNKFAISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGA
FT                   AYIGGICSLLRGGGVNEFGKTDLMAVTLAQSLAHNVGIISDKRKLASGECKCEDTWSGC
FT                   IMGDTGYYLPKKFTQCNVEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDC
FT                   GTPAECALEGAECCKKCTLTQDSQCSDGLCCKKCKFQPLGTVCREAVNDCDIREICSGN
FT                   SSQCAPNVHKMDGYSCDGTQGICFGGRCKTRDRQCKYIWGQKVTASDRYCYEKLNIEGT
FT                   EKGNCGKDKDTWTQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSG
FT                   AHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCSSSKAGTVCSGNGVCSN
FT                   ELKCVCNRHWTGADCGTHFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGI
FT                   TAWGYKNYREQRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNMGGNKKKIRGKR
FT                   FRPRSNSTE"
FT   CDS             complement(join(5025874..5025944,5026269..5026369,
FT                   5028611..5028718,5040194..5040211,5045053..5045143,
FT                   5049703..5049817,5050747..5050915,5054206..5054325,
FT                   5060485..5060590,5063367..5063430,5063643..5063693,
FT                   5065557..5065637,5067670..5067762,5067971..5068042,
FT                   5069964..5070063,5074877..5074928,5076200..5076290,
FT                   5077379..5077463,5078711..5078877,5079613..5079684,
FT                   5082366..5082440,5085537..5085607,5091985..5092054,
FT                   5093929..5093992,5100519..5100601,5165586..5165652,
FT                   5261803..5261879,5297734..5297894,5298409..5298487))
FT                   /codon_start=1
FT                   /gene="Adam22"
FT                   /locus_tag="mCG_123115"
FT                   /product="a disintegrin and metallopeptidase domain 22,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123115.1 transcript_id=mCT124344.1
FT                   protein_id=mCP87759.1 isoform=CRA_a"
FT                   /protein_id="EDL14666.1"
FT                   /translation="MQAAAAASFWLLCVLGTCPLARCGRAGVASLKGLERGKENRFLER
FT                   QSIIPLRLIYRLGGEDETQHNQLDTRVRGDPGGPQLTHVDKASFRVDAFGTSFVLDVLL
FT                   NHELLSSGYVERQIEHGGKVVENKGGEHCYYQGQIRGNPVSFVALSTCHGLHGMFYDGN
FT                   HTYLIEPEENEKSQESSHCHSVYKSRQFEFPLDDLPSEFQRVNITPPQFILKPRLKRRK
FT                   RQLLRFPRNVEEETKYIELMIVNDHLMFKKHRLSVVYTNTYAKSVVNMADVIYKDQLKT
FT                   RIVLVAMETWAADNKFAISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGA
FT                   AYIGGICSLLRGGGVNEFGKTDLMAVTLAQSLAHNVGIISDKRKLASGECKCEDTWSGC
FT                   IMGDTGYYLPKKFTQCNVEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDC
FT                   GTPAECALEGAECCKKCTLTQDSQCSDGLCCKKCKFQPLGTVCREAVNDCDIREICSGN
FT                   SSQCAPNVHKMDGYSCDGTQGICFGGRCKTRDRQCKYIWGQKVTASDRYCYEKLNIEGT
FT                   EKGNCGKDKDTWTQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSG
FT                   AHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCSSSKAGTVCSGNGVCSN
FT                   ELKCVCNRHWTGADCGTHFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGI
FT                   TAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDFPPGGSTNSASSSKKRSNGLSHSWSER
FT                   IPDTKHISDICENGRPRSNSWQGNMGGNKKKIRGKRFRPRSNSTE"
FT   CDS             complement(join(5045049..5045143,5049703..5049817,
FT                   5050747..5050915,5054206..5054325,5060485..5060590,
FT                   5063367..5063430,5063643..5063693,5065557..5065637,
FT                   5067670..5067762,5067971..5068042,5069964..5070063,
FT                   5074877..5074928,5076200..5076290,5077379..5077463,
FT                   5078711..5078877,5079613..5079684,5082366..5082440,
FT                   5085537..5085607,5091985..5092054,5093929..5093992,
FT                   5100519..5100601,5165586..5165652,5261803..5261879,
FT                   5297734..5297894,5298409..>5298580))
FT                   /codon_start=1
FT                   /gene="Adam22"
FT                   /locus_tag="mCG_123115"
FT                   /product="a disintegrin and metallopeptidase domain 22,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG123115.1 transcript_id=mCT190833.0
FT                   protein_id=mCP111778.0 isoform=CRA_c"
FT                   /protein_id="EDL14668.1"
FT                   /translation="GHGGCGSGSSWEGAVGRPSPRPGQEQLSAATMQAAAAASFWLLCV
FT                   LGTCPLARCGRAGVASLKGLERGKENRFLERQSIIPLRLIYRLGGEDETQHNQLDTRVR
FT                   GDPGGPQLTHVDKASFRVDAFGTSFVLDVLLNHELLSSGYVERQIEHGGKVVENKGGEH
FT                   CYYQGQIRGNPVSFVALSTCHGLHGMFYDGNHTYLIEPEENEKSQESSHCHSVYKSRQF
FT                   EFPLDDLPSEFQRVNITPPQFILKPRLKRRKRQLLRFPRNVEEETKYIELMIVNDHLMF
FT                   KKHRLSVVYTNTYAKSVVNMADVIYKDQLKTRIVLVAMETWAADNKFAISENPLITLRE
FT                   FMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGICSLLRGGGVNEFGKTDLMAVTL
FT                   AQSLAHNVGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNVEEYHDFLNSG
FT                   GGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECALEGAECCKKCTLTQDSQCSDG
FT                   LCCKKCKFQPLGTVCREAVNDCDIREICSGNSSQCAPNVHKMDGYSCDGTQGICFGGRC
FT                   KTRDRQCKYIWGQKVTASDRYCYEKLNIEGTEKGNCGKDKDTWTQCNKRDVLCGYLLCT
FT                   NIGNIPRLGELDGEITSTLVVQQGRTLNCSGAHVKLEEDVDLGYVEDGTPCGPQMMCLE
FT                   HRCLPVASFNFSTCSSSKAGTVCSGNGVCSNELKCVCNRHWTGADCGTHFPHNDDAKTG
FT                   ITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYK"
FT   gene            complement(5316773..5343011)
FT                   /gene="Dbf4"
FT                   /locus_tag="mCG_1487"
FT                   /note="gene_id=mCG1487.2"
FT   mRNA            complement(join(5316773..5318455,5319981..5320105,
FT                   5323374..5323485,5323906..5324034,5325165..5325210,
FT                   5326096..5326132,5328528..5328604,5328788..5328857,
FT                   5330304..5330354,5332415..5332594,5341515..5341687,
FT                   5342761..5343011))
FT                   /gene="Dbf4"
FT                   /locus_tag="mCG_1487"
FT                   /product="DBF4 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG1487.2 transcript_id=mCT7929.1 created on
FT                   08-MAY-2002"
FT   CDS             complement(join(5317510..5318455,5319981..5320105,
FT                   5323374..5323485,5323906..5324034,5325165..5325210,
FT                   5326096..5326132,5328528..5328604,5328788..5328857,
FT                   5330304..5330354,5332415..5332594,5341515..5341687,
FT                   5342761..5342806))
FT                   /codon_start=1
FT                   /gene="Dbf4"
FT                   /locus_tag="mCG_1487"
FT                   /product="DBF4 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG1487.2 transcript_id=mCT7929.1
FT                   protein_id=mCP8676.1"
FT                   /db_xref="GOA:B2RS44"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR006572"
FT                   /db_xref="MGI:MGI:1351328"
FT                   /db_xref="UniProtKB/TrEMBL:B2RS44"
FT                   /protein_id="EDL14669.1"
FT                   /translation="MNLETMRIHSKAPLPGGIQDRNEKNRPSLKSLKADNRLEKSKYKP
FT                   LWGKIFYLDLPSITICEKLQKDIKELGGRVEEFLSKDISYFVSNKKEAKYAQTLGRVSP
FT                   VPSPESAYTAETTSPHPSHDGSSFKSQDRVCLSRGKLLAEKAVKDHDFIPANSILSNAL
FT                   SWGVKILHIDDIRYYIEQKKKALSALKKSSASGKDAGKKAGPGIQKTRTGRLKKPFLKV
FT                   EDVNRCYRPFYLQLPSLPCINYFLQKPCSPFDIEKSSSVQKQAQPKLRINMDGDKCGTP
FT                   VQLQLKEKRKKGYCECCLQKYEDLETHLLSEKHRNFAQSNQYQVVDDIVSQLVFDFVEY
FT                   GRDTPQKKRIRYSVGSLSSVSANVLKNTAPKEKPLLEPNFQKDVGESSGHLLKPNSQYE
FT                   ETQKPEEKHGFASEPTTYSSAGLKGCDRKPVSMFNASEPDPEQEYAQLPLRDSTPEHQV
FT                   TEGRNDGEQRVDPAPGVSQSCGQVSHLSTESNLPQPQLAADITQLSAKDLQEKGFHVVI
FT                   GHASDLVALNTSKEQLTMKARTPPCSPQEPHECDTENMENLPCGKIQRKVRMLLGQQKA
FT                   NAEPSAELDKKRTEYLPAHEDRTCGSPVQSLLDLFQTSEEKSEFLGFTGYTENSGICDV
FT                   LDIWEEENSSTLLSTFFSSPSTSAFVGF"
FT   gene            <5343144..5375195
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /note="gene_id=mCG1488.2"
FT   mRNA            join(5343144..5343333,5345091..5345181,5347490..5347561,
FT                   5347702..5347810,5348923..5348982,5350704..5350810,
FT                   5361014..5361081,5362740..5362864,5363970..5364143,
FT                   5367656..5367765,5369971..5370052,5373104..5373269,
FT                   5374056..5375195)
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, transcript variant
FT                   mCT7930"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT7930.2 created on
FT                   08-MAY-2002"
FT   mRNA            join(5343144..5343333,5347490..5347561,5347702..5347810,
FT                   5348923..5348982,5350704..5350810,5361014..5361081,
FT                   5362740..5362864,5363970..5364143,5367656..5367765,
FT                   5369971..5370052,5373104..5373269,5374056..5375195)
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, transcript variant
FT                   mCT168978"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT168978.0 created
FT                   on 08-MAY-2002"
FT   mRNA            join(<5343144..5343333,5347490..5347561,5347702..5347810,
FT                   5348923..5348982,5350704..5350810,5361014..5361081,
FT                   5362740..5362864,5363970..5364143,5367656..5367765,
FT                   5369971..5370052,5373104..5373184,5373550..5375093)
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, transcript variant
FT                   mCT190837"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT190837.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<5343182..5343333,5347490..5347561,5347702..5347810,
FT                   5348923..5348982,5350723..5350810,5361014..5361081,
FT                   5362740..5362864,5363970..5364143,5367656..5367765,
FT                   5369971..5370052,5373104..5373184,5373550..5375195)
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, transcript variant
FT                   mCT190836"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT190836.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<5343192..5343333,5347702..5347810,5348923..5348982,
FT                   5350704..5350810,5361014..5361081,5362740..5362864,
FT                   5363970..5364143,5367656..5367765,5369971..5370052,
FT                   5373104..5373184,5373550..5375094)
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, transcript variant
FT                   mCT190835"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT190835.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5343193..5343333,5347702..5347810,5348923..5348982,
FT                   5350704..5350810,5361014..5361081,5362740..5362864,
FT                   5363970..5364143,5367656..5367765,5369971..5370052,
FT                   5373104..5373184,5373550..5373656)
FT                   /codon_start=1
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, isoform CRA_a"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT190835.0
FT                   protein_id=mCP111781.0 isoform=CRA_a"
FT                   /protein_id="EDL14670.1"
FT                   /translation="EFRLRSAYLECGAARAVDAVSLGGFTSWSTSPARLAETRALQSPR
FT                   HQLKSMEPETEGPPPTIPVTPLQQMIASCTGAVLTSLMVTPLDVVKIRLQAQNNPFPKG
FT                   KCFLYSNGLMDHMCVCEEESKKAWYKKPGNFRGTLDAFLKILRNEGIKSLWSGLPPTLV
FT                   MAIPATVIYFTCYEQLSAFLKTKLGENETRIPIVAGVVARFGAVTVISPLELIRTKVQS
FT                   KKFSYKELYQFVSMRVSEDGWISLWKGWAPTILRDVPFSAMYWYNYENLKRWLCEKSGL
FT                   YEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTNEYCKFPAPLDMSTWTIMKN
FT                   IVADKGFSGLFTGLIPRLVKIVPACAIMISSYELGKSFFQKQNVESR"
FT   CDS             join(<5347559..5347561,5347702..5347810,5348923..5348982,
FT                   5350704..5350810,5361014..5361081,5362740..5362864,
FT                   5363970..5364143,5367656..5367765,5369971..5370052,
FT                   5373104..5373184,5373550..5373656)
FT                   /codon_start=1
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, isoform CRA_c"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT190837.0
FT                   protein_id=mCP111783.0 isoform=CRA_c"
FT                   /protein_id="EDL14672.1"
FT                   /translation="QLKSMEPETEGPPPTIPVTPLQQMIASCTGAVLTSLMVTPLDVVK
FT                   IRLQAQNNPFPKGKCFLYSNGLMDHMCVCEEESKKAWYKKPGNFRGTLDAFLKILRNEG
FT                   IKSLWSGLPPTLVMAIPATVIYFTCYEQLSAFLKTKLGENETRIPIVAGVVARFGAVTV
FT                   ISPLELIRTKVQSKKFSYKELYQFVSMRVSEDGWISLWKGWAPTILRDVPFSAMYWYNY
FT                   ENLKRWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTNEYCKFP
FT                   APLDMSTWTIMKNIVADKGFSGLFTGLIPRLVKIVPACAIMISSYELGKSFFQKQNVES
FT                   R"
FT   CDS             join(5347711..5347810,5348923..5348982,5350704..5350810,
FT                   5361014..5361081,5362740..5362864,5363970..5364143,
FT                   5367656..5367765,5369971..5370052,5373104..5373269,
FT                   5374056..5374128)
FT                   /codon_start=1
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, isoform CRA_d"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT7930.2
FT                   protein_id=mCP8670.2 isoform=CRA_d"
FT                   /protein_id="EDL14673.1"
FT                   /translation="MEPETEGPPPTIPVTPLQQMIASCTGAVLTSLMVTPLDVVKIRLQ
FT                   AQNNPFPKGKCFLYSNGLMDHMCVCEEESKKAWYKKPGNFRGTLDAFLKILRNEGIKSL
FT                   WSGLPPTLVMAIPATVIYFTCYEQLSAFLKTKLGENETRIPIVAGVVARFGAVTVISPL
FT                   ELIRTKVQSKKFSYKELYQFVSMRVSEDGWISLWKGWAPTILRDVPFSAMYWYNYENLK
FT                   RWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTNEYCKFPAPLD
FT                   MSTWTIMKNIVADKGFSGLFTGKNLSFTESLNTIIHFHLLLQLASSKCDSLSISVKSGR
FT                   AIMWHCSHSPDGAC"
FT   CDS             join(5347711..5347810,5348923..5348982,5350704..5350810,
FT                   5361014..5361081,5362740..5362864,5363970..5364143,
FT                   5367656..5367765,5369971..5370052,5373104..5373269,
FT                   5374056..5374128)
FT                   /codon_start=1
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, isoform CRA_d"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT168978.0
FT                   protein_id=mCP91857.0 isoform=CRA_d"
FT                   /protein_id="EDL14674.1"
FT                   /translation="MEPETEGPPPTIPVTPLQQMIASCTGAVLTSLMVTPLDVVKIRLQ
FT                   AQNNPFPKGKCFLYSNGLMDHMCVCEEESKKAWYKKPGNFRGTLDAFLKILRNEGIKSL
FT                   WSGLPPTLVMAIPATVIYFTCYEQLSAFLKTKLGENETRIPIVAGVVARFGAVTVISPL
FT                   ELIRTKVQSKKFSYKELYQFVSMRVSEDGWISLWKGWAPTILRDVPFSAMYWYNYENLK
FT                   RWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTNEYCKFPAPLD
FT                   MSTWTIMKNIVADKGFSGLFTGKNLSFTESLNTIIHFHLLLQLASSKCDSLSISVKSGR
FT                   AIMWHCSHSPDGAC"
FT   CDS             join(<5348945..5348982,5350723..5350810,5361014..5361081,
FT                   5362740..5362864,5363970..5364143,5367656..5367765,
FT                   5369971..5370052,5373104..5373184,5373550..5373656)
FT                   /codon_start=1
FT                   /gene="B230315F11Rik"
FT                   /locus_tag="mCG_1488"
FT                   /product="RIKEN cDNA B230315F11, isoform CRA_b"
FT                   /note="gene_id=mCG1488.2 transcript_id=mCT190836.0
FT                   protein_id=mCP111782.0 isoform=CRA_b"
FT                   /protein_id="EDL14671.1"
FT                   /translation="NSTPGPEQPIPQSNGLMDHMCVCEEESKKAWYKKPGNFRGTLDAF
FT                   LKILRNEGIKSLWSGLPPTLVMAIPATVIYFTCYEQLSAFLKTKLGENETRIPIVAGVV
FT                   ARFGAVTVISPLELIRTKVQSKKFSYKELYQFVSMRVSEDGWISLWKGWAPTILRDVPF
FT                   SAMYWYNYENLKRWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLW
FT                   TNEYCKFPAPLDMSTWTIMKNIVADKGFSGLFTGLIPRLVKIVPACAIMISSYELGKSF
FT                   FQKQNVESR"
FT   gene            complement(5410693..>5411631)
FT                   /locus_tag="mCG_1036399"
FT                   /note="gene_id=mCG1036399.1"
FT   mRNA            complement(5410693..>5411631)
FT                   /locus_tag="mCG_1036399"
FT                   /product="mCG1036399"
FT                   /note="gene_id=mCG1036399.1 transcript_id=mCT154103.1
FT                   created on 08-MAY-2002"
FT   CDS             complement(5411324..>5411629)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036399"
FT                   /product="mCG1036399"
FT                   /note="gene_id=mCG1036399.1 transcript_id=mCT154103.1
FT                   protein_id=mCP87864.1"
FT                   /protein_id="EDL14675.1"
FT                   /translation="IPPKASWGVLNSQVHSFYPKCRGGRFWEVLGAQSHGVESINSNMT
FT                   SVTCEAVQTLISGAKEACKLMTDIASGDSEQTEQFLPEADALKQSTSIFSDLCAPY"
FT   gene            complement(5412167..>5543046)
FT                   /gene="Gm440"
FT                   /locus_tag="mCG_123117"
FT                   /note="gene_id=mCG123117.1"
FT   mRNA            complement(join(5412167..5412943,5415138..5415259,
FT                   5432615..5432761,5441213..5441370,5448960..5449128,
FT                   5468699..5468779,5480080..5480169,5490155..5490240,
FT                   5499685..5499818,5524304..5524419,5542922..>5543046))
FT                   /gene="Gm440"
FT                   /locus_tag="mCG_123117"
FT                   /product="gene model 440, (NCBI)"
FT                   /note="gene_id=mCG123117.1 transcript_id=mCT124346.1
FT                   created on 08-MAY-2002"
FT   CDS             complement(join(5412798..5412943,5415138..5415259,
FT                   5432615..5432761,5441213..5441370,5448960..5449128,
FT                   5468699..5468779,5480080..5480169,5490155..5490240,
FT                   5499685..5499818,5524304..5524419,5542922..5543046))
FT                   /codon_start=1
FT                   /gene="Gm440"
FT                   /locus_tag="mCG_123117"
FT                   /product="gene model 440, (NCBI)"
FT                   /note="gene_id=mCG123117.1 transcript_id=mCT124346.1
FT                   protein_id=mCP87768.1"
FT                   /db_xref="GOA:D3YUQ5"
FT                   /db_xref="InterPro:IPR004012"
FT                   /db_xref="MGI:MGI:2685286"
FT                   /db_xref="UniProtKB/TrEMBL:D3YUQ5"
FT                   /protein_id="EDL14676.1"
FT                   /translation="MASRSLGGLSGSRGGGGGGGGKKSLSARNAAVERRNLITVCRFSV
FT                   KTLIDRSCFETIDDSSPEFNNFAAVLEQILSHRLKGQVTWFGYESPRSFWDYIRVACRK
FT                   VSQNCICSIENMENVSSSRAKGRAWIRVALMEKHLSEYISTALRDFKTTRRFYEDGAIV
FT                   LGEEANMLAGMLLGLNAIDFSFCLKGEGLDGTFPAVIDYTPYLKFEQSSDSISSDEEEL
FT                   RTFGSSDSESSTPENVGPPLILDENTWFNKCKRVRQKYQLTLEQKGYLEELLRLRENQL
FT                   SESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLRSRQELTAHLTK
FT                   QWPSPGALDVNAVALDTLLYRKHNKQWYDKSYQSLDQLSAEVSLSQASLDPSHSQEGDG
FT                   KQDSLNFIGEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDCLASPTTELTSPGLTPS"
FT   gene            5580580..5668100
FT                   /locus_tag="mCG_1178"
FT                   /note="gene_id=mCG1178.1"
FT   mRNA            join(5580580..5580710,5581150..5581220,5585034..5585082,
FT                   5595171..5595330,5603898..5603949,5605735..5605926,
FT                   5606641..5606812,5614578..5614702,5618998..5619169,
FT                   5622121..5622234,5622379..5622489,5622665..5622790,
FT                   5622881..5623084,5623305..5623475,5632442..5632603,
FT                   5634089..5634265,5634944..5635090,5638181..5638288,
FT                   5639193..5639270,5642361..5642444,5645975..5646178,
FT                   5651724..5651824,5653031..5653171,5657047..5657203,
FT                   5658127..5658324,5659841..5660047,5666090..5666236,
FT                   5666936..5668100)
FT                   /locus_tag="mCG_1178"
FT                   /product="mCG1178"
FT                   /note="gene_id=mCG1178.1 transcript_id=mCT8381.1 created on
FT                   08-MAY-2002"
FT   CDS             join(5581156..5581220,5585034..5585082,5595171..5595330,
FT                   5603898..5603949,5605735..5605926,5606641..5606812,
FT                   5614578..5614702,5618998..5619169,5622121..5622234,
FT                   5622379..5622489,5622665..5622790,5622881..5623084,
FT                   5623305..5623475,5632442..5632603,5634089..5634265,
FT                   5634944..5635090,5638181..5638288,5639193..5639270,
FT                   5642361..5642444,5645975..5646178,5651724..5651824,
FT                   5653031..5653171,5657047..5657203,5658127..5658324,
FT                   5659841..5660047,5666090..5666236,5666936..5667142)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1178"
FT                   /product="mCG1178"
FT                   /note="gene_id=mCG1178.1 transcript_id=mCT8381.1
FT                   protein_id=mCP8677.2"
FT                   /db_xref="GOA:P21447"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:97570"
FT                   /db_xref="PDB:3G5U"
FT                   /db_xref="PDB:3G60"
FT                   /db_xref="PDB:3G61"
FT                   /db_xref="PDB:4KSB"
FT                   /db_xref="PDB:4KSC"
FT                   /db_xref="PDB:4KSD"
FT                   /db_xref="PDB:4LSG"
FT                   /db_xref="PDB:4M1M"
FT                   /db_xref="PDB:4M2S"
FT                   /db_xref="PDB:4M2T"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21447"
FT                   /protein_id="EDL14677.1"
FT                   /translation="MELEEDLKGRADKNFSKMGKKSKKEKKEKKPAVSVLTMFRYAGWL
FT                   DRLYMLVGTLAAIIHGVALPLMMLIFGDMTDSFASVGNVSKNSTNMSEADKRAMFAKLE
FT                   EEMTTYAYYYTGIGAGVLIVAYIQVSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHD
FT                   VGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLG
FT                   LSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAK
FT                   RLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVLTVFFSVLIGAFS
FT                   VGQASPNIEAFANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPS
FT                   RKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTIN
FT                   VRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFD
FT                   TLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGR
FT                   TTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTAGNEIELGN
FT                   EACKSKDEIDNLDMSSKDSGSSLIRRRSTRKSICGPHDQDRKLSTKEALDEDVPPASFW
FT                   RILKLNSTEWPYFVVGIFCAIINGGLQPAFSVIFSKVVGVFTNGGPPETQRQNSNLFSL
FT                   LFLILGIISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTT
FT                   RLANDAAQVKGATGSRLAVIFQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVE
FT                   MKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETMYAQSLQIPYRNAMKK
FT                   AHVFGITFSFTQAMMYFSYAACFRFGAYLVTQQLMTFENVLLVFSAIVFGAMAVGQVSS
FT                   FAPDYAKATVSASHIIRIIEKTPEIDSYSTQGLKPNMLEGNVQFSGVVFNYPTRPSIPV
FT                   LQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRA
FT                   QLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTRVG
FT                   DKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIV
FT                   IAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSVQAGAKRS"
FT   gene            complement(5693252..5718109)
FT                   /locus_tag="mCG_140325"
FT                   /note="gene_id=mCG140325.0"
FT   mRNA            complement(join(5693252..5693767,5709489..5709726,
FT                   5717606..5718109))
FT                   /locus_tag="mCG_140325"
FT                   /product="mCG140325, transcript variant mCT168982"
FT                   /note="gene_id=mCG140325.0 transcript_id=mCT168982.0
FT                   created on 08-MAY-2002"
FT   mRNA            complement(join(5701316..5701538,5709489..5709726,
FT                   5717606..5718109))
FT                   /locus_tag="mCG_140325"
FT                   /product="mCG140325, transcript variant mCT168981"
FT                   /note="gene_id=mCG140325.0 transcript_id=mCT168981.0
FT                   created on 08-MAY-2002"
FT   CDS             complement(join(5709560..5709726,5717606..5717864))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140325"
FT                   /product="mCG140325, isoform CRA_a"
FT                   /note="gene_id=mCG140325.0 transcript_id=mCT168981.0
FT                   protein_id=mCP91870.0 isoform=CRA_a"
FT                   /protein_id="EDL14678.1"
FT                   /translation="MEAAASASYGFKSHCGKEPEGFLGPRIKIDASGRPKARQPISLVG
FT                   GIGHGQLERLRNRRYFQAYPDFFEKGAGSLRHLHRLVFTCSVGSVFTPGLKSLNCEMTW
FT                   ERSSVFTPGLKSINCEVTWERSMASHLGVSILTDLIP"
FT   CDS             complement(join(5709560..5709726,5717606..5717864))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140325"
FT                   /product="mCG140325, isoform CRA_a"
FT                   /note="gene_id=mCG140325.0 transcript_id=mCT168982.0
FT                   protein_id=mCP91871.0 isoform=CRA_a"
FT                   /protein_id="EDL14679.1"
FT                   /translation="MEAAASASYGFKSHCGKEPEGFLGPRIKIDASGRPKARQPISLVG
FT                   GIGHGQLERLRNRRYFQAYPDFFEKGAGSLRHLHRLVFTCSVGSVFTPGLKSLNCEMTW
FT                   ERSSVFTPGLKSINCEVTWERSMASHLGVSILTDLIP"
FT   gene            5717848..5786033
FT                   /locus_tag="mCG_1177"
FT                   /note="gene_id=mCG1177.1"
FT   mRNA            join(5717848..5717951,5718398..5718468,5725095..5725143,
FT                   5725670..5725832,5730220..5730277,5732317..5732508,
FT                   5733236..5733407,5734385..5734509,5740935..5741106,
FT                   5743595..5743708,5743850..5743960,5744136..5744261,
FT                   5744352..5744555,5744776..5744946,5745214..5745375,
FT                   5746989..5747162,5747366..5747512,5748486..5748593,
FT                   5751857..5751934,5754691..5754774,5757254..5757457,
FT                   5765405..5765505,5769169..5769309,5771114..5771270,
FT                   5773086..5773283,5781149..5781355,5783840..5783986,
FT                   5785475..5786033)
FT                   /locus_tag="mCG_1177"
FT                   /product="mCG1177"
FT                   /note="gene_id=mCG1177.1 transcript_id=mCT8380.0 created on
FT                   08-MAY-2002"
FT   CDS             join(5718404..5718468,5725095..5725143,5725670..5725832,
FT                   5730220..5730277,5732317..5732508,5733236..5733407,
FT                   5734385..5734509,5740935..5741106,5743595..5743708,
FT                   5743850..5743960,5744136..5744261,5744352..5744555,
FT                   5744776..5744946,5745214..5745375,5746989..5747162,
FT                   5747366..5747512,5748486..5748593,5751857..5751934,
FT                   5754691..5754774,5757254..5757457,5765405..5765505,
FT                   5769169..5769309,5771114..5771270,5773086..5773283,
FT                   5781149..5781355,5783840..5783986,5785475..5785675)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1177"
FT                   /product="mCG1177"
FT                   /note="gene_id=mCG1177.1 transcript_id=mCT8380.0
FT                   protein_id=mCP8673.1"
FT                   /db_xref="GOA:B2RUR3"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:97568"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUR3"
FT                   /protein_id="EDL14680.1"
FT                   /translation="MEFEENLKGRADKNFSKMGKKSKKEKKEKKPAVGVFGMFRYADWL
FT                   DKLCMILGTLAAIIHGTLLPLLMLVFGNMTDSFTKAEASILPSITNQSGPNSTLIISNS
FT                   SLEEEMAIYAYYYTGIGAGVLIVAYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFD
FT                   VHDVGELNTRLTDDVSKINDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSP
FT                   LIGLSSALWAKVLTSFTNKELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLE
FT                   EAKNVGIKKAITASISIGIAYLLVYASYALAFWYGTSLVLSNEYSIGEVLTVFFSILLG
FT                   TFSIGHLAPNIEAFANARGAAFEIFKIIDNEPSIDSFSTKGYKPDSIMGNLEFKNVHFN
FT                   YPSRSEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIR
FT                   TINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPH
FT                   QFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAR
FT                   EGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTRGNEIE
FT                   PGNNAYGSQSDTDASELTSEESKSPLIRRSIYRSVHRKQDQERRLSMKEAVDEDVPLVS
FT                   FWRILNLNLSEWPYLLVGVLCAVINGCIQPVFAIVFSRIVGVFSRDDDHETKRQNCNLF
FT                   SLFFLVMGLISFVTYFFQGFTFGKAGEILTKRVRYMVFKSMLRQDISWFDDHKNSTGSL
FT                   TTRLASDASSVKGAMGARLAVVTQNVANLGTGVILSLVYGWQLTLLLVVIIPLIVLGGI
FT                   IEMKLLSGQALKDKKQLEISGKIATEAIENFRTIVSLTREQKFETMYAQSLQVPYRNAM
FT                   KKAHVFGITFSFTQAMMYFSYAACFRFGAYLVAQQLMTFENVMLVFSAVVFGAMAAGNT
FT                   SSFAPDYAKAKVSASHIIRIIEKTPEIDSYSTEGLKPTLLEGNVKFNGVQFNYPTRPNI
FT                   PVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWL
FT                   RAHLGIVSQEPILFDCSIAENIAYGDNSRAVSHEEIVRAAKEANIHQFIDSLPDKYNTR
FT                   VGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTC
FT                   IVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMVQAGAKRS"
FT   gene            5813442..5878635
FT                   /locus_tag="mCG_123112"
FT                   /note="gene_id=mCG123112.0"
FT   mRNA            join(5813442..5813632,5813813..5813889,5816298..5816352,
FT                   5819295..5819445,5825702..5825759,5826935..5827126,
FT                   5828829..5829000,5830346..5830470,5834683..5834854,
FT                   5838386..5838499,5839747..5839857,5840062..5840187,
FT                   5847488..5847691,5848124..5848294,5850459..5850620,
FT                   5853875..5854045,5854895..5855041,5856504..5856608,
FT                   5858298..5858375,5859553..5859636,5860630..5860833,
FT                   5865428..5865528,5866706..5866846,5869358..5869514,
FT                   5870069..5870266,5874798..5875004,5877720..5877866,
FT                   5878378..5878635)
FT                   /locus_tag="mCG_123112"
FT                   /product="mCG123112"
FT                   /note="gene_id=mCG123112.0 transcript_id=mCT124341.0
FT                   created on 08-MAY-2002"
FT   CDS             join(5813819..5813889,5816298..5816352,5819295..5819445,
FT                   5825702..5825759,5826935..5827126,5828829..5829000,
FT                   5830346..5830470,5834683..5834854,5838386..5838499,
FT                   5839747..5839857,5840062..5840187,5847488..5847691,
FT                   5848124..5848294,5850459..5850620,5853875..5854045,
FT                   5854895..5855041,5856504..5856608,5858298..5858375,
FT                   5859553..5859636,5860630..5860833,5865428..5865528,
FT                   5866706..5866846,5869358..5869514,5870069..5870266,
FT                   5874798..5875004,5877720..5877866,5878378..5878584)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123112"
FT                   /product="mCG123112"
FT                   /note="gene_id=mCG123112.0 transcript_id=mCT124341.0
FT                   protein_id=mCP87804.1"
FT                   /db_xref="GOA:P21440"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:97569"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21440"
FT                   /protein_id="EDL14681.1"
FT                   /translation="MDLEAARNGTARRLDGDFELGSISNQGREKKKKVNLIGLLTLFRY
FT                   SDWQDKLFMFLGTLMAIAHGSGLPLMMIVFGEMTDKFVDNTGNFSLPVNFSLSMLNPGR
FT                   ILEEEMTRYAYYYSGLGGGVLVAAYIQVSFWTLAAGRQIKKIRQKFFHAILRQEMGWFD
FT                   IKGTTELNTRLTDDVSKISEGIGDKVGMFFQAIATFFAGFIVGFIRGWKLTLVIMAISP
FT                   ILGLSTAVWAKILSTFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLE
FT                   NAKKIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIG
FT                   AFSVGQAAPCIDAFANARGAAYVIFDIIDNNPKIDSFSERGHKPDNIKGNLEFSDVHFS
FT                   YPSRANIKILKGLNLKVKSGQTVALVGNSGCGKSTTVQLLQRLYDPTEGKISIDGQDIR
FT                   NFNVRCLREIIGVVSQEPVLFSTTIAENIRYGRGNVTMDEIEKAVKEANAYDFIMKLPQ
FT                   KFDTLVGDRGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAR
FT                   EGRTTIVIAHRLSTIRNADVIAGFEDGVIVEQGSHSELMKKEGIYFRLVNMQTAGSQIL
FT                   SEEFEVELSDEKAAGDVAPNGWKARIFRNSTKKSLKSPHQNRLDEETNELDANVPPVSF
FT                   LKVLKLNKTEWPYFVVGTVCAIANGALQPAFSIILSEMIAIFGPGDDAVKQQKCNMFSL
FT                   VFLGLGVLSFFTFFLQGFTFGKAGEILTTRLRSMAFKAMLRQDMSWFDDHKNSTGALST
FT                   RLATDAAQVQGATGTRLALIAQNTANLGTGIIISFIYGWQLTLLLLSVVPFIAVAGIVE
FT                   MKMLAGNAKRDKKEMEAAGKIATEAIENIRTVVSLTQERKFESMYVEKLHGPYRNSVRK
FT                   AHIYGITFSISQAFMYFSYAGCFRFGSYLIVNGHMRFKDVILVFSAIVLGAVALGHASS
FT                   FAPDYAKAKLSAAYLFSLFERQPLIDSYSGEGLWPDKFEGSVTFNEVVFNYPTRANVPV
FT                   LQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVLLDGQEAKKLNVQWLRA
FT                   QLGIVSQEPILFDCSIAENIAYGDNSRVVPHDEIVRAAKEANIHPFIETLPQKYNTRVG
FT                   DKGTQLSGGQKQRIAIARALIRQPRVLLLDEATSALDTESEKVVQEALDKAREGRTCIV
FT                   IAHRLSTIQNADLIVVIENGKVKEHGTHQQLLAQKGIYFSMVNIQAGTQNL"
FT   gene            5832602..5833528
FT                   /pseudo
FT                   /locus_tag="mCG_123118"
FT                   /note="gene_id=mCG123118.1"
FT   mRNA            5832602..5833528
FT                   /pseudo
FT                   /locus_tag="mCG_123118"
FT                   /note="gene_id=mCG123118.1 transcript_id=mCT124347.1
FT                   created on 08-MAY-2002"
FT   gene            complement(5885437..5916786)
FT                   /gene="Crot"
FT                   /locus_tag="mCG_1181"
FT                   /note="gene_id=mCG1181.2"
FT   mRNA            complement(join(5885437..5886381,5888056..5888175,
FT                   5888279..5888372,5888457..5888535,5889325..5889448,
FT                   5892995..5893125,5893354..5893461,5893542..5893625,
FT                   5895417..5895518,5896864..5896989,5897607..5897700,
FT                   5903098..5903206,5907177..5907301,5907513..5907694,
FT                   5909015..5909139,5912913..5913048,5915859..5915954,
FT                   5916511..5916786))
FT                   /gene="Crot"
FT                   /locus_tag="mCG_1181"
FT                   /product="carnitine O-octanoyltransferase"
FT                   /note="gene_id=mCG1181.2 transcript_id=mCT8384.2 created on
FT                   08-MAY-2002"
FT   CDS             complement(join(5886261..5886381,5888056..5888175,
FT                   5888279..5888372,5888457..5888535,5889325..5889448,
FT                   5892995..5893125,5893354..5893461,5893542..5893625,
FT                   5895417..5895518,5896864..5896989,5897607..5897700,
FT                   5903098..5903206,5907177..5907301,5907513..5907694,
FT                   5909015..5909139,5912913..5913027))
FT                   /codon_start=1
FT                   /gene="Crot"
FT                   /locus_tag="mCG_1181"
FT                   /product="carnitine O-octanoyltransferase"
FT                   /note="gene_id=mCG1181.2 transcript_id=mCT8384.2
FT                   protein_id=mCP8683.2"
FT                   /protein_id="EDL14682.1"
FT                   /translation="MENQLTKSVEERTFQYQDSLPSLPVPALEESLKKYLESVKPFANE
FT                   DEYKKTEEIVQKFQEGAGKRLHQKLLERARGKRNWLEEWWLNVAYLDVRIPSQLNVNFV
FT                   GPCPHFEHYWPAREGTQLERGSMMLWHNLNYWQLLRREKLPVHKSGNTPLDMNQFRMLF
FT                   STCKVPGITRDSIMNYFKTESEGHCPTHIAVLCRGRAFVFDVLHEGCLITPPELLRQLT
FT                   YIHKKCSNEPVGPSIAALTSEERTRWAKAREYLISLDPENLTLLEKIQTSLFVYSIEDS
FT                   SPHATPEEYSQVFEMLLGGDPSVRWGDKSYNLISFANGIFGCCCDHAPYDAMVMVNIAH
FT                   YVDERVLETEGRWKGSEKVRDIPLPEELVFTVDEKILNDVSQAKAQHLKAASDLQIAAS
FT                   TFTSFGKKLTKEEALHPDTFIQLALQLAYYRLHGRPGCCYETAMTRYFYHGRTETVRSC
FT                   TVEAVRWCQSMQDPSASLLERQQKMLEAFAKHNKMMKDCSHGKGFDRHLLGLLLIAKEE
FT                   GLPVPELFEDPLFSRSGGGGNFVLSTSLVGYLRVQGVVVPMVHNGYGFFYHIRDDRFVV
FT                   ACSSWRSCPETDAEKLVQMIFHAFHDMIQLMNTAHL"
FT   gene            <5891357..>5891551
FT                   /locus_tag="mCG_53057"
FT                   /note="gene_id=mCG53057.0"
FT   mRNA            <5891357..>5891551
FT                   /locus_tag="mCG_53057"
FT                   /product="mCG53057"
FT                   /note="gene_id=mCG53057.0 transcript_id=mCT53240.0 created
FT                   on 08-MAY-2002"
FT   CDS             5891357..5891551
FT                   /codon_start=1
FT                   /locus_tag="mCG_53057"
FT                   /product="mCG53057"
FT                   /note="gene_id=mCG53057.0 transcript_id=mCT53240.0
FT                   protein_id=mCP30988.0"
FT                   /protein_id="EDL14683.1"
FT                   /translation="MSGWEGGKKKPLKQPKKQAKEMDEEDKAFKQNQKEERKKLEELKA
FT                   KAAGKGPLATGGIKKSGKK"
FT   gene            <5978256..5978586
FT                   /locus_tag="mCG_1036350"
FT                   /note="gene_id=mCG1036350.0"
FT   mRNA            <5978256..5978586
FT                   /locus_tag="mCG_1036350"
FT                   /product="mCG1036350"
FT                   /note="gene_id=mCG1036350.0 transcript_id=mCT154054.1
FT                   created on 08-MAY-2002"
FT   CDS             5978256..5978420
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036350"
FT                   /product="mCG1036350"
FT                   /note="gene_id=mCG1036350.0 transcript_id=mCT154054.1
FT                   protein_id=mCP87810.0"
FT                   /protein_id="EDL14684.1"
FT                   /translation="MLKFLLAHLTKPFPQPLVPFPWLVEPFPTQHLLHIHSTIGEMLRK
FT                   FCEEVNCSP"
FT   gene            6017304..6073878
FT                   /locus_tag="mCG_1490"
FT                   /note="gene_id=mCG1490.2"
FT   mRNA            join(6017304..6017497,6017855..6018033,6069319..6069477,
FT                   6069885..6069946,6070712..6070795,6073740..6073878)
FT                   /locus_tag="mCG_1490"
FT                   /product="mCG1490, transcript variant mCT168979"
FT                   /note="gene_id=mCG1490.2 transcript_id=mCT168979.0 created
FT                   on 08-MAY-2002"
FT   mRNA            join(6017304..6017497,6017855..6018033,6032832..6032882,
FT                   6033811..6033915,6034806..6036492,6036699..6036870)
FT                   /locus_tag="mCG_1490"
FT                   /product="mCG1490, transcript variant mCT8375"
FT                   /note="gene_id=mCG1490.2 transcript_id=mCT8375.2 created on
FT                   08-MAY-2002"
FT   mRNA            join(6017751..6018033,6069319..6069477,6069885..6070038)
FT                   /locus_tag="mCG_1490"
FT                   /product="mCG1490, transcript variant mCT168980"
FT                   /note="gene_id=mCG1490.2 transcript_id=mCT168980.0 created
FT                   on 08-MAY-2002"
FT   CDS             join(6017956..6018033,6069319..6069387)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1490"
FT                   /product="mCG1490, isoform CRA_a"
FT                   /note="gene_id=mCG1490.2 transcript_id=mCT168979.0
FT                   protein_id=mCP91864.0 isoform=CRA_a"
FT                   /protein_id="EDL14685.1"
FT                   /translation="MEDFATRTYGTSGLDNRPLFGETSAKFQDPAVSFGLWNTDIHAGK
FT                   KHS"
FT   CDS             join(6017956..6018033,6069319..6069387)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1490"
FT                   /product="mCG1490, isoform CRA_a"
FT                   /note="gene_id=mCG1490.2 transcript_id=mCT168980.0
FT                   protein_id=mCP91872.0 isoform=CRA_a"
FT                   /protein_id="EDL14686.1"
FT                   /translation="MEDFATRTYGTSGLDNRPLFGETSAKFQDPAVSFGLWNTDIHAGK
FT                   KHS"
FT   CDS             join(6017956..6018033,6032832..6032882,6033811..6033915,
FT                   6034806..6034928)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1490"
FT                   /product="mCG1490, isoform CRA_b"
FT                   /note="gene_id=mCG1490.2 transcript_id=mCT8375.2
FT                   protein_id=mCP8671.2 isoform=CRA_b"
FT                   /db_xref="GOA:B2RVB9"
FT                   /db_xref="InterPro:IPR022564"
FT                   /db_xref="MGI:MGI:3606159"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVB9"
FT                   /protein_id="EDL14687.1"
FT                   /translation="MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTTLLILVT
FT                   LISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRNLIYYILFSIIM
FT                   LCICANLYFHDVGR"
FT   gene            complement(6034825..6078097)
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /note="gene_id=mCG1491.2"
FT   mRNA            complement(join(6034825..6036490,6036702..6036846,
FT                   6037437..6037814,6038134..6038289,6040794..6040879,
FT                   6042892..6043101,6044309..6044460,6045500..6045728,
FT                   6046720..6046829,6047628..6047660,6048808..6048965,
FT                   6052418..6052494,6053478..6053592,6056738..6056832,
FT                   6065252..6065374,6066728..6066844,6068150..6068270,
FT                   6077966..6078097))
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   transcript variant mCT8377"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT8377.1 created on
FT                   08-MAY-2002"
FT   mRNA            complement(join(6035193..6036490,6036702..6036846,
FT                   6037437..6037814,6038134..6038289,6040794..6040879,
FT                   6044309..6044460,6045500..6045728,6046720..6046829,
FT                   6047628..6047660,6048808..6048965,6052418..6052494,
FT                   6053478..6053592,6056738..6056832,6065252..6065374,
FT                   6066728..6066844,6068150..6068270,6077966..>6078029))
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   transcript variant mCT190822"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT190822.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6035222..6036490,6036702..6036846,
FT                   6037437..6037814,6038134..6038289,6040794..6040879,
FT                   6042892..6042995,6044309..6044460,6045500..6045728,
FT                   6046720..6046829,6047628..6047660,6048808..6048965,
FT                   6052418..6052494,6053478..6053592,6056738..6056832,
FT                   6066728..6066844,6068150..6068270,6077966..>6078071))
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   transcript variant mCT190824"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT190824.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6035422..6036490,6036702..6036846,
FT                   6037437..6037814,6038134..6038813,6040794..6040879,
FT                   6044309..6044460,6045500..6045728,6046720..6047004,
FT                   6047628..6047660,6048808..6048965,6052418..6052494,
FT                   6053478..6053592,6056738..6056832,6065252..6065374,
FT                   6066728..6066844,6068150..6068270,6077966..>6078024))
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   transcript variant mCT190823"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT190823.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6036381..6036490,6036702..6036846,
FT                   6037437..6037814,6038134..6038289,6040794..6040879,
FT                   6044309..6044460,6045500..6045728,6046720..6046829,
FT                   6047628..6047660,6048808..6048965,6052418..6052494,
FT                   6053478..6053592,6056738..6056832,6065252..6065374,
FT                   6066728..6066844,6068150..>6068165))
FT                   /codon_start=1
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT190822.0
FT                   protein_id=mCP111785.0 isoform=CRA_b"
FT                   /protein_id="EDL14689.1"
FT                   /translation="STCGLDLSMSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQND
FT                   PDEVDSEDSTEPPHKRLCLSSEDDQSIDDATPCISVVALPLSENDQSFEVTMTATTEVA
FT                   DDELSEGTVTQIQILQNDQLDEISPLGTEEVSAVSQAWFTTKEDKDSLTNKGHKWKQGM
FT                   WSKEEIDILMNNIERYLKARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRV
FT                   LRMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT
FT                   GKWTEEEEKRLAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWK
FT                   QSGGTEWTKEDEINLILRIAELDVADENDINWDLLAEGWSSVRSPQWLRSKWWTIKRQI
FT                   ANHKDVSFPASTDSPAASVDSETITLNSGTLQTFEILPSFHLQPTGTPGTYLLQTSSSQ
FT                   GLPLTLTTNPTVTLAAAAPASPEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTVATE
FT                   DITSSLSQEELTVDSDLHSSDFPEPPDALEADTFPDEIPRPKMTIQPSFNNAHVSKFSD
FT                   QNSTELMNSVMVRTEEEIADTDLKQEEPPSDLASAYVTEDLESPTIVHQVHQTIDDETI
FT                   LIVPSPHGFIQASDVIDTESVLPLTTLTDPIFQHHQEASNIIGSSLGSPVSEDSKDVED
FT                   LVNCH"
FT   CDS             complement(join(6036381..6036490,6036702..6036846,
FT                   6037437..6037814,6038134..6038289,6040794..6040879,
FT                   6042892..6043101,6044309..6044460,6045500..6045728,
FT                   6046720..6046829,6047628..6047660,6048808..6048965,
FT                   6052418..6052494,6053478..6053592,6056738..6056832,
FT                   6065252..6065374,6066728..6066836))
FT                   /codon_start=1
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT8377.1
FT                   protein_id=mCP8681.1 isoform=CRA_e"
FT                   /protein_id="EDL14692.1"
FT                   /translation="MSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQNDPDEVDSED
FT                   STEPPHKRLCLSSEDDQSIDDATPCISVVALPLSENDQSFEVTMTATTEVADDELSEGT
FT                   VTQIQILQNDQLDEISPLGTEEVSAVSQAWFTTKEDKDSLTNKGHKWKQGMWSKEEIDI
FT                   LMNNIERYLKARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRVLRMYDDRN
FT                   HVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTGKWTEEEE
FT                   KRLAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWT
FT                   KEDEINLILRIAELDVADENDINWDLLAEGWSSVRSPQWLRSKWWTIKRQIANHKDVSF
FT                   PVLIKGLKQLHENQKNNPVLLENKSGSGVPNSNCNSSVQHVQIRVARLEDNTAISPSPM
FT                   AALQIPVQITHVSSTDSPAASVDSETITLNSGTLQTFEILPSFHLQPTGTPGTYLLQTS
FT                   SSQGLPLTLTTNPTVTLAAAAPASPEQIIVHALSPEHLLNTSDNVTVQCHTPRVIIQTV
FT                   ATEDITSSLSQEELTVDSDLHSSDFPEPPDALEADTFPDEIPRPKMTIQPSFNNAHVSK
FT                   FSDQNSTELMNSVMVRTEEEIADTDLKQEEPPSDLASAYVTEDLESPTIVHQVHQTIDD
FT                   ETILIVPSPHGFIQASDVIDTESVLPLTTLTDPIFQHHQEASNIIGSSLGSPVSEDSKD
FT                   VEDLVNCH"
FT   mRNA            complement(join(6038410..6038813,6040794..6040879,
FT                   6044309..6044460,6045500..6045728,6046720..6046829,
FT                   6047628..6047660,6048808..6048965,6052418..6052494,
FT                   6053478..6053592,6056738..6056832,6065252..6065374,
FT                   6066728..6066844,6068150..6068270,6077966..>6078096))
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   transcript variant mCT190821"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT190821.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6038736..6038813,6040794..6040879,
FT                   6044309..6044460,6045500..6045728,6046720..6046829,
FT                   6047628..6047660,6048808..6048965,6052418..6052494,
FT                   6053478..6053592,6056738..6056832,6065252..6065374,
FT                   6066728..6066844,6068150..>6068165))
FT                   /codon_start=1
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT190821.0
FT                   protein_id=mCP111784.0 isoform=CRA_a"
FT                   /protein_id="EDL14688.1"
FT                   /translation="STCGLDLSMSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQND
FT                   PDEVDSEDSTEPPHKRLCLSSEDDQSIDDATPCISVVALPLSENDQSFEVTMTATTEVA
FT                   DDELSEGTVTQIQILQNDQLDEISPLGTEEVSAVSQAWFTTKEDKDSLTNKGHKWKQGM
FT                   WSKEEIDILMNNIERYLKARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRV
FT                   LRMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNT
FT                   GKWTEEEEKRLAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWK
FT                   QSGGTEWTKEDEINLILRIAELDVADENDINWDLLAEGWSSVRSPQWLRSKWWTIKRQI
FT                   ANHKDVSFPASTDSPAASVDSETITLNSGTLQTFEILPKRKLLLLHLVMGTRGHALMVM
FT                   EVKG"
FT   CDS             complement(join(6040829..6040879,6042892..6042995,
FT                   6044309..6044460,6045500..6045728,6046720..6046829,
FT                   6047628..6047660,6048808..6048965,6052418..6052494,
FT                   6053478..6053592,6056738..6056832,6066728..6066844,
FT                   6068150..>6068165))
FT                   /codon_start=1
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT190824.0
FT                   protein_id=mCP111787.0 isoform=CRA_d"
FT                   /protein_id="EDL14691.1"
FT                   /translation="STCGLDLSMSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQNV
FT                   SENDQSFEVTMTATTEVADDELSEGTVTQIQILQNDQLDEISPLGTEEVSAVSQAWFTT
FT                   KEDKDSLTNKGHKWKQGMWSKEEIDILMNNIERYLKARGIKDATEIIFEMSKDERKDFY
FT                   RTIAWGLNRPLFAVYRRVLRMYDDRNHVGKYTPEEIEKLKELRIKHGNDWATIGAALGR
FT                   SASSVKDRCRLMKDTCNTGKWTEEEEKRLAEVVHELTSTEPGDIVTQGVSWAAVAERVG
FT                   TRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILRIAELDVADENDINWDLLAEGWSS
FT                   VRSPQWLRSKWWTIKRQIANHKDVSFPVYSMFRSESPAWKIIQPSLQAPWQRCRFQSRS
FT                   PTSLQQTPLLLLLTQKQSH"
FT   CDS             complement(join(6046893..6047004,6047628..6047660,
FT                   6048808..6048965,6052418..6052494,6053478..6053592,
FT                   6056738..6056832,6065252..6065374,6066728..6066844,
FT                   6068150..>6068165))
FT                   /codon_start=1
FT                   /gene="Dmtf1"
FT                   /locus_tag="mCG_1491"
FT                   /product="cyclin D binding myb-like transcription factor 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG1491.2 transcript_id=mCT190823.0
FT                   protein_id=mCP111786.0 isoform=CRA_c"
FT                   /protein_id="EDL14690.1"
FT                   /translation="STCGLDLSMSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQND
FT                   PDEVDSEDSTEPPHKRLCLSSEDDQSIDDATPCISVVALPLSENDQSFEVTMTATTEVA
FT                   DDELSEGTVTQIQILQNDQLDEISPLGTEEVSAVSQAWFTTKEDKDSLTNKGHKWKQGM
FT                   WSKEEIDILMNNIERYLKARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRV
FT                   LRMYDDRNHVGKYTPEEIEKLKEQLWTPHNKGHTFKLWLSKVLLPTTCQPVRREKKNEE
FT                   "
FT   gene            complement(6177885..>6178607)
FT                   /locus_tag="mCG_1183"
FT                   /note="gene_id=mCG1183.1"
FT   mRNA            complement(6177885..>6178607)
FT                   /locus_tag="mCG_1183"
FT                   /product="mCG1183"
FT                   /note="gene_id=mCG1183.1 transcript_id=mCT8386.1 created on
FT                   08-MAY-2002"
FT   CDS             complement(6178156..>6178605)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1183"
FT                   /product="mCG1183"
FT                   /note="gene_id=mCG1183.1 transcript_id=mCT8386.1
FT                   protein_id=mCP8680.1"
FT                   /protein_id="EDL14693.1"
FT                   /translation="ATMADSGPAGGAALAAPAPGPGSGSTGPRVYFQSPPGAAGEGPGG
FT                   ADDDGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLD
FT                   MESDDTRAARVKELLVDCYKPTEAFISGLLDKIPGMQKLSTPQKK"
FT   gene            <6183292..6399475
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /note="gene_id=mCG118632.3"
FT   mRNA            join(<6183292..6183631,6297813..6297933,6316717..6316912,
FT                   6328179..6328326,6335580..6335666,6338212..6338317,
FT                   6339100..6339252,6339897..6339985,6345285..6345465,
FT                   6346000..6346128,6352241..6352331,6352947..6353049,
FT                   6355326..6355463,6358346..6358604,6359255..6359428,
FT                   6362981..6363170,6364511..6364607,6365337..6365438,
FT                   6376797..6376923,6378939..6379117,6380486..6380651,
FT                   6396813..6397353)
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, transcript variant
FT                   mCT190831"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT190831.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(6183296..6183631,6297813..6297933,6316717..6316912,
FT                   6328179..6328326,6335580..6335666,6338212..6338317,
FT                   6339100..6339252,6339897..6339985,6345285..6345465,
FT                   6346000..6346128,6352241..6352331,6352947..6353049,
FT                   6355326..6355463,6358341..6358604,6359255..6359428,
FT                   6362981..6363170,6364511..6364607,6365337..6365438,
FT                   6376797..6376923,6378939..6379117,6380486..6380651,
FT                   6396813..6399475)
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, transcript variant
FT                   mCT119790"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT119790.2
FT                   created on 13-JUN-2003"
FT   mRNA            join(6183302..6183631,6316717..6316912,6328179..6328326,
FT                   6335580..6335666,6338212..6338317,6339100..6339252,
FT                   6339897..6339985,6345285..6345465,6346000..6346128,
FT                   6352241..6352331,6352947..6353049,6355326..6355463,
FT                   6358314..6358604,6359255..6359428,6362981..6363170,
FT                   6364511..6364607,6365337..6365438,6376797..6376923,
FT                   6378939..6379117,6380486..6381216)
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, transcript variant
FT                   mCT185246"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT185246.0
FT                   created on 13-JUN-2003"
FT   mRNA            join(<6183315..6183631,6316717..6316912,6328179..6328326,
FT                   6335580..6335666,6338212..6338317,6339100..6339252,
FT                   6339897..6339985,6345285..6345465,6346000..6346128,
FT                   6352241..6352331,6352947..6353049,6355326..6355463,
FT                   6358341..6358604,6359255..6359428,6362981..6363170,
FT                   6364511..6364607,6365337..6365438,6376797..6376923,
FT                   6378939..6379117,6380486..6381216)
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, transcript variant
FT                   mCT190830"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT190830.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<6183333..6183631,6297813..6297933,6316717..6316912,
FT                   6328179..6328326,6335580..6335666,6338212..6338317,
FT                   6339100..6339252,6339897..6339985,6345285..6345465,
FT                   6346000..6346128,6352241..6352331,6352947..6353049,
FT                   6355326..6355463,6358341..6358604,6359255..6359428,
FT                   6362981..6363170,6364511..6364607,6365337..6365438,
FT                   6376797..6376923,6378939..6379117,6380486..6381600)
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, transcript variant
FT                   mCT190829"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT190829.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<6183348..6183631,6297813..6297933,6316717..6316912,
FT                   6328179..6328292,6335580..6335666,6338212..6338317,
FT                   6339100..6339252,6339897..6339985,6345285..6345465,
FT                   6346000..6346128,6352241..6352331,6352947..6353049,
FT                   6355326..6355463,6358341..6358604,6359255..6359428,
FT                   6362981..6363170,6364511..6364607,6365337..6365438,
FT                   6376797..6376923,6378939..>6379103)
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, transcript variant
FT                   mCT190832"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT190832.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<6183374..6183631,6297813..6297933,6316717..6316912,
FT                   6328179..6328326,6335580..6335666,6338212..6338317,
FT                   6339100..6339252,6339897..6339985,6345285..6345465,
FT                   6346000..6346128,6352241..6352331,6352947..6353049,
FT                   6355326..6355463,6358341..6358604,6359255..6359428,
FT                   6362981..6363170,6364511..6364607,6365337..6365438,
FT                   6376797..6376923,6378939..6379117,6380486..6380669)
FT                   /codon_start=1
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, isoform CRA_c"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT190829.0
FT                   protein_id=mCP111774.0 isoform=CRA_c"
FT                   /protein_id="EDL14696.1"
FT                   /translation="AEPRGGKSTVLASQTPRRSPFSAGMLLLTLRRAKGRDRGRPAGGP
FT                   RRALSLPWSPAWICCWALAGCQAVWAGDSSSSGRPLPACQEKDYHFEYTECDSTGSRWR
FT                   VAIPNSAVDCSGLPDPVKGKECTFSCASGEYLEMKNQVCSKCVEGTYSLGSGIKFDEWD
FT                   ELPAGFSNVATFMDTVVGPSDSRPDGCNNSSWLPRGNYIESNRDDCTVSLIYAVHLKKS
FT                   GYVFFEYQYVDNNIFFEFFIQNDQCQEMDATTDKWVKLTDNGEWGSHSVMLKSGTNILY
FT                   WRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSNKPGSFNCQMCPRNTYSE
FT                   KGAKECIRCKEDSQFSEEGASECVDRPPCTTKDYFQIHTPCDEEGKTQIMYKWIEPKIC
FT                   REDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSDGTKECKSCPAGTEPA
FT                   LGFEYKWWNVLPANMKTSCFNVGNSKCDGMNGWEVAGDHIRSGAGGSDNDYLILNLHIP
FT                   GFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAY
FT                   THVIFKNATFTFTWAFQRTNQGQDNRRFINDVVKIYSITATNAVDGVAASCRACALGSE
FT                   QSASSCVPCPPGHYIEKETNQCKECPADTYLSIHQVYGKEACIPCGPGSKSTQDHSLCY
FT                   SDCFFYHEKENQTLHYDFRNLSSVGSLMNGPSFTSKGTKYFHFFNISLCGHEGRKMALC
FT                   TNNISDFTVKEMVTGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADMFLGVT
FT                   VDTALQNVNIKEDMFPVSPSQVPDVHFFYKSSTATTSCINGRSTAVKMRCNPMRPGAGV
FT                   ISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGLQEILYVWNEPKWC
FT                   IKGISLPEKKLSTCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKYSKLVMT
FT                   TNSKECELPAADSCAIMEGEDNEEDVVYSNKQSLLGKLKSLATKVRADF"
FT   CDS             join(<6183374..6183631,6297813..6297933,6316717..6316912,
FT                   6328179..6328326,6335580..6335666,6338212..6338317,
FT                   6339100..6339252,6339897..6339985,6345285..6345465,
FT                   6346000..6346128,6352241..6352331,6352947..6353049,
FT                   6355326..6355463,6358346..6358360)
FT                   /codon_start=1
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, isoform CRA_e"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT190831.0
FT                   protein_id=mCP111776.0 isoform=CRA_e"
FT                   /protein_id="EDL14698.1"
FT                   /translation="AEPRGGKSTVLASQTPRRSPFSAGMLLLTLRRAKGRDRGRPAGGP
FT                   RRALSLPWSPAWICCWALAGCQAVWAGDSSSSGRPLPACQEKDYHFEYTECDSTGSRWR
FT                   VAIPNSAVDCSGLPDPVKGKECTFSCASGEYLEMKNQVCSKCVEGTYSLGSGIKFDEWD
FT                   ELPAGFSNVATFMDTVVGPSDSRPDGCNNSSWLPRGNYIESNRDDCTVSLIYAVHLKKS
FT                   GYVFFEYQYVDNNIFFEFFIQNDQCQEMDATTDKWVKLTDNGEWGSHSVMLKSGTNILY
FT                   WRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSNKPGSFNCQMCPRNTYSE
FT                   KGAKECIRCKEDSQFSEEGASECVDRPPCTTKDYFQIHTPCDEEGKTQIMYKWIEPKIC
FT                   REDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSDGTKECKSCPAGTEPA
FT                   LGFEYKWWNVLPANMKTSCFNVGNSKCDGMNGWEVAGDHIRSGAGGSDNDYLILNLHIP
FT                   GFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAY
FT                   THVIFKNATFTFTWAFQRTNQGQDTIHQ"
FT   CDS             join(<6183379..6183631,6316717..6316912,6328179..6328326,
FT                   6335580..6335666,6338212..6338317,6339100..6339252,
FT                   6339897..6339985,6345285..6345465,6346000..6346128,
FT                   6352241..6352331,6352947..6353049,6355326..6355463,
FT                   6358341..6358604,6359255..6359428,6362981..6363170,
FT                   6364511..6364607,6365337..6365438,6376797..6376923,
FT                   6378939..6379117,6380486..6380669)
FT                   /codon_start=1
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, isoform CRA_d"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT190830.0
FT                   protein_id=mCP111775.0 isoform=CRA_d"
FT                   /protein_id="EDL14697.1"
FT                   /translation="AQRRQEHGPRFPDSSPESIQCRDAAAHPAAGERQGSGATGRGSPP
FT                   RALAALEPRLDLLLGARRLPGSLGWRLVLLWPPASCVPRAFSCASGEYLEMKNQVCSKC
FT                   VEGTYSLGSGIKFDEWDELPAGFSNVATFMDTVVGPSDSRPDGCNNSSWLPRGNYIESN
FT                   RDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQCQEMDATTDKWVKLTDNG
FT                   EWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSN
FT                   KPGSFNCQMCPRNTYSEKGAKECIRCKEDSQFSEEGASECVDRPPCTTKDYFQIHTPCD
FT                   EEGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTF
FT                   SDGTKECKSCPAGTEPALGFEYKWWNVLPANMKTSCFNVGNSKCDGMNGWEVAGDHIRS
FT                   GAGGSDNDYLILNLHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRK
FT                   STNVVESWGGTKEKQAYTHVIFKNATFTFTWAFQRTNQGQDNRRFINDVVKIYSITATN
FT                   AVDGVAASCRACALGSEQSASSCVPCPPGHYIEKETNQCKECPADTYLSIHQVYGKEAC
FT                   IPCGPGSKSTQDHSLCYSDCFFYHEKENQTLHYDFRNLSSVGSLMNGPSFTSKGTKYFH
FT                   FFNISLCGHEGRKMALCTNNISDFTVKEMVTGSDDYTNLVGAFVCQSTIIPSESKGFRA
FT                   ALSSQSIILADMFLGVTVDTALQNVNIKEDMFPVSPSQVPDVHFFYKSSTATTSCINGR
FT                   STAVKMRCNPMRPGAGVISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGAC
FT                   KRGLQEILYVWNEPKWCIKGISLPEKKLSTCETVDFWLKVGAGVGAFTAVLLVALTCYF
FT                   WKKNQKLEYKYSKLVMTTNSKECELPAADSCAIMEGEDNEEDVVYSNKQSLLGKLKSLA
FT                   TKVRADF"
FT   CDS             join(6183446..6183631,6297813..6297933,6316717..6316912,
FT                   6328179..6328326,6335580..6335666,6338212..6338317,
FT                   6339100..6339252,6339897..6339985,6345285..6345465,
FT                   6346000..6346128,6352241..6352331,6352947..6353049,
FT                   6355326..6355463,6358341..6358604,6359255..6359428,
FT                   6362981..6363170,6364511..6364607,6365337..6365438,
FT                   6376797..6376923,6378939..6379117,6380486..6380651,
FT                   6396813..6396872)
FT                   /codon_start=1
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, isoform CRA_a"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT119790.2
FT                   protein_id=mCP87825.2 isoform=CRA_a"
FT                   /db_xref="GOA:B9EHI9"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="MGI:MGI:2443264"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHI9"
FT                   /protein_id="EDL14694.1"
FT                   /translation="MLLLTLRRAKGRDRGRPAGGPRRALSLPWSPAWICCWALAGCQAV
FT                   WAGDSSSSGRPLPACQEKDYHFEYTECDSTGSRWRVAIPNSAVDCSGLPDPVKGKECTF
FT                   SCASGEYLEMKNQVCSKCVEGTYSLGSGIKFDEWDELPAGFSNVATFMDTVVGPSDSRP
FT                   DGCNNSSWLPRGNYIESNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFFIQNDQ
FT                   CQEMDATTDKWVKLTDNGEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNITIE
FT                   GVAYTSECFPCKPGTFSNKPGSFNCQMCPRNTYSEKGAKECIRCKEDSQFSEEGASECV
FT                   DRPPCTTKDYFQIHTPCDEEGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNP
FT                   GFYNNGSSSCHPCPPGTFSDGTKECKSCPAGTEPALGFEYKWWNVLPANMKTSCFNVGN
FT                   SKCDGMNGWEVAGDHIRSGAGGSDNDYLILNLHIPGFKPPTSMTGATGSELGRITFVFE
FT                   TLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHVIFKNATFTFTWAFQRTNQGQD
FT                   NRRFINDVVKIYSITATNAVDGVAASCRACALGSEQSASSCVPCPPGHYIEKETNQCKE
FT                   CPADTYLSIHQVYGKEACIPCGPGSKSTQDHSLCYSDCFFYHEKENQTLHYDFRNLSSV
FT                   GSLMNGPSFTSKGTKYFHFFNISLCGHEGRKMALCTNNISDFTVKEMVTGSDDYTNLVG
FT                   AFVCQSTIIPSESKGFRAALSSQSIILADMFLGVTVDTALQNVNIKEDMFPVSPSQVPD
FT                   VHFFYKSSTATTSCINGRSTAVKMRCNPMRPGAGVISVPSKCPAGTCDGCTFYFLWESA
FT                   EACPLCTEHDFHEIEGACKRGLQEILYVWNEPKWCIKGISLPEKKLSTCETVDFWLKVG
FT                   AGVGAFTAVLLVALTCYFWKKNQKLEYKYSKLVMTTNSKECELPAADSCAIMEGEDNEE
FT                   DVVYSNKQSLLGKLKSLATKEKDDHFESVQLKSSRCPNI"
FT   gene            6270291..6270568
FT                   /pseudo
FT                   /locus_tag="mCG_1036351"
FT                   /note="gene_id=mCG1036351.1"
FT   mRNA            6270291..6270568
FT                   /pseudo
FT                   /locus_tag="mCG_1036351"
FT                   /note="gene_id=mCG1036351.1 transcript_id=mCT154055.1
FT                   created on 08-MAY-2002"
FT   CDS             join(6316749..6316912,6328179..6328326,6335580..6335666,
FT                   6338212..6338317,6339100..6339252,6339897..6339985,
FT                   6345285..6345465,6346000..6346128,6352241..6352331,
FT                   6352947..6353049,6355326..6355463,6358314..6358340)
FT                   /codon_start=1
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, isoform CRA_b"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT185246.0
FT                   protein_id=mCP106504.0 isoform=CRA_b"
FT                   /protein_id="EDL14695.1"
FT                   /translation="MKNQVCSKCVEGTYSLGSGIKFDEWDELPAGFSNVATFMDTVVGP
FT                   SDSRPDGCNNSSWLPRGNYIESNRDDCTVSLIYAVHLKKSGYVFFEYQYVDNNIFFEFF
FT                   IQNDQCQEMDATTDKWVKLTDNGEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVK
FT                   NITIEGVAYTSECFPCKPGTFSNKPGSFNCQMCPRNTYSEKGAKECIRCKEDSQFSEEG
FT                   ASECVDRPPCTTKDYFQIHTPCDEEGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDC
FT                   PPCNPGFYNNGSSSCHPCPPGTFSDGTKECKSCPAGTEPALGFEYKWWNVLPANMKTSC
FT                   FNVGNSKCDGMNGWEVAGDHIRSGAGGSDNDYLILNLHIPGFKPPTSMTGATGSELGRI
FT                   TFVFETLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHVIFKNATFTFTWAFQRT
FT                   NQGQDMPLFLLSF"
FT   CDS             join(<6328287..6328292,6335580..6335666,6338212..6338317,
FT                   6339100..6339252,6339897..6339985,6345285..6345465,
FT                   6346000..6346128,6352241..6352331,6352947..6353049,
FT                   6355326..6355463,6358341..6358604,6359255..6359428,
FT                   6362981..6363170,6364511..6364607,6365337..6365438,
FT                   6376797..6376923,6378939..>6379103)
FT                   /codon_start=1
FT                   /gene="9330182L06Rik"
FT                   /locus_tag="mCG_118632"
FT                   /product="RIKEN cDNA 9330182L06, isoform CRA_f"
FT                   /note="gene_id=mCG118632.3 transcript_id=mCT190832.0
FT                   protein_id=mCP111777.0 isoform=CRA_f"
FT                   /protein_id="EDL14699.1"
FT                   /translation="VPIQNDQCQEMDATTDKWVKLTDNGEWGSHSVMLKSGTNILYWRT
FT                   TGILMGSKAVKPVLVKNITIEGVAYTSECFPCKPGTFSNKPGSFNCQMCPRNTYSEKGA
FT                   KECIRCKEDSQFSEEGASECVDRPPCTTKDYFQIHTPCDEEGKTQIMYKWIEPKICRED
FT                   LTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSDGTKECKSCPAGTEPALGF
FT                   EYKWWNVLPANMKTSCFNVGNSKCDGMNGWEVAGDHIRSGAGGSDNDYLILNLHIPGFK
FT                   PPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHV
FT                   IFKNATFTFTWAFQRTNQGQDNRRFINDVVKIYSITATNAVDGVAASCRACALGSEQSA
FT                   SSCVPCPPGHYIEKETNQCKECPADTYLSIHQVYGKEACIPCGPGSKSTQDHSLCYSDC
FT                   FFYHEKENQTLHYDFRNLSSVGSLMNGPSFTSKGTKYFHFFNISLCGHEGRKMALCTNN
FT                   ISDFTVKEMVTGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADMFLGVTVDT
FT                   ALQNVNIKEDMFPVSPSQVPDVHFFYKSSTATTSCINGRSTAVKMRCNPMRPGAGVISV
FT                   PSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGLQEILYVWNEPKWCIKG
FT                   ISLPEKKLSTCETVDFWLKVGAGVGAFTAVLLVALTCYFW"
FT   gene            complement(6402808..6507943)
FT                   /gene="Grm3"
FT                   /locus_tag="mCG_14459"
FT                   /note="gene_id=mCG14459.2"
FT   mRNA            complement(join(6402808..6403410,6422644..6422818,
FT                   6429378..6430444,6487839..6488694,6507476..6507943))
FT                   /gene="Grm3"
FT                   /locus_tag="mCG_14459"
FT                   /product="glutamate receptor, metabotropic 3"
FT                   /note="gene_id=mCG14459.2 transcript_id=mCT17049.2 created
FT                   on 08-MAY-2002"
FT   CDS             complement(join(6403337..6403410,6422644..6422818,
FT                   6429378..6430444,6487839..6488694,6507476..6507859))
FT                   /codon_start=1
FT                   /gene="Grm3"
FT                   /locus_tag="mCG_14459"
FT                   /product="glutamate receptor, metabotropic 3"
FT                   /note="gene_id=mCG14459.2 transcript_id=mCT17049.2
FT                   protein_id=mCP8675.1"
FT                   /protein_id="EDL14700.1"
FT                   /translation="MRREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAML
FT                   FAIDEINKDNYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKVDEAEYMCPDGSY
FT                   AIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTV
FT                   PPDFYQAKAMAEILRYFNWTYVSTVASEGDYGETGIEAFEQEARLRNICIATAEKVGRS
FT                   NIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRVNASFTWVASDGWGAQESI
FT                   VKGSEHVAYGAITLELASHPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNKRN
FT                   HRQICDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAMKILDG
FT                   KKLYKDYLLKINFTAPFNPNKGADSIVKFDTYGDGMGRYNVFNFQHIGGKYSYLKVGHW
FT                   AETLYLDVDSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYLVDEFT
FT                   CMDCGPGQWPTADLSGCYNLPEDYIRWEDAWAIGPVTIACLGFMCTCIVITVFIKHNNT
FT                   PLVKASGRELCYILLFGVSLSYCMTFFFIAKPSPVICALRRLGLGTSFAICYSALLTKT
FT                   NCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILETPGTRRYTLPEK
FT                   RETVILKCNVKDSSMLISLTYDVVLVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCII
FT                   WLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIVLFQPQKNVVTHRLH
FT                   LNRFSVSGTATTYSQSSASTYVPTVCNGREVLDSTTSSL"
FT   gene            complement(6686496..6686823)
FT                   /pseudo
FT                   /locus_tag="mCG_1036404"
FT                   /note="gene_id=mCG1036404.1"
FT   mRNA            complement(6686496..6686823)
FT                   /pseudo
FT                   /locus_tag="mCG_1036404"
FT                   /note="gene_id=mCG1036404.1 transcript_id=mCT154108.1
FT                   created on 08-MAY-2002"
FT   gene            6696905..6697396
FT                   /pseudo
FT                   /locus_tag="mCG_1036352"
FT                   /note="gene_id=mCG1036352.1"
FT   mRNA            6696905..6697396
FT                   /pseudo
FT                   /locus_tag="mCG_1036352"
FT                   /note="gene_id=mCG1036352.1 transcript_id=mCT154056.1
FT                   created on 08-MAY-2002"
FT   gene            6885889..6886630
FT                   /pseudo
FT                   /locus_tag="mCG_49126"
FT                   /note="gene_id=mCG49126.2"
FT   mRNA            6885889..6886630
FT                   /pseudo
FT                   /locus_tag="mCG_49126"
FT                   /note="gene_id=mCG49126.2 transcript_id=mCT49309.2 created
FT                   on 08-MAY-2002"
FT   gene            6985706..>6987543
FT                   /locus_tag="mCG_118634"
FT                   /note="gene_id=mCG118634.1"
FT   mRNA            join(6985706..6985855,6986494..6986674,6987388..>6987543)
FT                   /locus_tag="mCG_118634"
FT                   /product="mCG118634"
FT                   /note="gene_id=mCG118634.1 transcript_id=mCT119792.1
FT                   created on 08-MAY-2002"
FT   CDS             join(6985710..6985855,6986494..6986674,6987388..>6987543)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118634"
FT                   /product="mCG118634"
FT                   /note="gene_id=mCG118634.1 transcript_id=mCT119792.1
FT                   protein_id=mCP87752.0"
FT                   /protein_id="EDL14701.1"
FT                   /translation="MPVENLNPFYEQLKLQNKQVMSSVYKSLKKLIEAQENIHKLNQEI
FT                   SLYSNLHSRLMVEKNLTKMSVTQKPESKEVQIDWALIEKYLVDLNQNGKDEQEQTSNHE
FT                   TQQLQDSATPARAEMSTSQEESLLQNEFPPQEPPAELHPRHPQSTLDEFYYTQYIYV"
FT   gene            7032755..7034809
FT                   /pseudo
FT                   /locus_tag="mCG_1036343"
FT                   /note="gene_id=mCG1036343.1"
FT   mRNA            7032755..7034809
FT                   /pseudo
FT                   /locus_tag="mCG_1036343"
FT                   /note="gene_id=mCG1036343.1 transcript_id=mCT154047.1
FT                   created on 08-MAY-2002"
FT   gene            complement(7153885..7154986)
FT                   /pseudo
FT                   /locus_tag="mCG_118216"
FT                   /note="gene_id=mCG118216.1"
FT   mRNA            complement(7153885..7154986)
FT                   /pseudo
FT                   /locus_tag="mCG_118216"
FT                   /note="gene_id=mCG118216.1 transcript_id=mCT119367.1
FT                   created on 08-MAY-2002"
FT   gene            complement(7159743..>7166134)
FT                   /locus_tag="mCG_118217"
FT                   /note="gene_id=mCG118217.1"
FT   mRNA            complement(join(7159743..7160267,7160980..7161152,
FT                   7161774..7161923,7163163..7163312,7165210..7165375,
FT                   7166002..>7166134))
FT                   /locus_tag="mCG_118217"
FT                   /product="mCG118217"
FT                   /note="gene_id=mCG118217.1 transcript_id=mCT119368.1
FT                   created on 08-MAY-2002"
FT   CDS             complement(join(7160996..7161152,7161774..7161923,
FT                   7163163..7163312,7165210..7165375,7166002..7166134))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118217"
FT                   /product="mCG118217"
FT                   /note="gene_id=mCG118217.1 transcript_id=mCT119368.1
FT                   protein_id=mCP87835.1"
FT                   /protein_id="EDL14702.1"
FT                   /translation="MFARLCNLFGRASVDGRETRERRKGAGLPSESNEGRRRWTWRMWT
FT                   TSSYRILTQCLATRLVNMFARLCNLFGRASVDGRETRERRKGAGLPSESNEGRRRHTSS
FT                   TGPDLSKKEFKKEKERLTTELHLLIQMRNEQRDHLIDFKESSNYNRTKPIQKKNPFYEQ
FT                   LRSTKDQVLSSVYKLEMGIIEAQENIQELNKWIDYFTNLHSQLMVEKNLKMSVTQNQKN
FT                   KEVEIDWALIEKYLVDLNLNGQTGADQQP"
FT   gene            complement(7168250..7172667)
FT                   /pseudo
FT                   /locus_tag="mCG_1036406"
FT                   /note="gene_id=mCG1036406.0"
FT   mRNA            complement(join(7168250..7168411,7171328..7171477,
FT                   7172261..7172396,7172535..7172667))
FT                   /pseudo
FT                   /locus_tag="mCG_1036406"
FT                   /note="gene_id=mCG1036406.0 transcript_id=mCT154110.1
FT                   created on 08-MAY-2002"
FT   gene            <7480556..7481813
FT                   /locus_tag="mCG_1036344"
FT                   /note="gene_id=mCG1036344.1"
FT   mRNA            <7480556..7481813
FT                   /locus_tag="mCG_1036344"
FT                   /product="mCG1036344"
FT                   /note="gene_id=mCG1036344.1 transcript_id=mCT154048.1
FT                   created on 08-MAY-2002"
FT   CDS             7480556..7481638
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036344"
FT                   /product="mCG1036344"
FT                   /note="gene_id=mCG1036344.1 transcript_id=mCT154048.1
FT                   protein_id=mCP87757.0"
FT                   /protein_id="EDL14703.1"
FT                   /translation="MSHSKFSAPKHGFLGFLPHKRSSWHHRKVKSFPKDDASKPVYLTT
FT                   FLGYKAGMTHIVQEVDRPGSKVNKKEVVEAVTIVDPLTPPPPPVVVVGVVGYVESPRGL
FT                   RTFNTVFAEHISDECKWRFYKNWHKSKKKAFTKYYKKWQDGTGKKQLEKDSSSMKKYCQ
FT                   VICIIAHTQMRLLPLRQKAHLMEIQVSGGTMADKLGWAQERLELQVPVNQVFGQDEMII
FT                   VIDVTKGKGYKGVTSRWHTKKLPRKTHQGLRKVACIGAWHPARVAFSVAQAGQKGYHHR
FT                   KETNKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINSLGGFVHYGEVTNDFIMLKGCV
FT                   VGTKKRVLAGPDQMSGPGED"
FT   gene            complement(7630335..7630768)
FT                   /locus_tag="mCG_1036366"
FT                   /note="gene_id=mCG1036366.1"
FT   mRNA            complement(7630335..7630768)
FT                   /locus_tag="mCG_1036366"
FT                   /product="mCG1036366"
FT                   /note="gene_id=mCG1036366.1 transcript_id=mCT154070.1
FT                   created on 08-MAY-2002"
FT   CDS             complement(7630485..7630673)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036366"
FT                   /product="mCG1036366"
FT                   /note="gene_id=mCG1036366.1 transcript_id=mCT154070.1
FT                   protein_id=mCP87762.1"
FT                   /protein_id="EDL14704.1"
FT                   /translation="MPGSEPKFLLHGCETSRLLQDYYSFLPCSDSGSLCGLLTLLCQPT
FT                   RGKARLTEGSSFRRKQH"
FT   gene            <7790633..7793367
FT                   /locus_tag="mCG_118215"
FT                   /note="gene_id=mCG118215.1"
FT   mRNA            join(<7790633..7790765,7791786..7791945,7793210..7793367)
FT                   /locus_tag="mCG_118215"
FT                   /product="mCG118215"
FT                   /note="gene_id=mCG118215.1 transcript_id=mCT119366.1
FT                   created on 08-MAY-2002"
FT   CDS             join(7790633..7790765,7791786..7791945,7793210..7793363)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118215"
FT                   /product="mCG118215"
FT                   /note="gene_id=mCG118215.1 transcript_id=mCT119366.1
FT                   protein_id=mCP87832.1"
FT                   /protein_id="EDL14705.1"
FT                   /translation="MFARLCNLFGRASVDGRETRERRKGAGLPSESNEGRRRWTWRMWR
FT                   ARRHPSSTAPVLSKKEFKKEKERLTTELDLLIQLRNEQRDHLIDFKESSNYNRTKPTQK
FT                   KNPFYEQLRSTKNQVLSSVHKLEMGIIEAQENIQELNKWIDYFT"
FT   assembly_gap    1180..2019
FT                   /estimated_length=840
FT                   /gap_type="unknown"
FT   assembly_gap    7915..7934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9522..9727
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    39330..39349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    58648..62769
FT                   /estimated_length=4122
FT                   /gap_type="unknown"
FT   assembly_gap    117376..121090
FT                   /estimated_length=3715
FT                   /gap_type="unknown"
FT   assembly_gap    124767..124852
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    151969..151999
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    155983..156538
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    174695..176524
FT                   /estimated_length=1830
FT                   /gap_type="unknown"
FT   assembly_gap    194662..194681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    218412..218431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    242471..242490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    338101..338964
FT                   /estimated_length=864
FT                   /gap_type="unknown"
FT   assembly_gap    346262..346368
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    349706..350033
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    413615..413649
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    444689..444708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    474032..474446
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    517412..517690
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    583950..583969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    595366..595844
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   assembly_gap    608311..608330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    692357..692549
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    697072..699569
FT                   /estimated_length=2498
FT                   /gap_type="unknown"
FT   assembly_gap    701638..702202
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    719496..719515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    803207..803226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    815693..822597
FT                   /estimated_length=6905
FT                   /gap_type="unknown"
FT   assembly_gap    980559..982709
FT                   /estimated_length=2151
FT                   /gap_type="unknown"
FT   assembly_gap    1098287..1098361
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    1100498..1102217
FT                   /estimated_length=1720
FT                   /gap_type="unknown"
FT   assembly_gap    1104283..1104503
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    1105899..1105918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1107509..1107528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1147952..1147971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1196340..1196359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1209590..1209609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1213205..1213224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1214253..1214272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1286878..1286897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1295731..1296993
FT                   /estimated_length=1263
FT                   /gap_type="unknown"
FT   assembly_gap    1297610..1299978
FT                   /estimated_length=2369
FT                   /gap_type="unknown"
FT   assembly_gap    1323788..1323807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1330170..1331423
FT                   /estimated_length=1254
FT                   /gap_type="unknown"
FT   assembly_gap    1332881..1332900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1333948..1333967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1336434..1338251
FT                   /estimated_length=1818
FT                   /gap_type="unknown"
FT   assembly_gap    1391477..1391496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1446074..1446093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1467246..1467265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1474569..1474844
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    1492485..1492893
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    1500886..1500905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1535574..1538076
FT                   /estimated_length=2503
FT                   /gap_type="unknown"
FT   assembly_gap    1548369..1548388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1590490..1590509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1613790..1613809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1648043..1648143
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    1654208..1658417
FT                   /estimated_length=4210
FT                   /gap_type="unknown"
FT   assembly_gap    1667075..1667094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1681760..1681779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1745115..1745134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1834038..1834057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1845549..1846220
FT                   /estimated_length=672
FT                   /gap_type="unknown"
FT   assembly_gap    1870369..1870388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1873320..1873409
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    2028910..2028929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2036361..2036380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2076045..2076064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2097189..2097208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2115378..2115397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2137891..2137910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2156955..2159456
FT                   /estimated_length=2502
FT                   /gap_type="unknown"
FT   assembly_gap    2169936..2169955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2172128..2172147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2221367..2222226
FT                   /estimated_length=860
FT                   /gap_type="unknown"
FT   assembly_gap    2241777..2241796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2270707..2270731
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    2303578..2305535
FT                   /estimated_length=1958
FT                   /gap_type="unknown"
FT   assembly_gap    2310988..2311007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2314499..2314518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2344092..2344111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2350950..2355874
FT                   /estimated_length=4925
FT                   /gap_type="unknown"
FT   assembly_gap    2388968..2388987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2414042..2414156
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    2416544..2416563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2418704..2418723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2435212..2435993
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   assembly_gap    2438141..2438623
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    2456491..2456510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2471937..2472021
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2473721..2473740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2477450..2477469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2546936..2548177
FT                   /estimated_length=1242
FT                   /gap_type="unknown"
FT   assembly_gap    2554828..2554847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2565947..2565966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2606554..2606573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2713348..2713367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2720152..2720171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2722124..2726241
FT                   /estimated_length=4118
FT                   /gap_type="unknown"
FT   assembly_gap    2727256..2727275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2742073..2742092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2744226..2744245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2745930..2745949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2819112..2819262
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    2821114..2822997
FT                   /estimated_length=1884
FT                   /gap_type="unknown"
FT   assembly_gap    2841166..2841185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2844103..2844122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2866488..2866699
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    2878267..2878286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2894399..2894418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2899587..2899835
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    2925403..2925440
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    2942052..2942071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2945812..2945831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2948108..2948127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3006975..3010464
FT                   /estimated_length=3490
FT                   /gap_type="unknown"
FT   assembly_gap    3014279..3015330
FT                   /estimated_length=1052
FT                   /gap_type="unknown"
FT   assembly_gap    3031214..3031233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3032923..3032942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3047384..3047403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3049160..3049179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3066270..3066289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3081064..3082314
FT                   /estimated_length=1251
FT                   /gap_type="unknown"
FT   assembly_gap    3083924..3085498
FT                   /estimated_length=1575
FT                   /gap_type="unknown"
FT   assembly_gap    3111187..3111206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3114303..3114322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3130362..3131815
FT                   /estimated_length=1454
FT                   /gap_type="unknown"
FT   assembly_gap    3151987..3154349
FT                   /estimated_length=2363
FT                   /gap_type="unknown"
FT   assembly_gap    3155385..3157023
FT                   /estimated_length=1639
FT                   /gap_type="unknown"
FT   assembly_gap    3163593..3163612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3241026..3241235
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    3274544..3274563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3330584..3335863
FT                   /estimated_length=5280
FT                   /gap_type="unknown"
FT   assembly_gap    3399697..3421603
FT                   /estimated_length=21907
FT                   /gap_type="unknown"
FT   assembly_gap    3439491..3441583
FT                   /estimated_length=2093
FT                   /gap_type="unknown"
FT   assembly_gap    3443443..3443604
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3477111..3478347
FT                   /estimated_length=1237
FT                   /gap_type="unknown"
FT   assembly_gap    3479585..3481183
FT                   /estimated_length=1599
FT                   /gap_type="unknown"
FT   assembly_gap    3485821..3485840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3491422..3491441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3493427..3495364
FT                   /estimated_length=1938
FT                   /gap_type="unknown"
FT   assembly_gap    3497120..3499111
FT                   /estimated_length=1992
FT                   /gap_type="unknown"
FT   assembly_gap    3533500..3533519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3560086..3560105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3588090..3588109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3589462..3589481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3599021..3599040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3602257..3603366
FT                   /estimated_length=1110
FT                   /gap_type="unknown"
FT   assembly_gap    3612025..3612570
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    3635026..3635045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3643616..3643635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3650407..3650426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3654930..3654949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3656645..3656664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3659584..3659603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3661965..3663951
FT                   /estimated_length=1987
FT                   /gap_type="unknown"
FT   assembly_gap    3668249..3668268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3681778..3681797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3686398..3686421
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3696066..3696805
FT                   /estimated_length=740
FT                   /gap_type="unknown"
FT   assembly_gap    3715607..3715626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3746901..3746920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3836447..3836492
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3837401..3837802
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    3898138..3898893
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    3922640..3922665
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    3934781..3934800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3987548..3987567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4019401..4019420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4031704..4031880
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    4057365..4057596
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    4067105..4067209
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    4073382..4073559
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    4081078..4081097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4130281..4131796
FT                   /estimated_length=1516
FT                   /gap_type="unknown"
FT   assembly_gap    4155028..4155314
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    4181850..4182307
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    4195977..4196628
FT                   /estimated_length=652
FT                   /gap_type="unknown"
FT   assembly_gap    4210756..4210937
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    4211483..4211661
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    4230889..4230908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4259438..4259586
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    4302407..4302426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4340828..4340847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4349739..4350152
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    4374679..4374698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4396704..4396723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4423289..4423308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4429897..4429916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4458951..4458970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4467691..4467710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4500349..4500406
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    4502221..4502240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4513854..4514190
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    4529914..4529933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4531129..4531661
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    4533262..4533281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4534385..4534404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4536772..4536791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4549901..4553998
FT                   /estimated_length=4098
FT                   /gap_type="unknown"
FT   assembly_gap    4578993..4579012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4587584..4587666
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    4597789..4597808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4606364..4606383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4647527..4647546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4648859..4649106
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    4708851..4708955
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    4737833..4740292
FT                   /estimated_length=2460
FT                   /gap_type="unknown"
FT   assembly_gap    4743484..4743858
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    4756860..4756979
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    4782181..4782200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4814132..4814151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4825145..4827167
FT                   /estimated_length=2023
FT                   /gap_type="unknown"
FT   assembly_gap    4830446..4830638
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    4874026..4874686
FT                   /estimated_length=661
FT                   /gap_type="unknown"
FT   assembly_gap    4877459..4877540
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    4880541..4882226
FT                   /estimated_length=1686
FT                   /gap_type="unknown"
FT   assembly_gap    4962345..4963630
FT                   /estimated_length=1286
FT                   /gap_type="unknown"
FT   assembly_gap    4999681..4999700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5013510..5013577
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    5044533..5044552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5092494..5093820
FT                   /estimated_length=1327
FT                   /gap_type="unknown"
FT   assembly_gap    5104115..5106816
FT                   /estimated_length=2702
FT                   /gap_type="unknown"
FT   assembly_gap    5131544..5131563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5161900..5161939
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5190932..5190951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5195884..5196397
FT                   /estimated_length=514
FT                   /gap_type="unknown"
FT   assembly_gap    5200562..5203771
FT                   /estimated_length=3210
FT                   /gap_type="unknown"
FT   assembly_gap    5240420..5240888
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    5268683..5268892
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    5270340..5271061
FT                   /estimated_length=722
FT                   /gap_type="unknown"
FT   assembly_gap    5306561..5306580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5453879..5453898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5460537..5460739
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    5465314..5465335
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    5477722..5478460
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    5479501..5479526
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    5519304..5519323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5523053..5523072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5560754..5560902
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    5561833..5562786
FT                   /estimated_length=954
FT                   /gap_type="unknown"
FT   assembly_gap    5597777..5597887
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    5611098..5611117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5625317..5631196
FT                   /estimated_length=5880
FT                   /gap_type="unknown"
FT   assembly_gap    5633469..5633549
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    5661396..5661550
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    5684857..5684876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5687223..5687242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5778633..5778733
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5861320..5861339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5935599..5935657
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    5941154..5941173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5943816..5945326
FT                   /estimated_length=1511
FT                   /gap_type="unknown"
FT   assembly_gap    5958237..5958291
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5968230..5968788
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    5969349..5971251
FT                   /estimated_length=1903
FT                   /gap_type="unknown"
FT   assembly_gap    6030372..6030491
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    6091078..6091265
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    6092595..6092614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6104868..6105294
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    6112256..6112776
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    6161580..6161599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6180047..6180066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6192684..6193159
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   assembly_gap    6195174..6195209
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    6221345..6223635
FT                   /estimated_length=2291
FT                   /gap_type="unknown"
FT   assembly_gap    6248312..6254243
FT                   /estimated_length=5932
FT                   /gap_type="unknown"
FT   assembly_gap    6255341..6255799
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    6257266..6257676
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    6260461..6260559
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    6278165..6278290
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    6279527..6279546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6291225..6291244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6319800..6322357
FT                   /estimated_length=2558
FT                   /gap_type="unknown"
FT   assembly_gap    6323366..6326130
FT                   /estimated_length=2765
FT                   /gap_type="unknown"
FT   assembly_gap    6346691..6346710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6408013..6408204
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    6421340..6421359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6530178..6530197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6563936..6563955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6584798..6584817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6594473..6594492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6621997..6622121
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    6676722..6680543
FT                   /estimated_length=3822
FT                   /gap_type="unknown"
FT   assembly_gap    6713979..6713998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6728611..6728807
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    6733200..6737817
FT                   /estimated_length=4618
FT                   /gap_type="unknown"
FT   assembly_gap    6769934..6769953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6785059..6785085
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    6806160..6806284
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    6850741..6850870
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    6854130..6854199
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    6942495..6942567
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    6943834..6944169
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    6950186..6950231
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    6950994..6951071
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    6970273..6970292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6973322..6973341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6989221..6991070
FT                   /estimated_length=1850
FT                   /gap_type="unknown"
FT   assembly_gap    7020708..7020769
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    7023659..7023700
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    7049820..7049839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7051362..7051381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7098450..7098469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7117140..7117159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7156178..7156197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7176336..7176582
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    7208121..7210939
FT                   /estimated_length=2819
FT                   /gap_type="unknown"
FT   assembly_gap    7220372..7220391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7305861..7306016
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    7317657..7317676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7326469..7326488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7327752..7331975
FT                   /estimated_length=4224
FT                   /gap_type="unknown"
FT   assembly_gap    7335408..7335556
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    7377544..7377665
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    7393960..7393979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7435450..7435646
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    7477106..7477158
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    7483648..7483944
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    7489136..7491096
FT                   /estimated_length=1961
FT                   /gap_type="unknown"
FT   assembly_gap    7496061..7496080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7531801..7531924
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    7536789..7536808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7540899..7540918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7547462..7549282
FT                   /estimated_length=1821
FT                   /gap_type="unknown"
FT   assembly_gap    7568691..7568710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7579035..7580077
FT                   /estimated_length=1043
FT                   /gap_type="unknown"
FT   assembly_gap    7589289..7589308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7596279..7596516
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    7625885..7625904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7649837..7649915
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    7653712..7653731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7708657..7708676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7734996..7735178
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    7745696..7749901
FT                   /estimated_length=4206
FT                   /gap_type="unknown"
FT   assembly_gap    7753202..7753303
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    7781827..7781846
FT                   /estimated_length=20
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01042071.1:1..1179),gap(840),AAHY01042072.1:1..5895,
CO   gap(20),AAHY01042073.1:1..1587,gap(206),AAHY01042074.1:1..29602,gap(20),
CO   AAHY01042075.1:1..19298,gap(4122),AAHY01042076.1:1..54606,gap(3715),
CO   AAHY01042077.1:1..3676,gap(86),AAHY01042078.1:1..27116,gap(31),
CO   complement(AAHY01042079.1:1..3983),gap(556),
CO   complement(AAHY01042080.1:1..18156),gap(1830),AAHY01042081.1:1..18137,
CO   gap(20),AAHY01042082.1:1..23730,gap(20),
CO   complement(AAHY01042083.1:1..24039),gap(20),
CO   complement(AAHY01042084.1:1..95610),gap(864),
CO   complement(AAHY01042085.1:1..7297),gap(107),
CO   complement(AAHY01042086.1:1..3337),gap(328),
CO   complement(AAHY01042087.1:1..63581),gap(35),AAHY01042088.1:1..31039,
CO   gap(20),complement(AAHY01042089.1:1..29323),gap(415),
CO   complement(AAHY01042090.1:1..42965),gap(279),AAHY01042091.1:1..66259,
CO   gap(20),AAHY01042092.1:1..11396,gap(479),AAHY01042093.1:1..12466,gap(20),
CO   AAHY01042094.1:1..84026,gap(193),AAHY01042095.1:1..4522,gap(2498),
CO   AAHY01042096.1:1..2068,gap(565),complement(AAHY01042097.1:1..17293),
CO   gap(20),AAHY01042098.1:1..83691,gap(20),AAHY01042099.1:1..12466,gap(6905),
CO   AAHY01042100.1:1..157961,gap(2151),AAHY01042101.1:1..115577,gap(75),
CO   AAHY01042102.1:1..2136,gap(1720),AAHY01042103.1:1..2065,gap(221),
CO   AAHY01042104.1:1..1395,gap(20),AAHY01042105.1:1..1590,gap(20),
CO   AAHY01042106.1:1..40423,gap(20),AAHY01042107.1:1..48368,gap(20),
CO   AAHY01042108.1:1..13230,gap(20),AAHY01042109.1:1..3595,gap(20),
CO   complement(AAHY01042110.1:1..1028),gap(20),AAHY01042111.1:1..72605,gap(20),
CO   AAHY01042112.1:1..8833,gap(1263),AAHY01042113.1:1..616,gap(2369),
CO   AAHY01042114.1:1..23809,gap(20),AAHY01042115.1:1..6362,gap(1254),
CO   complement(AAHY01042116.1:1..1457),gap(20),AAHY01042117.1:1..1047,gap(20),
CO   AAHY01042118.1:1..2466,gap(1818),AAHY01042119.1:1..53225,gap(20),
CO   AAHY01042120.1:1..54577,gap(20),AAHY01042121.1:1..21152,gap(20),
CO   AAHY01042122.1:1..7303,gap(276),AAHY01042123.1:1..17640,gap(409),
CO   AAHY01042124.1:1..7992,gap(20),AAHY01042125.1:1..34668,gap(2503),
CO   AAHY01042126.1:1..10292,gap(20),complement(AAHY01042127.1:1..42101),
CO   gap(20),AAHY01042128.1:1..23280,gap(20),AAHY01042129.1:1..34233,gap(101),
CO   AAHY01042130.1:1..6064,gap(4210),AAHY01042131.1:1..8657,gap(20),
CO   AAHY01042132.1:1..14665,gap(20),complement(AAHY01042133.1:1..63335),
CO   gap(20),complement(AAHY01042134.1:1..88903),gap(20),
CO   AAHY01042135.1:1..11491,gap(672),complement(AAHY01042136.1:1..24148),
CO   gap(20),AAHY01042137.1:1..2931,gap(90),AAHY01042138.1:1..155500,gap(20),
CO   complement(AAHY01042139.1:1..7431),gap(20),AAHY01042140.1:1..39664,gap(20),
CO   AAHY01042141.1:1..21124,gap(20),AAHY01042142.1:1..18169,gap(20),
CO   AAHY01042143.1:1..22493,gap(20),complement(AAHY01042144.1:1..19044),
CO   gap(2502),AAHY01042145.1:1..10479,gap(20),AAHY01042146.1:1..2172,gap(20),
CO   AAHY01042147.1:1..49219,gap(860),AAHY01042148.1:1..19550,gap(20),
CO   AAHY01042149.1:1..28910,gap(25),AAHY01042150.1:1..32846,gap(1958),
CO   AAHY01042151.1:1..5452,gap(20),AAHY01042152.1:1..3491,gap(20),
CO   AAHY01042153.1:1..29573,gap(20),AAHY01042154.1:1..6838,gap(4925),
CO   AAHY01042155.1:1..33093,gap(20),AAHY01042156.1:1..25054,gap(115),
CO   AAHY01042157.1:1..2387,gap(20),AAHY01042158.1:1..2140,gap(20),
CO   AAHY01042159.1:1..16488,gap(782),complement(AAHY01042160.1:1..2147),
CO   gap(483),AAHY01042161.1:1..17867,gap(20),AAHY01042162.1:1..15426,gap(85),
CO   complement(AAHY01042163.1:1..1699),gap(20),
CO   complement(AAHY01042164.1:1..3709),gap(20),AAHY01042165.1:1..69466,
CO   gap(1242),complement(AAHY01042166.1:1..6650),gap(20),
CO   complement(AAHY01042167.1:1..11099),gap(20),AAHY01042168.1:1..40587,
CO   gap(20),AAHY01042169.1:1..106774,gap(20),AAHY01042170.1:1..6784,gap(20),
CO   complement(AAHY01042171.1:1..1952),gap(4118),
CO   complement(AAHY01042172.1:1..1014),gap(20),AAHY01042173.1:1..14797,gap(20),
CO   AAHY01042174.1:1..2133,gap(20),AAHY01042175.1:1..1684,gap(20),
CO   AAHY01042176.1:1..73162,gap(151),AAHY01042177.1:1..1851,gap(1884),
CO   complement(AAHY01042178.1:1..18168),gap(20),AAHY01042179.1:1..2917,gap(20),
CO   AAHY01042180.1:1..22365,gap(212),complement(AAHY01042181.1:1..11567),
CO   gap(20),complement(AAHY01042182.1:1..16112),gap(20),AAHY01042183.1:1..5168,
CO   gap(249),complement(AAHY01042184.1:1..25567),gap(38),
CO   complement(AAHY01042185.1:1..16611),gap(20),
CO   complement(AAHY01042186.1:1..3740),gap(20),
CO   complement(AAHY01042187.1:1..2276),gap(20),AAHY01042188.1:1..58847,
CO   gap(3490),complement(AAHY01042189.1:1..3814),gap(1052),
CO   AAHY01042190.1:1..15883,gap(20),AAHY01042191.1:1..1689,gap(20),
CO   complement(AAHY01042192.1:1..14441),gap(20),
CO   complement(AAHY01042193.1:1..1756),gap(20),
CO   complement(AAHY01042194.1:1..17090),gap(20),
CO   complement(AAHY01042195.1:1..14774),gap(1251),AAHY01042196.1:1..1609,
CO   gap(1575),complement(AAHY01042197.1:1..25688),gap(20),
CO   complement(AAHY01042198.1:1..3096),gap(20),AAHY01042199.1:1..16039,
CO   gap(1454),AAHY01042200.1:1..20171,gap(2363),AAHY01042201.1:1..1035,
CO   gap(1639),AAHY01042202.1:1..6569,gap(20),AAHY01042203.1:1..77413,gap(210),
CO   AAHY01042204.1:1..33308,gap(20),AAHY01042205.1:1..56020,gap(5280),
CO   AAHY01042206.1:1..63833,gap(21907),AAHY01042207.1:1..17887,gap(2093),
CO   complement(AAHY01042208.1:1..1859),gap(162),AAHY01042209.1:1..33506,
CO   gap(1237),complement(AAHY01042210.1:1..1237),gap(1599),
CO   complement(AAHY01042211.1:1..4637),gap(20),
CO   complement(AAHY01042212.1:1..5581),gap(20),AAHY01042213.1:1..1985,
CO   gap(1938),AAHY01042214.1:1..1755,gap(1992),AAHY01042215.1:1..34388,gap(20),
CO   AAHY01042216.1:1..26566,gap(20),AAHY01042217.1:1..27984,gap(20),
CO   AAHY01042218.1:1..1352,gap(20),AAHY01042219.1:1..9539,gap(20),
CO   AAHY01042220.1:1..3216,gap(1110),AAHY01042221.1:1..8658,gap(546),
CO   AAHY01042222.1:1..22455,gap(20),AAHY01042223.1:1..8570,gap(20),
CO   complement(AAHY01042224.1:1..6771),gap(20),
CO   complement(AAHY01042225.1:1..4503),gap(20),
CO   complement(AAHY01042226.1:1..1695),gap(20),
CO   complement(AAHY01042227.1:1..2919),gap(20),AAHY01042228.1:1..2361,
CO   gap(1987),complement(AAHY01042229.1:1..4297),gap(20),
CO   complement(AAHY01042230.1:1..13509),gap(20),
CO   complement(AAHY01042231.1:1..4600),gap(24),AAHY01042232.1:1..9644,gap(740),
CO   complement(AAHY01042233.1:1..18801),gap(20),
CO   complement(AAHY01042234.1:1..31274),gap(20),AAHY01042235.1:1..89526,
CO   gap(46),complement(AAHY01042236.1:1..908),gap(402),AAHY01042237.1:1..60335,
CO   gap(756),AAHY01042238.1:1..23746,gap(26),
CO   complement(AAHY01042239.1:1..12115),gap(20),AAHY01042240.1:1..52747,
CO   gap(20),AAHY01042241.1:1..31833,gap(20),AAHY01042242.1:1..12283,gap(177),
CO   AAHY01042243.1:1..25484,gap(232),AAHY01042244.1:1..9508,gap(105),
CO   AAHY01042245.1:1..6172,gap(178),AAHY01042246.1:1..7518,gap(20),
CO   AAHY01042247.1:1..49183,gap(1516),AAHY01042248.1:1..23231,gap(287),
CO   AAHY01042249.1:1..26535,gap(458),AAHY01042250.1:1..13669,gap(652),
CO   AAHY01042251.1:1..14127,gap(182),complement(AAHY01042252.1:1..545),
CO   gap(179),AAHY01042253.1:1..19227,gap(20),AAHY01042254.1:1..28529,gap(149),
CO   AAHY01042255.1:1..42820,gap(20),AAHY01042256.1:1..38401,gap(20),
CO   AAHY01042257.1:1..8891,gap(414),AAHY01042258.1:1..24526,gap(20),
CO   AAHY01042259.1:1..22005,gap(20),AAHY01042260.1:1..26565,gap(20),
CO   AAHY01042261.1:1..6588,gap(20),AAHY01042262.1:1..29034,gap(20),
CO   AAHY01042263.1:1..8720,gap(20),AAHY01042264.1:1..32638,gap(58),
CO   AAHY01042265.1:1..1814,gap(20),AAHY01042266.1:1..11613,gap(337),
CO   AAHY01042267.1:1..15723,gap(20),complement(AAHY01042268.1:1..1195),
CO   gap(533),complement(AAHY01042269.1:1..1600),gap(20),
CO   complement(AAHY01042270.1:1..1103),gap(20),
CO   complement(AAHY01042271.1:1..2367),gap(20),
CO   complement(AAHY01042272.1:1..13109),gap(4098),AAHY01042273.1:1..24994,
CO   gap(20),AAHY01042274.1:1..8571,gap(83),AAHY01042275.1:1..10122,gap(20),
CO   AAHY01042276.1:1..8555,gap(20),AAHY01042277.1:1..41143,gap(20),
CO   complement(AAHY01042278.1:1..1312),gap(248),AAHY01042279.1:1..59744,
CO   gap(105),AAHY01042280.1:1..28877,gap(2460),AAHY01042281.1:1..3191,gap(375),
CO   AAHY01042282.1:1..13001,gap(120),complement(AAHY01042283.1:1..25201),
CO   gap(20),AAHY01042284.1:1..31931,gap(20),AAHY01042285.1:1..10993,gap(2023),
CO   AAHY01042286.1:1..3278,gap(193),AAHY01042287.1:1..43387,gap(661),
CO   AAHY01042288.1:1..2772,gap(82),AAHY01042289.1:1..3000,gap(1686),
CO   AAHY01042290.1:1..80118,gap(1286),complement(AAHY01042291.1:1..36050),
CO   gap(20),complement(AAHY01042292.1:1..13809),gap(68),
CO   complement(AAHY01042293.1:1..30955),gap(20),AAHY01042294.1:1..47941,
CO   gap(1327),AAHY01042295.1:1..10294,gap(2702),AAHY01042296.1:1..24727,
CO   gap(20),AAHY01042297.1:1..30336,gap(40),
CO   complement(AAHY01042298.1:1..28992),gap(20),AAHY01042299.1:1..4932,
CO   gap(514),AAHY01042300.1:1..4164,gap(3210),AAHY01042301.1:1..36648,gap(469),
CO   AAHY01042302.1:1..27794,gap(210),AAHY01042303.1:1..1447,gap(722),
CO   complement(AAHY01042304.1:1..35499),gap(20),AAHY01042305.1:1..147298,
CO   gap(20),AAHY01042306.1:1..6638,gap(203),AAHY01042307.1:1..4574,gap(22),
CO   AAHY01042308.1:1..12386,gap(739),AAHY01042309.1:1..1040,gap(26),
CO   AAHY01042310.1:1..39777,gap(20),AAHY01042311.1:1..3729,gap(20),
CO   AAHY01042312.1:1..37681,gap(149),AAHY01042313.1:1..930,gap(954),
CO   AAHY01042314.1:1..34990,gap(111),AAHY01042315.1:1..13210,gap(20),
CO   AAHY01042316.1:1..14199,gap(5880),AAHY01042317.1:1..2272,gap(81),
CO   complement(AAHY01042318.1:1..27846),gap(155),AAHY01042319.1:1..23306,
CO   gap(20),AAHY01042320.1:1..2346,gap(20),AAHY01042321.1:1..91390,gap(101),
CO   complement(AAHY01042322.1:1..82586),gap(20),AAHY01042323.1:1..74259,
CO   gap(59),AAHY01042324.1:1..5496,gap(20),AAHY01042325.1:1..2642,gap(1511),
CO   AAHY01042326.1:1..12910,gap(55),AAHY01042327.1:1..9938,gap(559),
CO   AAHY01042328.1:1..560,gap(1903),AAHY01042329.1:1..59120,gap(120),
CO   complement(AAHY01042330.1:1..60586),gap(188),
CO   complement(AAHY01042331.1:1..1329),gap(20),
CO   complement(AAHY01042332.1:1..12253),gap(427),AAHY01042333.1:1..6961,
CO   gap(521),AAHY01042334.1:1..48803,gap(20),AAHY01042335.1:1..18447,gap(20),
CO   AAHY01042336.1:1..12617,gap(476),AAHY01042337.1:1..2014,gap(36),
CO   AAHY01042338.1:1..26135,gap(2291),AAHY01042339.1:1..24676,gap(5932),
CO   AAHY01042340.1:1..1097,gap(459),AAHY01042341.1:1..1466,gap(411),
CO   complement(AAHY01042342.1:1..2784),gap(99),AAHY01042343.1:1..17605,
CO   gap(126),complement(AAHY01042344.1:1..1236),gap(20),
CO   AAHY01042345.1:1..11678,gap(20),AAHY01042346.1:1..28555,gap(2558),
CO   AAHY01042347.1:1..1008,gap(2765),AAHY01042348.1:1..20560,gap(20),
CO   AAHY01042349.1:1..61302,gap(192),AAHY01042350.1:1..13135,gap(20),
CO   AAHY01042351.1:1..108818,gap(20),complement(AAHY01042352.1:1..33738),
CO   gap(20),complement(AAHY01042353.1:1..20842),gap(20),
CO   complement(AAHY01042354.1:1..9655),gap(20),
CO   complement(AAHY01042355.1:1..27504),gap(125),
CO   complement(AAHY01042356.1:1..54600),gap(3822),
CO   complement(AAHY01042357.1:1..33435),gap(20),AAHY01042358.1:1..14612,
CO   gap(197),AAHY01042359.1:1..4392,gap(4618),AAHY01042360.1:1..32116,gap(20),
CO   AAHY01042361.1:1..15105,gap(27),complement(AAHY01042362.1:1..21074),
CO   gap(125),AAHY01042363.1:1..44456,gap(130),AAHY01042364.1:1..3259,gap(70),
CO   complement(AAHY01042365.1:1..88295),gap(73),
CO   complement(AAHY01042366.1:1..1266),gap(336),AAHY01042367.1:1..6016,gap(46),
CO   complement(AAHY01042368.1:1..762),gap(78),AAHY01042369.1:1..19201,gap(20),
CO   AAHY01042370.1:1..3029,gap(20),AAHY01042371.1:1..15879,gap(1850),
CO   AAHY01042372.1:1..29637,gap(62),AAHY01042373.1:1..2889,gap(42),
CO   complement(AAHY01042374.1:1..26119),gap(20),AAHY01042375.1:1..1522,gap(20),
CO   AAHY01042376.1:1..47068,gap(20),AAHY01042377.1:1..18670,gap(20),
CO   AAHY01042378.1:1..39018,gap(20),AAHY01042379.1:1..20138,gap(247),
CO   AAHY01042380.1:1..31538,gap(2819),AAHY01042381.1:1..9432,gap(20),
CO   AAHY01042382.1:1..85469,gap(156),AAHY01042383.1:1..11640,gap(20),
CO   AAHY01042384.1:1..8792,gap(20),complement(AAHY01042385.1:1..1263),
CO   gap(4224),complement(AAHY01042386.1:1..3432),gap(149),
CO   AAHY01042387.1:1..41987,gap(122),AAHY01042388.1:1..16294,gap(20),
CO   AAHY01042389.1:1..41470,gap(197),AAHY01042390.1:1..41459,gap(53),
CO   AAHY01042391.1:1..6489,gap(297),AAHY01042392.1:1..5191,gap(1961),
CO   AAHY01042393.1:1..4964,gap(20),AAHY01042394.1:1..35720,gap(124),
CO   AAHY01042395.1:1..4864,gap(20),AAHY01042396.1:1..4090,gap(20),
CO   AAHY01042397.1:1..6543,gap(1821),AAHY01042398.1:1..19408,gap(20),
CO   AAHY01042399.1:1..10324,gap(1043),AAHY01042400.1:1..9211,gap(20),
CO   AAHY01042401.1:1..6970,gap(238),AAHY01042402.1:1..29368,gap(20),
CO   AAHY01042403.1:1..23932,gap(79),AAHY01042404.1:1..3796,gap(20),
CO   AAHY01042405.1:1..54925,gap(20),AAHY01042406.1:1..26319,gap(183),
CO   AAHY01042407.1:1..10517,gap(4206),AAHY01042408.1:1..3300,gap(102),
CO   AAHY01042409.1:1..28523,gap(20),AAHY01042410.1:1..11812)
//


spacer
spacer