spacer

EBI Dbfetch

ID   CH466597; SV 1; linear; genomic DNA; CON; MUS; 8267202 BP.
XX
AC   CH466597;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 181000113608377 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8267202
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-8267202
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 04a66f93b5946eb4ffb0188cf00ff2b1.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000214.
DR   Ensembl-Gn; ENSMUSG00000002797; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002930; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004633; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029813; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029832; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029836; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029844; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037984; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038058; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038065; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038074; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038388; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043219; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043931; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045466; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045725; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051124; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051499; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052763; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058927; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059647; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060636; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063694; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068551; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031862; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036225; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046276; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049152; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052827; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054050; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059138; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062829; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064744; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095944; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101443; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101445; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114439; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114446; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114558; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114561; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114563; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114566; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115076; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121957; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131475; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153280; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179365; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8267202
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(6611..6964)
FT                   /pseudo
FT                   /locus_tag="mCG_1036412"
FT                   /note="gene_id=mCG1036412.1"
FT   mRNA            complement(6611..6964)
FT                   /pseudo
FT                   /locus_tag="mCG_1036412"
FT                   /note="gene_id=mCG1036412.1 transcript_id=mCT154116.1
FT                   created on 06-AUG-2002"
FT   gene            complement(16702..34039)
FT                   /gene="Pdia4"
FT                   /locus_tag="mCG_128034"
FT                   /note="gene_id=mCG128034.1"
FT   mRNA            complement(join(16702..17513,18915..19148,19736..19892,
FT                   21488..21639,23981..24139,24255..24460,27054..27192,
FT                   27554..27759,28723..28882,33745..34039))
FT                   /gene="Pdia4"
FT                   /locus_tag="mCG_128034"
FT                   /product="protein disulfide isomerase associated 4"
FT                   /note="gene_id=mCG128034.1 transcript_id=mCT129325.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(17098..17513,18915..19148,19736..19892,
FT                   21488..21639,23981..24139,24255..24460,27054..27192,
FT                   27554..27759,28723..28882,33745..33832))
FT                   /codon_start=1
FT                   /gene="Pdia4"
FT                   /locus_tag="mCG_128034"
FT                   /product="protein disulfide isomerase associated 4"
FT                   /note="gene_id=mCG128034.1 transcript_id=mCT129325.1
FT                   protein_id=mCP61210.1"
FT                   /protein_id="EDK98508.1"
FT                   /translation="MKLRKAWLLVLLLALTQLLAAASAGDAHEDTSDTENATEEEEEED
FT                   DDDLEVKEENGVWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDN
FT                   DPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQP
FT                   DWTPPPEVTLSLTKDNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPP
FT                   IPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMIEQSGPPSK
FT                   EILTLKQVQEFLKDGDDVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKF
FT                   LKVSLGKLVLTHPEKFQSKYEPRFHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDA
FT                   KRYSKRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFPEYTFAIADEEDYATEVKDL
FT                   GLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNK
FT                   GPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKM
FT                   DATANDITNDQYKVEGFPTIYFAPSGDKKNPIKFEGGNRDLEHLSKFIDEHATKRSRTK
FT                   EEL"
FT   gene            complement(24508..>24665)
FT                   /locus_tag="mCG_128031"
FT                   /note="gene_id=mCG128031.1"
FT   mRNA            complement(24508..>24665)
FT                   /locus_tag="mCG_128031"
FT                   /product="mCG128031"
FT                   /note="gene_id=mCG128031.1 transcript_id=mCT129322.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(24561..24665)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128031"
FT                   /product="mCG128031"
FT                   /note="gene_id=mCG128031.1 transcript_id=mCT129322.0
FT                   protein_id=mCP61184.0"
FT                   /protein_id="EDK98509.1"
FT                   /translation="MPTTRVSCSNNLVCLWGLSCHSHLGDIPRFGGCN"
FT   gene            complement(35778..>36155)
FT                   /locus_tag="mCG_1036413"
FT                   /note="gene_id=mCG1036413.1"
FT   mRNA            complement(35778..>36155)
FT                   /locus_tag="mCG_1036413"
FT                   /product="mCG1036413"
FT                   /note="gene_id=mCG1036413.1 transcript_id=mCT154117.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(35823..36155)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036413"
FT                   /product="mCG1036413"
FT                   /note="gene_id=mCG1036413.1 transcript_id=mCT154117.1
FT                   protein_id=mCP61271.0"
FT                   /protein_id="EDK98510.1"
FT                   /translation="MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDEKEFYLGK
FT                   RCAYVYKAKHNTATPGGKPNKTRVIWGKVSRAHGNSCMVRAKFRSHLPAKAIGHRIRVM
FT                   LYPSQI"
FT   gene            complement(40071..51034)
FT                   /gene="A730012O14Rik"
FT                   /locus_tag="mCG_128039"
FT                   /note="gene_id=mCG128039.1"
FT   mRNA            complement(join(40071..42230,45570..45725,47491..47617,
FT                   50856..51034))
FT                   /gene="A730012O14Rik"
FT                   /locus_tag="mCG_128039"
FT                   /product="RIKEN cDNA A730012O14"
FT                   /note="gene_id=mCG128039.1 transcript_id=mCT129330.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(40198..42230,45570..45725,47491..47617,
FT                   50856..50873))
FT                   /codon_start=1
FT                   /gene="A730012O14Rik"
FT                   /locus_tag="mCG_128039"
FT                   /product="RIKEN cDNA A730012O14"
FT                   /note="gene_id=mCG128039.1 transcript_id=mCT129330.1
FT                   protein_id=mCP61301.1"
FT                   /db_xref="GOA:B2RSK4"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:3026883"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSK4"
FT                   /protein_id="EDK98511.1"
FT                   /translation="MAGPARFPLTFEDVAIYFSEQEWQHLEAWQKELYKQVMRTNYETL
FT                   ISLDNGLPKPELISWIELGRELFGSWGEKKKPDKETHCSIDDVHVHLAIEEQLLESSQR
FT                   AVKSEVTCHSQLNPLESRHSFGLAVGERVDASLRHDQGISLVNAQTRCGEAVVSVVHSS
FT                   SEAAQRKVLSSHRTLALPGLQRVSSWQSTQNSCPVCRENSWEKNHLVKQQKGHSKSRSY
FT                   RVWKKFSRQADAKQPWSISCLGCGKSFRLKQYLVRHLDIHTRKRPPQCPKCKMCFHHER
FT                   TLFSHHLKNSSSQHPTCDTSFRTDSSVDLCQQIQERPAFWREDTNVPSRQKPGPSLDCE
FT                   DCCHMGSKLKGLQCGCILGEDRPHSHTEYGNCFLSQSKQAGLCRTHTGEKASQCPESNK
FT                   RLCLRGLQNVHQHGLRGEKPVFCRKCGQGFTKHCGLTEHTRILSGEKSFWCAQCGRNFS
FT                   QKGQLLRHQRLHLEEKPFQCTMCELRFHLKSRLRAHQLQHGGERPFSCSECGRAFTHQC
FT                   KLREHLRVHSGERPFQCPECHKSFRLKGVLKAHQRIHSKERPFSCGECGKGFIRQSKLT
FT                   EHFRVHSGERPFQCPECDRRFRLKGQLLSHQRLHTGERPFQCPECGKSYRVKADMKAHQ
FT                   LLHGGQMPFSCQCGKGFAKQSKLVEHMRTHTGEKPFQCPKCDKSFRLKAQLLSHQGLHT
FT                   GERPFHCPECDKNFREKGHMLRHQRIHRPERPFACGDCGKGFIYKSKLAEHIRVHTKAC
FT                   QVPREPDIKKRLSQLFAMIEADWS"
FT   gap             52437..52456
FT                   /estimated_length=20
FT   gap             54562..55184
FT                   /estimated_length=623
FT   gene            60009..85598
FT                   /gene="Zfp398"
FT                   /locus_tag="mCG_128041"
FT                   /note="gene_id=mCG128041.1"
FT   mRNA            join(60009..60262,64594..64989,76276..76402,76766..76879,
FT                   80442..80555,83133..85598)
FT                   /gene="Zfp398"
FT                   /locus_tag="mCG_128041"
FT                   /product="zinc finger protein 398"
FT                   /note="gene_id=mCG128041.1 transcript_id=mCT129332.0
FT                   created on 08-JUL-2002"
FT   CDS             join(60239..60262,64594..64989,76276..76402,76766..76879,
FT                   80442..80555,83133..84289)
FT                   /codon_start=1
FT                   /gene="Zfp398"
FT                   /locus_tag="mCG_128041"
FT                   /product="zinc finger protein 398"
FT                   /note="gene_id=mCG128041.1 transcript_id=mCT129332.0
FT                   protein_id=mCP61338.1"
FT                   /db_xref="GOA:Q14DQ6"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022137"
FT                   /db_xref="MGI:MGI:1917856"
FT                   /db_xref="UniProtKB/TrEMBL:Q14DQ6"
FT                   /protein_id="EDK98512.1"
FT                   /translation="MAEATAAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWT
FT                   VVAAVQAIERKVEVHSRRLLHLEGRTGTAEKKLASCEKTVAELGNQLDGKWAVLGTLLQ
FT                   EYGLLQRRLENLENLLRNRNFWILRLPPGIKGDIPKVPVAFDDVSIYFSTPEWEKLEEW
FT                   QKELYKNIMKGNYESLISMDYAMNQPDVLSQIQPEGEHSTDDQPRPEASEIPADPSEEP
FT                   GLSTSDILSWIKQEEEPQVGVSQESKESELYKGTYADEELVIKAEDLARASLCPEVPVA
FT                   FSAPPPAAAKDAFSDIAFKSQQCTPMAPFARTATDLPEASEGQVTFTQLGSYPLPPPVG
FT                   EQVFSCHHCGKSLSQDMLMTHQCGHAAEHPLTCAQCPKHFTPQADVGSTSQDHANETPP
FT                   TCPHCARTFTHPSRLTYHLRVHNSTERPFLCPDCPKRFADQARLTSHRRAHATERPFRC
FT                   PQCGRSFSLKISLLLHQRGHAQERPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDC
FT                   SKSFMRKEHLLNHRRLHTGERPFQCPHCGKSFIRKHHLMKHQRIHTGERPYPCAVCGRS
FT                   FRYKQTLKDHLRTGHSGGCAGDRDPSVQPPDPPGPLLTALETSGLGVSTEGLESSQWYG
FT                   EGSEGVVL"
FT   gene            <94988..125616
FT                   /gene="Zfp282"
FT                   /locus_tag="mCG_140821"
FT                   /note="gene_id=mCG140821.0"
FT   mRNA            join(<94988..95234,97393..97812,107523..107649,
FT                   108061..108180,110312..110431,115281..115394,
FT                   116360..116473,122057..125616)
FT                   /gene="Zfp282"
FT                   /locus_tag="mCG_140821"
FT                   /product="zinc finger protein 282, transcript variant
FT                   mCT171673"
FT                   /note="gene_id=mCG140821.0 transcript_id=mCT171673.0
FT                   created on 10-SEP-2002"
FT   mRNA            join(<94988..95234,97393..97812,107523..107649,
FT                   108061..108180,110312..110431,115281..115394,
FT                   116360..116473,122057..122579,122964..124461)
FT                   /gene="Zfp282"
FT                   /locus_tag="mCG_140821"
FT                   /product="zinc finger protein 282, transcript variant
FT                   mCT173147"
FT                   /note="gene_id=mCG140821.0 transcript_id=mCT173147.0
FT                   created on 10-SEP-2002"
FT   CDS             join(<95199..95234,97393..97812,107523..107649,
FT                   108061..108180,110312..110431,115281..115394,
FT                   116360..116473,122057..122579,122964..123063)
FT                   /codon_start=1
FT                   /gene="Zfp282"
FT                   /locus_tag="mCG_140821"
FT                   /product="zinc finger protein 282, isoform CRA_b"
FT                   /note="gene_id=mCG140821.0 transcript_id=mCT173147.0
FT                   protein_id=mCP96066.0 isoform=CRA_b"
FT                   /protein_id="EDK98514.1"
FT                   /translation="RAEMAEGMPPMQAQEWDMDARRPMPFQFPPFPDRAPVFPDRMMRE
FT                   PQLPTAEISLWTVVAAIQAVERKVDAQASQLLNLEGRTGTAEKKLADCEKTAVEFGNHM
FT                   ESKWAVLGTLLQEYGLLQRRLENLENLLRNRNFWVLRLPPGSKGEAPKVPVTFVDIAVY
FT                   FSEDEWKNLDEWQKELYSNLVKENYKTLMSLDTDGPVSKPDPPVQAEPREEPCVWEQHH
FT                   PEEREIPVTADTGTETLVPAQDISSQVKREEALCVRGQRGLEDRAIPTESITDSPISAQ
FT                   DLLSRIKQEEQQCVWDQQDLAERDIPTDPNSESLISAHDILSWIKQEEQPYPWGPRDSM
FT                   EGELGLDSGPSDSLLLVKNPPPSSAQPQTQPHQQSLPALAVPENPGGPGSRSLLEDGFP
FT                   ALPGERSTGGEAQPTGEGSAGGGGGGGSGGGGGTGAGSGNSTGAGAGSGCGSCCPGGLR
FT                   RSLLAHGARSKPYSCLECGKTFGVRKSLIIHHRSHTKERPYECAECEKSFNCHSGLIRH
FT                   QMTHRGERPLLTSCWKSAQELHSRQGIPRGGPGYPSTVQL"
FT   CDS             join(<95199..95234,97393..97812,107523..107649,
FT                   108061..108180,110312..110431,115281..115394,
FT                   116360..116473,122057..122877)
FT                   /codon_start=1
FT                   /gene="Zfp282"
FT                   /locus_tag="mCG_140821"
FT                   /product="zinc finger protein 282, isoform CRA_a"
FT                   /note="gene_id=mCG140821.0 transcript_id=mCT171673.0
FT                   protein_id=mCP94592.0 isoform=CRA_a"
FT                   /protein_id="EDK98513.1"
FT                   /translation="RAEMAEGMPPMQAQEWDMDARRPMPFQFPPFPDRAPVFPDRMMRE
FT                   PQLPTAEISLWTVVAAIQAVERKVDAQASQLLNLEGRTGTAEKKLADCEKTAVEFGNHM
FT                   ESKWAVLGTLLQEYGLLQRRLENLENLLRNRNFWVLRLPPGSKGEAPKVPVTFVDIAVY
FT                   FSEDEWKNLDEWQKELYSNLVKENYKTLMSLDTDGPVSKPDPPVQAEPREEPCVWEQHH
FT                   PEEREIPVTADTGTETLVPAQDISSQVKREEALCVRGQRGLEDRAIPTESITDSPISAQ
FT                   DLLSRIKQEEQQCVWDQQDLAERDIPTDPNSESLISAHDILSWIKQEEQPYPWGPRDSM
FT                   EGELGLDSGPSDSLLLVKNPPPSSAQPQTQPHQQSLPALAVPENPGGPGSRSLLEDGFP
FT                   ALPGERSTGGEAQPTGEGSAGGGGGGGSGGGGGTGAGSGNSTGAGAGSGCGSCCPGGLR
FT                   RSLLAHGARSKPYSCLECGKTFGVRKSLIIHHRSHTKERPYECAECEKSFNCHSGLIRH
FT                   QMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGERPFQCALCGKSFIRKQNLLKHQRI
FT                   HTGERPYTCGECGKSFRYKESLKDHLRVHNGPGLGAPRPLQVPPERD"
FT   gap             104521..104673
FT                   /estimated_length=153
FT   gap             106022..106041
FT                   /estimated_length=20
FT   gap             117913..117973
FT                   /estimated_length=61
FT   gap             130193..130296
FT                   /estimated_length=104
FT   gap             135104..135324
FT                   /estimated_length=221
FT   gene            137436..149956
FT                   /gene="Zfp212"
FT                   /locus_tag="mCG_140822"
FT                   /note="gene_id=mCG140822.0"
FT   mRNA            join(137436..138070,143825..144214,144338..144464,
FT                   146368..146448,148029..149956)
FT                   /gene="Zfp212"
FT                   /locus_tag="mCG_140822"
FT                   /product="Zinc finger protein 212, transcript variant
FT                   mCT171672"
FT                   /note="gene_id=mCG140822.0 transcript_id=mCT171672.0
FT                   created on 07-AUG-2002"
FT   mRNA            join(<138032..138070,143825..144214,144338..144464,
FT                   146368..146448,148032..149953)
FT                   /gene="Zfp212"
FT                   /locus_tag="mCG_140822"
FT                   /product="Zinc finger protein 212, transcript variant
FT                   mCT189071"
FT                   /note="gene_id=mCG140822.0 transcript_id=mCT189071.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<138032..138070,143825..144214,144338..144464,
FT                   146368..146448,148032..148885)
FT                   /codon_start=1
FT                   /gene="Zfp212"
FT                   /locus_tag="mCG_140822"
FT                   /product="Zinc finger protein 212, isoform CRA_b"
FT                   /note="gene_id=mCG140822.0 transcript_id=mCT189071.0
FT                   protein_id=mCP110076.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZPF1"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022137"
FT                   /db_xref="MGI:MGI:2682609"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZPF1"
FT                   /protein_id="EDK98516.1"
FT                   /translation="GATATMAESTPTRHRRKRRATPLAPATPPSQTTEKSPYFQTTEIS
FT                   LWTVVAAIQAVEKKMESQAARLQSLEGRAGSAEKKLADFEKTAVEFSNQLEGKWAVLGT
FT                   LLQEYGLLQRRLENVENLLRNKNFWVLRLPPGSKGETPKVSGSLENDGVCFSEQEWENL
FT                   EDWQKELYRNVMESNYETLVSLKVLGQPEEEVELGAEMVGDLVEEGTHLDRAMVKQEML
FT                   YKQEGPAGLPNMFSSAVEQQAFFGAEQAMFWNSPGDSALLESGPGDSNPESVETSRDPA
FT                   PGRNLDCPRKQKSHRQVQLGQECGQGLKVKRDSSPYKCPECQISFRYKQQLTAHLQSHA
FT                   GRESYSATEPEESLRPRPRLKPQAKRSKLHQCDVCHRSFSCKVSLVTHQRCHQQEGPST
FT                   SPQIQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSC
FT                   PECEKSFVQKQHLLQHQKIHQRERGGLASESARPNGLL"
FT   CDS             join(138047..138070,143825..144214,144338..144464,
FT                   146368..146448,148029..148885)
FT                   /codon_start=1
FT                   /gene="Zfp212"
FT                   /locus_tag="mCG_140822"
FT                   /product="Zinc finger protein 212, isoform CRA_a"
FT                   /note="gene_id=mCG140822.0 transcript_id=mCT171672.0
FT                   protein_id=mCP94591.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8R7"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022137"
FT                   /db_xref="MGI:MGI:2682609"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8R7"
FT                   /protein_id="EDK98515.1"
FT                   /translation="MAESTPTRHRRKRRATPLAPATPPSQTTEKSPYFQTTEISLWTVV
FT                   AAIQAVEKKMESQAARLQSLEGRAGSAEKKLADFEKTAVEFSNQLEGKWAVLGTLLQEY
FT                   GLLQRRLENVENLLRNKNFWVLRLPPGSKGETPKVSGSLENDGVCFSEQEWENLEDWQK
FT                   ELYRNVMESNYETLVSLKVLGQPEEEVELGAEMVGDLVEEGTHLADRAMVKQEMLYKQE
FT                   GPAGLPNMFSSAVEQQAFFGAEQAMFWNSPGDSALLESGPGDSNPESVETSRDPAPGRN
FT                   LDCPRKQKSHRQVQLGQECGQGLKVKRDSSPYKCPECQISFRYKQQLTAHLQSHAGRES
FT                   YSATEPEESLRPRPRLKPQAKRSKLHQCDVCHRSFSCKVSLVTHQRCHQQEGPSTSPQI
FT                   QERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCPECE
FT                   KSFVQKQHLLQHQKIHQRERGGLASESARPNGLL"
FT   gap             151045..151064
FT                   /estimated_length=20
FT   gene            161488..182953
FT                   /gene="AI894139"
FT                   /locus_tag="mCG_140816"
FT                   /note="gene_id=mCG140816.0"
FT   mRNA            join(161488..161659,163711..164033,164165..164244,
FT                   164944..165072,167177..167302,168164..168274,
FT                   171630..171861,174096..174449,175759..175885,
FT                   180805..180912,181601..182953)
FT                   /gene="AI894139"
FT                   /locus_tag="mCG_140816"
FT                   /product="expressed sequence AI894139"
FT                   /note="gene_id=mCG140816.0 transcript_id=mCT171645.0
FT                   created on 07-AUG-2002"
FT   CDS             join(171838..171861,174096..174449,175759..175885,
FT                   180805..180912,181601..182706)
FT                   /codon_start=1
FT                   /gene="AI894139"
FT                   /locus_tag="mCG_140816"
FT                   /product="expressed sequence AI894139"
FT                   /note="gene_id=mCG140816.0 transcript_id=mCT171645.0
FT                   protein_id=mCP94564.0"
FT                   /db_xref="GOA:Q3UZY6"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022137"
FT                   /db_xref="MGI:MGI:2141515"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UZY6"
FT                   /protein_id="EDK98517.1"
FT                   /translation="MTEAAAAPDWHMGTDLQQQTQIQSAEISLLAILSAVQAVEKKTES
FT                   QAVHLQNLEVRTGSAEKKLADFEKTAMELSSQLEGKWAVLGTLLQEYGLLQRRLENLEN
FT                   QMQNRNPWVLRLPPSSRDEAPKVSVTTEEVAGCFPEQQEGSPEDWQKELCKRVAKERRE
FT                   VLGSLETGQLESAPSVLPWIKQEEEVCEKSLQETASASLCSETWLANKKRTLEGMSMAP
FT                   EPSWATEGGPGKEDFEQGSCVDLLPVCREREAAPLPRGSQSQPVPAAEATEDDQNFSVR
FT                   ELSTQPEYSHHGSQPFASLQCPQSATQQVTLTRNRRAPTAQRAYTCVQCGKSFVHQSTL
FT                   TTHYRTHTGEKPYKCAECEKRFGRLSTLLEHQRTHTGERPFPCAQCGRRFGRLSTLVEH
FT                   RRTHTGEKPFPCTQCDKRFTRLANLTVHQSVHSGEHAFQCTQCGSCFTHKPSFLRHLRS
FT                   HSQEKRFSCGQCGKSFTCRSWLVRHQSSHAHLASSAYVACERSSPSHVSPTGLFKGAAR
FT                   GKFSSDPPVSPISKDTVVSQDHKAYGGGQQLSDHGQESLVGSLHSCLSVKMENAG"
FT   gene            complement(195214..196099)
FT                   /pseudo
FT                   /locus_tag="mCG_128054"
FT                   /note="gene_id=mCG128054.1"
FT   mRNA            complement(195214..196099)
FT                   /pseudo
FT                   /locus_tag="mCG_128054"
FT                   /note="gene_id=mCG128054.1 transcript_id=mCT129347.1
FT                   created on 06-AUG-2002"
FT   gap             220720..223011
FT                   /estimated_length=2292
FT   gene            complement(242366..262875)
FT                   /locus_tag="mCG_140820"
FT                   /note="gene_id=mCG140820.0"
FT   mRNA            complement(join(242366..243996,247297..247548,
FT                   255729..255842,260203..260329,262018..262875))
FT                   /locus_tag="mCG_140820"
FT                   /product="mCG140820"
FT                   /note="gene_id=mCG140820.0 transcript_id=mCT171669.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(242807..243996,247297..247548,
FT                   255729..255842,260203..260329,262018..262860))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140820"
FT                   /product="mCG140820"
FT                   /note="gene_id=mCG140820.0 transcript_id=mCT171669.0
FT                   protein_id=mCP94590.0"
FT                   /db_xref="GOA:G5E8L5"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022137"
FT                   /db_xref="MGI:MGI:1919556"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8L5"
FT                   /protein_id="EDK98518.1"
FT                   /translation="MEDDRSSPLSFSSVPHEESVRQAPARLPRETVFPSCILPPKEVPP
FT                   LSPTASRQGVLPQTDSTTKQETSSQMSHVLQKGPSLLYPATSEQDTPHQVSLASQEETQ
FT                   CSPSAAAQGIPFLSHSAHRQEAPLHSPEVPEKDSLTLSPTVPETDMDPLLQSPTLQKDT
FT                   PFHTSSAAQKEQPLPTAEITRLAVWAAVQAVERKLEAQAMRLLTLEGRTGTNEKKIADC
FT                   ERTAVEFANHLESKWVVLGTLLQEYGLLQRRLENMENLLKNRNFWILRLPPGSNGEVPK
FT                   VPVTFDDVAVHFSEQEWGNLSEWQKELYKNVMRGNYESLVSMDYAISKPDLMSQMERGE
FT                   RPAMQEQEDSEEGETPTDPSAAHDGIVIKIEVQTNDEGSEGLETPEPLMGQVEEHGFQD
FT                   SELGDPCGEQPDLDMQEQENALEESTEGSSEFSELKQMLVQQRNCTEGIVIKTEEQEEE
FT                   EEEEEEDELPQHLQSLGQLSGRYEASMYQTPLPGEMSPEGEESPPPLQLGNPAVKRLAP
FT                   SIHGHTHGHGHGHGHSERHLGENRGNSSQQQRNRRGERPFTCMECGKSFRLKINLIIHQ
FT                   RNHIKEGPYECAECEISFRHKQQLTLHQRIHRVRSGYASPERGSAFNPKHSLKPRPKSP
FT                   SSGSGGGPKPYKCPECDSSFSHKSSLTKHQITHTGERPYTCPECKKSFRLHISLVIHQR
FT                   VHAGKHEVSFICSLCGKSFSRPSHLLRHQRTHTGERPFKCPECEKSFSEKSKLTNHCRV
FT                   HSRERPHACPECGKSFIRKHHLLEHRRIHTGERPYHCAECGKRFTQKHHLLEHQRAHTG
FT                   ERPYPCTHCAKCFRYKQSLKYHLRTHTGE"
FT   gap             266130..266861
FT                   /estimated_length=732
FT   gap             268291..268410
FT                   /estimated_length=120
FT   gap             271446..271634
FT                   /estimated_length=189
FT   gene            complement(280469..301686)
FT                   /locus_tag="mCG_140819"
FT                   /note="gene_id=mCG140819.0"
FT   mRNA            complement(join(280469..283026,284503..284628,
FT                   285243..285434,300234..300347,301173..301299,
FT                   301386..301685))
FT                   /locus_tag="mCG_140819"
FT                   /product="mCG140819, transcript variant mCT171670"
FT                   /note="gene_id=mCG140819.0 transcript_id=mCT171670.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(281906..283026,284503..284628,
FT                   285243..285434,300234..300347,301173..301299,
FT                   301386..301670))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140819"
FT                   /product="mCG140819, isoform CRA_b"
FT                   /note="gene_id=mCG140819.0 transcript_id=mCT171670.0
FT                   protein_id=mCP94589.0 isoform=CRA_b"
FT                   /protein_id="EDK98520.1"
FT                   /translation="MAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFSN
FT                   QLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEVPKVPLTFDDVA
FT                   MYFSDQEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCTWRRTG
FT                   PKVPEVPVDPSPGSGAPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWG
FT                   LSQLDSGAGDISTDATSGVHSNFSTTIPPTSWQADLPPHHPSSACSDGTLKLNTAASTE
FT                   ADVKIVIKTEVQEEEVVATPVHPTDLEAHGTLFAPGQATRFFPSPVQEGAWESQGSSFP
FT                   SQDPVLGLREPTRPERDIGELSPAIAQEEAPAGDWLFGGVRWGWNFRCKPPVGLNPRTV
FT                   PEGLPFSSPDNGEAILDPSQAPRPFNDPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTC
FT                   ATCGKSFQLQVSLSAHQRSCGLSDGAATGAASTATGGGGGGSGGGGGSSGGGSSARDSS
FT                   ALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFT
FT                   CTVCGKSFIRKDHLRKHQRNHPAVAKAPAHGQPLPPLPAPPDPFKSPAAKGPMASTDLV
FT                   TDWTCGLSVLGPSDGGGDL"
FT   mRNA            complement(join(284227..284628,285243..285434,
FT                   300234..300347,301173..301254,301386..301686))
FT                   /locus_tag="mCG_140819"
FT                   /product="mCG140819, transcript variant mCT171671"
FT                   /note="gene_id=mCG140819.0 transcript_id=mCT171671.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(284357..284628,285243..285434,
FT                   300234..300347,301173..301254,301386..301670))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140819"
FT                   /product="mCG140819, isoform CRA_a"
FT                   /note="gene_id=mCG140819.0 transcript_id=mCT171671.0
FT                   protein_id=mCP94588.0 isoform=CRA_a"
FT                   /protein_id="EDK98519.1"
FT                   /translation="MAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFSN
FT                   QLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEVPKEWGKLEDWQ
FT                   KELYKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCTWRRTGPKVPEVPVDPSPGSG
FT                   APVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDA
FT                   TSGVHSNFSTTIPPTSWQADLPPHHPSSACSDGTLKLNTAASTEGTGVAGEESDCLNGH
FT                   SVLTGDCPMLSASMHLAHGSLCLLLYLLQNSLT"
FT   gap             304092..304227
FT                   /estimated_length=136
FT   gap             318813..318832
FT                   /estimated_length=20
FT   gap             332577..333291
FT                   /estimated_length=715
FT   gap             334739..334758
FT                   /estimated_length=20
FT   gap             337372..337408
FT                   /estimated_length=37
FT   gap             344704..344723
FT                   /estimated_length=20
FT   gap             364710..364729
FT                   /estimated_length=20
FT   gap             366430..366694
FT                   /estimated_length=265
FT   gap             389311..390223
FT                   /estimated_length=913
FT   gap             396606..396654
FT                   /estimated_length=49
FT   gap             402665..402684
FT                   /estimated_length=20
FT   gap             409516..409535
FT                   /estimated_length=20
FT   gap             417162..417205
FT                   /estimated_length=44
FT   gap             418056..418264
FT                   /estimated_length=209
FT   gap             441378..441470
FT                   /estimated_length=93
FT   gap             452971..453032
FT                   /estimated_length=62
FT   gap             473559..473578
FT                   /estimated_length=20
FT   gap             501661..501680
FT                   /estimated_length=20
FT   gap             515922..515941
FT                   /estimated_length=20
FT   gap             518041..518060
FT                   /estimated_length=20
FT   gap             519146..519165
FT                   /estimated_length=20
FT   gap             526366..526385
FT                   /estimated_length=20
FT   gap             526548..526567
FT                   /estimated_length=20
FT   gap             537130..537149
FT                   /estimated_length=20
FT   gap             537351..537370
FT                   /estimated_length=20
FT   gene            complement(563582..>564003)
FT                   /locus_tag="mCG_1036747"
FT                   /note="gene_id=mCG1036747.1"
FT   mRNA            complement(563582..>564003)
FT                   /locus_tag="mCG_1036747"
FT                   /product="mCG1036747"
FT                   /note="gene_id=mCG1036747.1 transcript_id=mCT154451.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(563679..>564002)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036747"
FT                   /product="mCG1036747"
FT                   /note="gene_id=mCG1036747.1 transcript_id=mCT154451.1
FT                   protein_id=mCP61351.1"
FT                   /protein_id="EDK98521.1"
FT                   /translation="RVPIEVSFIRLRCLLFKAYIAGNMGGVEGELYKEQRSGHLLTWGP
FT                   KSGARQRALWILSLVHRSSLTALGVRLSSGVTHVLGWHGNSGRDREEGTIIQLLQPQVP
FT                   RKE"
FT   gap             564799..564818
FT                   /estimated_length=20
FT   gene            complement(565822..587100)
FT                   /locus_tag="mCG_140825"
FT                   /note="gene_id=mCG140825.0"
FT   mRNA            complement(join(565822..566277,586336..587100))
FT                   /locus_tag="mCG_140825"
FT                   /product="mCG140825"
FT                   /note="gene_id=mCG140825.0 transcript_id=mCT171692.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(586531..586854)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140825"
FT                   /product="mCG140825"
FT                   /note="gene_id=mCG140825.0 transcript_id=mCT171692.0
FT                   protein_id=mCP94611.0"
FT                   /protein_id="EDK98522.1"
FT                   /translation="MYDVWTKCVPHLWIHLCCCLCGADIVLRLHFEAHFPSWSPRLSLH
FT                   CMGKTQREVFGALKQVLGATAEATIPRTCSRLSTPKNVCRGVPLSAISEEGRFLPSHPS
FT                   IAL"
FT   gene            <587285..609201
FT                   /gene="A930040G15Rik"
FT                   /locus_tag="mCG_128029"
FT                   /note="gene_id=mCG128029.2"
FT   mRNA            join(<587285..587587,594582..594721,595089..595208,
FT                   595702..595851,596946..597101,598009..598143,
FT                   598549..598722,599388..599537,600244..600441,
FT                   600885..601058,601433..601609,603357..603509,
FT                   603989..604141,604793..604987,605078..605218,
FT                   605771..605866,606205..606315,607291..609201)
FT                   /gene="A930040G15Rik"
FT                   /locus_tag="mCG_128029"
FT                   /product="RIKEN cDNA A930040G15, transcript variant
FT                   mCT189087"
FT                   /note="gene_id=mCG128029.2 transcript_id=mCT189087.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(587312..587587,595089..595208,595702..595851,
FT                   596946..597101,598009..598143,598549..598722,
FT                   599388..599537,600885..601058,601433..601609,
FT                   603357..603509,603989..604141,604793..604987,
FT                   605078..605218,605771..605866,606205..606315,
FT                   607291..609199)
FT                   /gene="A930040G15Rik"
FT                   /locus_tag="mCG_128029"
FT                   /product="RIKEN cDNA A930040G15, transcript variant
FT                   mCT129338"
FT                   /note="gene_id=mCG128029.2 transcript_id=mCT129338.1
FT                   created on 19-JUN-2003"
FT   mRNA            join(<587332..587587,594582..594721,595089..595208,
FT                   595702..595851,596949..597101,598009..598143,
FT                   598549..598722,599388..599537,600244..600441,
FT                   600885..601058,601433..601609,603357..603509,
FT                   603989..604141,604793..604987,605078..605218,
FT                   605771..605866,606205..606315,607291..608614)
FT                   /gene="A930040G15Rik"
FT                   /locus_tag="mCG_128029"
FT                   /product="RIKEN cDNA A930040G15, transcript variant
FT                   mCT189086"
FT                   /note="gene_id=mCG128029.2 transcript_id=mCT189086.0
FT                   created on 08-MAR-2004"
FT   CDS             join(587386..587587,595089..595208,595702..595851,
FT                   596946..597101,598009..598143,598549..598722,
FT                   599388..599537,600885..601058,601433..601609,
FT                   603357..603509,603989..604141,604793..604987,
FT                   605078..605218,605771..605866,606205..606315,
FT                   607291..608105)
FT                   /codon_start=1
FT                   /gene="A930040G15Rik"
FT                   /locus_tag="mCG_128029"
FT                   /product="RIKEN cDNA A930040G15, isoform CRA_c"
FT                   /note="gene_id=mCG128029.2 transcript_id=mCT129338.1
FT                   protein_id=mCP62058.1 isoform=CRA_c"
FT                   /protein_id="EDK98525.1"
FT                   /translation="MRSARPTQTSQLCGSRCSEFPGPASCRAELGRCPRGSRGSRCSLQ
FT                   PEPHRKLGGPGSREAEFRHGAPGTSELLPLSAFLSPAEAGGATSGESHQDKGQKPHLEH
FT                   SSQGEQPQQSLHLTALVQLVKEIPEFLFGEVKGTEDYSESGSTSLDGEQTSPEVAVVVE
FT                   ACPPRGLLSSLPESPASHPSLATTPTGSSTSGGPPGDWAHGSPLPAIGTDDKPLSIEKE
FT                   GVGASRETSIHSTQSLGQSKSYLRQERGSMGTGTLPENSPLQGLINCLKEILVPRPQHR
FT                   GTAPDLPPSLPGLSVLKQTRAEVEAGSLPCPVKTEAASGDCPLQGLLNCLKEIPKAPDR
FT                   RPSPSGASDLQLQEDPGKRHSGASRASSSPLEALEACLKGIPPGGSSPLQSLAISWSRS
FT                   PQLGDAGSQRFELQQQGSHSEEATREPLLPLSLQGYMREGPGVQPCGSQGTPTSFSSAS
FT                   SSDGDLDFRSPRSSQGQRLGKGYLPGNSPLQGLENCLREIPIPRPQAAWPCSSAVNRGL
FT                   KRTEPRNWTGDREGLRGEASEPPHLRQRPGEVPSRSLHQDSPQTCTSTCHQVTTRPGTW
FT                   QWPQEETATMPSPLHRLENSLRGILPVRPLRFTCVTGPGPSPSPCSSSSFSSSDGEDLR
FT                   PEPAFWQSPLQQKDQPPSCKDPVRLCPVSGASPRVNSNSCSAEDRERTEPRDCSSLSAG
FT                   RAEEKPHPPRREDGAERTRQPGPVTNAEGKGAAAGHPSPAPQLEEKPEPKGTEDSRDLE
FT                   PGHRPPSAAARTQGKLLSGDPPESPSKSPLPTTVLSKWSPTSLQPPCPCGRSLQQELHN
FT                   LGTALTDKLDRLAAALAGLTQEVATMKTQMDQLRRHPRSLGPKGQGSWQLALPQRPRWV
FT                   NRLGHRHLPYWRQKGPTRPRPKILRTQAEGCKTSDRPGLSRGKGSLVPQLPPEASLVES
FT                   SRPTCSSSQQISSTPGGHTVLTAHPPLEHTACHQNPLSPSVPTSVQVPLVASPATSADT
FT                   EPPAARVAAISIPNQPKEPDSLLGEALSRDLWGGDHRDPRWGAH"
FT   CDS             join(<587568..587587,594582..594721,595089..595208,
FT                   595702..595851,596946..597101,598009..598143,
FT                   598549..598722,599388..599537,600244..600441,
FT                   600885..601058,601433..601609,603357..603509,
FT                   603989..604141,604793..604987,605078..605218,
FT                   605771..605866,606205..606315,607291..608105)
FT                   /codon_start=1
FT                   /gene="A930040G15Rik"
FT                   /locus_tag="mCG_128029"
FT                   /product="RIKEN cDNA A930040G15, isoform CRA_b"
FT                   /note="gene_id=mCG128029.2 transcript_id=mCT189087.0
FT                   protein_id=mCP110061.0 isoform=CRA_b"
FT                   /protein_id="EDK98524.1"
FT                   /translation="VPPWRSRLYPQVPISFKDLAVRFSEEEWRLLQEGQREFYRDVMRE
FT                   NYETLVSVGTSELLPLSAFLSPAEAGGATSGESHQDKGQKPHLEHSSQGEQPQQSLHLT
FT                   ALVQLVKEIPEFLFGEVKGTEDYSESGSTSLDGEQTSPEVAVVVEACPPRGLLSSLPES
FT                   PASHPSLATTPTGSSTSGGPPGDWAHGSPLPAIGTDDKPLSIEKEGVGASRETSIHSTQ
FT                   SLGQSKSYLRQERGSMGTGTLPENSPLQGLINCLKEILVPRPQHRGTAPDLPPSLPGLS
FT                   VLKQTRAEVEAGSLPCPVKTEAASGDCPLQGLLNCLKEIPKAPDRRPSPSGASDLQLQE
FT                   DPGKRHSGGMRHLQTPPHPSHEAGSMLATVKVEDGWAQSPPVPASCQLSRQGYSSYSTG
FT                   DNREVRVPRWGPMTLASRASSSPLEALEACLKGIPPGGSSPLQSLAISWSRSPQLGDAG
FT                   SQRFELQQQGSHSEEATREPLLPLSLQGYMREGPGVQPCGSQGTPTSFSSASSSDGDLD
FT                   FRSPRSSQGQRLGKGYLPGNSPLQGLENCLREIPIPRPQAAWPCSSAVNRGLKRTEPRN
FT                   WTGDREGLRGEASEPPHLRQRPGEVPSRSLHQDSPQTCTSTCHQVTTRPGTWQWPQEET
FT                   ATMPSPLHRLENSLRGILPVRPLRFTCVTGPGPSPSPCSSSSFSSSDGEDLRPEPAFWQ
FT                   SPLQQKDQPPSCKDPVRLCPVSGASPRVNSNSCSAEDRERTEPRDCSSLSAGRAEEKPH
FT                   PPRREDGAERTRQPGPVTNAEGKGAAAGHPSPAPQLEEKPEPKGTEDSRDLEPGHRPPS
FT                   AAARTQGKLLSGDPPESPSKSPLPTTVLSKWSPTSLQPPCPCGRSLQQELHNLGTALTD
FT                   KLDRLAAALAGLTQEVATMKTQMDQLRRHPRSLGPKGQGSWQLALPQRPRWVNRLGHRH
FT                   LPYWRQKGPTRPRPKILRTQAEGCKTSDRPGLSRGKGSLVPQLPPEASLVESSRPTCSS
FT                   SQQISSTPGGHTVLTAHPPLEHTACHQNPLSPSVPTSVQVPLVASPATSADTEPPAARV
FT                   AAISIPNQPKEPDSLLGEALSRDLWGGDHRDPRWGAH"
FT   CDS             join(<587568..587587,594582..594721,595089..595208,
FT                   595702..595851,596949..597101,598009..598143,
FT                   598549..598722,599388..599537,600244..600441,
FT                   600885..601058,601433..601609,603357..603509,
FT                   603989..604141,604793..604987,605078..605218,
FT                   605771..605866,606205..606315,607291..608105)
FT                   /codon_start=1
FT                   /gene="A930040G15Rik"
FT                   /locus_tag="mCG_128029"
FT                   /product="RIKEN cDNA A930040G15, isoform CRA_a"
FT                   /note="gene_id=mCG128029.2 transcript_id=mCT189086.0
FT                   protein_id=mCP110060.0 isoform=CRA_a"
FT                   /protein_id="EDK98523.1"
FT                   /translation="VPPWRSRLYPQVPISFKDLAVRFSEEEWRLLQEGQREFYRDVMRE
FT                   NYETLVSVGTSELLPLSAFLSPAEAGGATSGESHQDKGQKPHLEHSSQGEQPQQSLHLT
FT                   ALVQLVKEIPEFLFGEVKGTEDYSESGSTSLDGEQTSPEAVVVEACPPRGLLSSLPESP
FT                   ASHPSLATTPTGSSTSGGPPGDWAHGSPLPAIGTDDKPLSIEKEGVGASRETSIHSTQS
FT                   LGQSKSYLRQERGSMGTGTLPENSPLQGLINCLKEILVPRPQHRGTAPDLPPSLPGLSV
FT                   LKQTRAEVEAGSLPCPVKTEAASGDCPLQGLLNCLKEIPKAPDRRPSPSGASDLQLQED
FT                   PGKRHSGGMRHLQTPPHPSHEAGSMLATVKVEDGWAQSPPVPASCQLSRQGYSSYSTGD
FT                   NREVRVPRWGPMTLASRASSSPLEALEACLKGIPPGGSSPLQSLAISWSRSPQLGDAGS
FT                   QRFELQQQGSHSEEATREPLLPLSLQGYMREGPGVQPCGSQGTPTSFSSASSSDGDLDF
FT                   RSPRSSQGQRLGKGYLPGNSPLQGLENCLREIPIPRPQAAWPCSSAVNRGLKRTEPRNW
FT                   TGDREGLRGEASEPPHLRQRPGEVPSRSLHQDSPQTCTSTCHQVTTRPGTWQWPQEETA
FT                   TMPSPLHRLENSLRGILPVRPLRFTCVTGPGPSPSPCSSSSFSSSDGEDLRPEPAFWQS
FT                   PLQQKDQPPSCKDPVRLCPVSGASPRVNSNSCSAEDRERTEPRDCSSLSAGRAEEKPHP
FT                   PRREDGAERTRQPGPVTNAEGKGAAAGHPSPAPQLEEKPEPKGTEDSRDLEPGHRPPSA
FT                   AARTQGKLLSGDPPESPSKSPLPTTVLSKWSPTSLQPPCPCGRSLQQELHNLGTALTDK
FT                   LDRLAAALAGLTQEVATMKTQMDQLRRHPRSLGPKGQGSWQLALPQRPRWVNRLGHRHL
FT                   PYWRQKGPTRPRPKILRTQAEGCKTSDRPGLSRGKGSLVPQLPPEASLVESSRPTCSSS
FT                   QQISSTPGGHTVLTAHPPLEHTACHQNPLSPSVPTSVQVPLVASPATSADTEPPAARVA
FT                   AISIPNQPKEPDSLLGEALSRDLWGGDHRDPRWGAH"
FT   gap             613324..613343
FT                   /estimated_length=20
FT   gene            complement(619595..637715)
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /note="gene_id=mCG128033.1"
FT   mRNA            complement(join(619595..619776,633835..633948,
FT                   634513..634626,635302..635377,635871..635926))
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, transcript variant
FT                   mCT171659"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT171659.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(619697..619776,633835..633948,
FT                   634513..634626,635302..635335))
FT                   /codon_start=1
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, isoform CRA_a"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT171659.0
FT                   protein_id=mCP94581.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3USQ2"
FT                   /db_xref="MGI:MGI:1916160"
FT                   /db_xref="UniProtKB/TrEMBL:Q3USQ2"
FT                   /protein_id="EDK98526.1"
FT                   /translation="MRETLEALNSLGFSVGQPEMAPQSEPRDGFSNAQEKMSSRGESTL
FT                   HSCSGHETPGQKEGIHTEQAEAPCMGSQASTPQKAEPAGSVPGDHMKFHCSLRRKHLMS
FT                   PDACSSVSV"
FT   mRNA            complement(join(626050..626131,633664..633719,
FT                   633835..633948,634513..634626,635302..635377,
FT                   637243..637715))
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, transcript variant
FT                   mCT171660"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT171660.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(626114..626131,633664..633719,
FT                   633835..633948,634513..634626,635302..635335))
FT                   /codon_start=1
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, isoform CRA_b"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT171660.0
FT                   protein_id=mCP94579.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z7M0"
FT                   /db_xref="MGI:MGI:1916160"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z7M0"
FT                   /protein_id="EDK98527.1"
FT                   /translation="MRETLEALNSLGFSVGQPEMAPQSEPRDGFSNAQEKMSSRGESTL
FT                   HSCSGHETPGQKEGIHTEQAEAPCMGSQASTPQKAEPAGSVPVLQRSQGVSHLWTVEWE
FT                   KQVGPKL"
FT   mRNA            complement(join(628524..631249,633835..633948,
FT                   634513..634626,635302..635377,637243..637715))
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, transcript variant
FT                   mCT171662"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT171662.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(628524..631346,633835..633948,
FT                   634513..634626,635302..635377,637243..637715))
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, transcript variant
FT                   mCT129324"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT129324.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(628524..631346,633835..633948,
FT                   634513..634626,635302..635377,636861..636979))
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, transcript variant
FT                   mCT171661"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT171661.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(629824..631346,633835..633948,
FT                   634513..634626,635302..635335))
FT                   /codon_start=1
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, isoform CRA_d"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT129324.1
FT                   protein_id=mCP61189.1 isoform=CRA_d"
FT                   /db_xref="GOA:B2RU53"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1916160"
FT                   /db_xref="UniProtKB/TrEMBL:B2RU53"
FT                   /protein_id="EDK98529.1"
FT                   /translation="MRETLEALNSLGFSVGQPEMAPQSEPRDGFSNAQEKMSSRGESTL
FT                   HSCSGHETPGQKEGIHTEQAEAPCMGSQASTPQKAEPAGSVPGEEWMIRKVKVEDEDQE
FT                   AEEEVEWPQHLSFLPSPFPTPDLGQLAVTYKLEPGTPGALGGIALSGWAPIPEKPYGCE
FT                   ECERRFRDQLTLRLHQRLHRGEGPCACPDCGRSFTQRAHMLLHQRSHRGERPFPCSECD
FT                   KRFSKKAHLTRHLRTHTGERPYPCAECGKRFSQKIHLGSHQKTHTGERPFPCTECEKRF
FT                   RKKTHLIRHQRIHTGERPYQCTQCTRSFTHKQHLVRHQRVHDAASRTRSSPDIPVAPHS
FT                   PTASLTPSPPGPKPFACSHCGQSFGWKKNLATHQSLHLTEGRPFGCDECALGTNVDPAA
FT                   EPSACTPHAPDCGPGSGPAAPQRTTSSERSFFCPDCGRGFAHGQHLARHRRVHTGERPF
FT                   ACAQCGRRFGSRPNLVAHSRAHSGARPFACAQCGRRFSRKSHLGRHQAVHTGSRPHACA
FT                   VCARCFSSKTNLVRHQAIHTGSRPFSCPQCAKSFSRKTHLVRHQRIHGDAALPAPASNL
FT                   SAPAWSNPSEVVPPPIFF"
FT   CDS             complement(join(629824..631346,633835..633948,
FT                   634513..634626,635302..635335))
FT                   /codon_start=1
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, isoform CRA_d"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT171661.0
FT                   protein_id=mCP94580.0 isoform=CRA_d"
FT                   /db_xref="GOA:B2RU53"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1916160"
FT                   /db_xref="UniProtKB/TrEMBL:B2RU53"
FT                   /protein_id="EDK98530.1"
FT                   /translation="MRETLEALNSLGFSVGQPEMAPQSEPRDGFSNAQEKMSSRGESTL
FT                   HSCSGHETPGQKEGIHTEQAEAPCMGSQASTPQKAEPAGSVPGEEWMIRKVKVEDEDQE
FT                   AEEEVEWPQHLSFLPSPFPTPDLGQLAVTYKLEPGTPGALGGIALSGWAPIPEKPYGCE
FT                   ECERRFRDQLTLRLHQRLHRGEGPCACPDCGRSFTQRAHMLLHQRSHRGERPFPCSECD
FT                   KRFSKKAHLTRHLRTHTGERPYPCAECGKRFSQKIHLGSHQKTHTGERPFPCTECEKRF
FT                   RKKTHLIRHQRIHTGERPYQCTQCTRSFTHKQHLVRHQRVHDAASRTRSSPDIPVAPHS
FT                   PTASLTPSPPGPKPFACSHCGQSFGWKKNLATHQSLHLTEGRPFGCDECALGTNVDPAA
FT                   EPSACTPHAPDCGPGSGPAAPQRTTSSERSFFCPDCGRGFAHGQHLARHRRVHTGERPF
FT                   ACAQCGRRFGSRPNLVAHSRAHSGARPFACAQCGRRFSRKSHLGRHQAVHTGSRPHACA
FT                   VCARCFSSKTNLVRHQAIHTGSRPFSCPQCAKSFSRKTHLVRHQRIHGDAALPAPASNL
FT                   SAPAWSNPSEVVPPPIFF"
FT   CDS             complement(join(631176..631249,633835..633948,
FT                   634513..634626,635302..635335))
FT                   /codon_start=1
FT                   /gene="Zfp467"
FT                   /locus_tag="mCG_128033"
FT                   /product="zinc finger protein 467, isoform CRA_c"
FT                   /note="gene_id=mCG128033.1 transcript_id=mCT171662.0
FT                   protein_id=mCP94578.0 isoform=CRA_c"
FT                   /db_xref="GOA:G3X9X3"
FT                   /db_xref="MGI:MGI:1916160"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9X3"
FT                   /protein_id="EDK98528.1"
FT                   /translation="MRETLEALNSLGFSVGQPEMAPQSEPRDGFSNAQEKMSSRGESTL
FT                   HSCSGHETPGQKEGIHTEQAEAPCMGSQASTPQKAEPAGSVPVLFPLLTWVSWLLRTNW
FT                   SQGLREH"
FT   gene            640097..693367
FT                   /gene="Sspo"
FT                   /locus_tag="mCG_145751"
FT                   /note="gene_id=mCG145751.0"
FT   mRNA            join(640097..640149,640368..640550,640977..641059,
FT                   641236..641337,642872..643090,643208..643287,
FT                   643603..643755,644033..644204,644333..644573,
FT                   644805..644949,645846..645963,646554..646729,
FT                   646809..647033,647180..647345,647538..647772,
FT                   648844..649033,649140..649234,649442..649698,
FT                   649976..650110,650840..651031,651410..651569,
FT                   651660..651769,652096..652245,652339..652432,
FT                   652516..652685,652910..653143,653610..653831,
FT                   654252..654488,655446..655537,655615..655846,
FT                   655998..656150,656407..656547,656617..656751,
FT                   656929..657079,657595..657748,657872..657926,
FT                   658374..658484,658760..658954,659042..659169,
FT                   659683..659833,659922..660075,660560..660621,
FT                   662458..662676,662963..663106,664479..664649,
FT                   664734..664898,665467..665646,665747..665869,
FT                   665950..666079,666235..666360,666517..666608,
FT                   667443..667616,667873..668037,668558..668807,
FT                   669825..669871,670021..670191,670517..670648,
FT                   670861..671006,671709..671803,672654..672706,
FT                   672870..673076,673209..673379,673487..673566,
FT                   674902..675071,675543..675589,675690..675881,
FT                   676000..676170,676400..676600,676882..676978,
FT                   677074..677273,677562..677728,678548..678708,
FT                   678849..679072,679291..679332,679473..679628,
FT                   680150..680359,680563..680730,681930..682061,
FT                   682157..682403,682635..682787,682862..682908,
FT                   683050..683394,683641..683808,684330..684460,
FT                   684715..684839,685095..685141,685374..685652,
FT                   685977..686135,686304..686420,687056..687194,
FT                   687340..687542,688368..688495,688612..688754,
FT                   688851..688897,689607..689815,690357..690452,
FT                   690579..690639,690891..691021,692615..692765,
FT                   693311..693367)
FT                   /gene="Sspo"
FT                   /locus_tag="mCG_145751"
FT                   /product="SCO-spondin"
FT                   /note="gene_id=mCG145751.0 transcript_id=mCT185740.0
FT                   created on 13-JUN-2003"
FT   CDS             join(640100..640149,640368..640550,640977..641059,
FT                   641236..641337,642872..643090,643208..643287,
FT                   643603..643755,644033..644204,644333..644573,
FT                   644805..644949,645846..645963,646554..646729,
FT                   646809..647033,647180..647345,647538..647772,
FT                   648844..649033,649140..649234,649442..649698,
FT                   649976..650110,650840..651031,651410..651569,
FT                   651660..651769,652096..652245,652339..652432,
FT                   652516..652685,652910..653143,653610..653831,
FT                   654252..654488,655446..655537,655615..655846,
FT                   655998..656150,656407..656547,656617..656751,
FT                   656929..657079,657595..657748,657872..657926,
FT                   658374..658484,658760..658954,659042..659169,
FT                   659683..659833,659922..660075,660560..660621,
FT                   662458..662676,662963..663106,664479..664649,
FT                   664734..664898,665467..665646,665747..665869,
FT                   665950..666079,666235..666360,666517..666608,
FT                   667443..667616,667873..668037,668558..668807,
FT                   669825..669871,670021..670191,670517..670648,
FT                   670861..671006,671709..671803,672654..672706,
FT                   672870..673076,673209..673379,673487..673566,
FT                   674902..675071,675543..675589,675690..675881,
FT                   676000..676170,676400..676600,676882..676978,
FT                   677074..677273,677562..677728,678548..678708,
FT                   678849..679072,679291..679332,679473..679628,
FT                   680150..680359,680563..680730,681930..682061,
FT                   682157..682403,682635..682787,682862..682908,
FT                   683050..683394,683641..683808,684330..684460,
FT                   684715..684839,685095..685141,685374..685652,
FT                   685977..686135,686304..686420,687056..687194,
FT                   687340..687542,688368..688495,688612..688754,
FT                   688851..688897,689607..689815,690357..690452,
FT                   690579..690639,690891..691021,692615..692765,
FT                   693311..693333)
FT                   /codon_start=1
FT                   /gene="Sspo"
FT                   /locus_tag="mCG_145751"
FT                   /product="SCO-spondin"
FT                   /note="gene_id=mCG145751.0 transcript_id=mCT185740.0
FT                   protein_id=mCP106998.0"
FT                   /protein_id="EDK98531.1"
FT                   /translation="MLPLALLFGMLWTQANGHWCEQIETVHVEEEVTPRQEDLVPCTSL
FT                   YHYSRLGWQLDLSWSGRVGLTRPPALGLCAIYKPPETRPATWNRTVRACCPGWGGAHCT
FT                   DALAETSPKGHCFVTWHCQPLAGSANSSAGSLEECYPADELGVWPLTLNDPIHFPGMSL
FT                   QWQGDWLVLSGGLGVVVRLDRSSSISISVDHEFWGRTQGLCGLYNGRPEDDFVEPGGGL
FT                   ATLAATFGNSWKLPGSEPGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLE
FT                   GPFWQCHGQVQPDEYHETCLFAYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVH
FT                   WRKPGFCERVCPGGQLYSDCVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGAL
FT                   CVPAAHCPCYHRRQRYAPGDTVKQQCNPCVCQDGRWHCAQALCPAECAVGGDGHYFTFD
FT                   GRSFFFRGTPGCHYSLVQDSVKGQLLVVLEHGACDTGSCLHALSVFLGNTHIQLRYSGA
FT                   VLVDGEDVDLPWIGVEGFNISWASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQ
FT                   GLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTS
FT                   AEAACAILHGHAFQECHGLVDREPFRLRCLEAVCGCAPGRDCLCPVLSAYTRHCAQEGV
FT                   LLQWRNETLCPVSCPGGQVYQECAPVCGHHCGEPEDCKELGICVAGCNCPPGLLWDLEG
FT                   QCVPPSMCHCQFGGHRYTINTTTVRDCSHCICQERGLWNCTAHHCPRQWALCPRELIYV
FT                   PGACLLTCDSPRANHSCWAGSTDGCVCPPGTVLLDKHCVSPDLCPCRHNGQWYPPNATI
FT                   QEDCNICVCQGQRWHCTGQRCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVREAGGRF
FT                   SVSVQNLPCGASGLTCTKALVVRLDSTVVHMLRGQAVTVNGVSIRLPKVYTGPGLSLHH
FT                   AGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVAGLCGNFDSDASNDLRSRQGVLEP
FT                   TAELTAHSWRLNPLCPEPGDLPHPWREIHKSTVLQVNAHRANWARARCEVILQPIFAPC
FT                   HTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQC
FT                   EGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCE
FT                   WQGSFFPPGTVLQKDCGNCTCQGSQWHCDRGGAPCEDMEPGCAEGETLCRENGHCVPLE
FT                   WLCDNQDDCGDGSDEEGCATSVCGEGQMSCQSGHCLPLSLICDGQDDCGDGTDEQGCLC
FT                   PHGSLACADGRCLPPALLCNGHPDCLDAADEESCLGPVSCISGEVSCVDGTCVRTIQLC
FT                   DGVWDCPDGADEGPSHCSLPSLPTPPGGIGQNPSTSSLDTAPSPVGSTSPASPCSLLEF
FT                   QCNSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCVSPGQLCDGVTQC
FT                   PDGSDEDPDVCEEQSASGGANRTGAPCPEFSCPDGTCIDFLLVCDGNPDCELADETEPS
FT                   LDEQGCGAWGSWGPWAPCSQTCGSGTRSRNRNCSTSSLQVLQNCPGLQHQSQACFTEAC
FT                   PVDGEWSSWSPWSPCSEPCGGTTTRHRQCRPPQNGGQDCALLPGSTHSTRQTSPCPQEG
FT                   CLNATCFGELVFRTCAPCPLTCDDISGQAACPPDRPCSSPGCWCPDGKVLNTEGQCVRP
FT                   RQCPCLVDGAHYWPGQRIKMDCQLCFLDCGWSSWSPWAECLGPCSSQSLQWSFRSPNNP
FT                   RLSGHGRQCRGIHRKARRCQTEACEGCEQWGLMYNVGERWRGGPCMVCECLHSSITHCS
FT                   PYCPIGSCPQGWVLVEGMGESCCHCALPEKNQTVIHMTTPAPAPASAPSPQIGAHLVTY
FT                   VLPPTADACYSPLGLAGLPMWAPSQHWEHITRADPVEAPMAGPGPREGASAEWHTQPLY
FT                   LQLDLRRPRNLTGIIVQRAGSSAAYVSTLSLQFSSDNLQWHNYVNSLSSTLSPPKPSPE
FT                   SSNHMAPEVWTFDQMVQARYIRVWPHSGHLRDNNQHDIFLWVELLGLSPLAPLCPGSRH
FT                   RCASGECAPKGGPCDGAVDCDDGSDEEGCGSLHASTTSRTPALSPTQPGKFPREVSEDL
FT                   RQGAEAMTSHSPPSSGETAGLIPASEGTLPVSGQPMQTLSATSTFPPGAKSLHPGMAAV
FT                   TVHPPHSVTPGAPVGQTVSPRPFPPMPCGPGQVPCDVLGCVEQEQLCDGREDCLDGSDE
FT                   QHCASAEPFTVPTTALPGLPASKALCSPSQLRCGSGECLPFEHRCDLQVNCQDGSDEDN
FT                   CVDCVLAPWSGWSDCSRSCGLGLIFQHRELLRLPLPGGSCLLDQFRSQSCFVQACPVAG
FT                   AWAEWGPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTDC
FT                   EPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPGLLLQDSHCLPLSE
FT                   CPCLVGQKLIQPRLAFLLDNCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGS
FT                   GVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTEIPGWTPWTSWSSCSQSCLVPG
FT                   GDPGWRQRSRLCPSSRDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQ
FT                   TRGRSCSGSAPGNPVCLGPHTQTRDCNMHPCTAQCPGNMVFRSAEQCLEEGGPCPQLCL
FT                   AQDPGVECTGSCAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVAHLDCNNCTC
FT                   ISGEMVCTSKRCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTAPPAAFGGAECQGPNL
FT                   DAEFCSLRPCRGPGAAWSSWTPCSVPCGGGYRNRTQGSGPHSPIEFSTCSLQPCAGPVP
FT                   GVCPEDQQWLDCAQGPASCAHLSIPGEANQTCHPGCYCLSGMLLLNNVCVPVQDCPCAH
FT                   RGRLYSPGSAVHLPCENCSCISGLITNCSSWPCEEGQPAWSSWTPWSVCSASCNPARRH
FT                   RHRFCARPPHRAPFSLVLLTTVAAPTTLCPGPEAEEEPCLLPGCNQAGGWSPWSPWSGC
FT                   SRSCGGGLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPVTNCSAMEGAEYSPCG
FT                   PPCPRSCDDLVHCVWRCQPGCYCPLGKVLSADGAICVKPSYCSCLDLLTGKRHHAGTQL
FT                   MRPDGCNHCTCMEGRLNCTDLPCQVSGDWCPWSEWTACSQPCRGQTRTRSRACVCPAPQ
FT                   HGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDACLGQSYRSRVCSHP
FT                   PISDGGKPCLGGYQQSRPCRNSSTLCTDCGGGQDLLPCGQPCPHSCQDLSLGSTCQPGS
FT                   AGCQSGCGCPPGQLSQDGLCVFPVDCHCHFQPRAMGIPENRSRSVGSTLSSWESLEPGE
FT                   VVTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCGGGEQLRSRQCARPPC
FT                   PGLAQQSRICHIHVCRETGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEGCHC
FT                   PEGTFQHHVACVQECPCVLTVLLLQELGLASAALGSYPTLLGDEGKPLGPGVELLPGQM
FT                   LQTDCGNCSCVHGKLSCSMVECSRVHGSFGPWGMWSLCSRSCGGLGTRTRTRQCVLPTL
FT                   APGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLAGGWGPWSPWSPCSHSCTDPAHP
FT                   AWRSRTRLCLANCTVGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRS
FT                   CGVGQQRRLRAYHPPGPGGHWCPDILTAYQERRFCNLRACPVPGGWSHWSPWSWCDRSC
FT                   GGGRSLRSRSCSSPPPKNGGTSCVGERHHVRPCNPMPCEEGCPAGMEMVSCANHCPYSC
FT                   SDLQEGGMCQEDQACQLGCRCSEGFLEQDGGCVPVGHCECTDAQGRSWAPGSQHQDACN
FT                   NCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQSRFRSSTSGSWALECQ
FT                   KEQSQSQPCPEVPCPPLCLHEAHLHELGDNWLHGECQQCSCTPEGAICKDTDCAVPGGW
FT                   TLWSSWSYCSVSCGGGSQVRTRSCTVSAPPHGSLSCEGPDTQTRHCGQQLCLQKLERCS
FT                   WGPWGPCSRSCGTGLASRSGSCPCLLTKEDSKCNDTFLGLDTQACYSGPCQDDCTWGDW
FT                   SSWTRCSCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQ
FT                   SCGSPCAGLCATHLNHRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNCWHISGEGAR
FT                   VTLAPGDRLQLGCKECVCRRGELQCSSQGCEGLLPLTGWSEWSPCGPCLPQSALAPASR
FT                   TALEGHWPLNTSDLPPPSVTLLASEQYRHRLCLDPETRRPWAGDPALCTVPLSQQRLCP
FT                   DPGACNDTCQWGPWGPWSPCQMPCSGGFKLRWRVARDTSAGECPGPWAQTESCNMGSCP
FT                   GESCETRDTVFTLDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISS
FT                   CRCGLPSANASWELAPTQVVQLDCHNCTCINGTLMCPHLECPVLGPWSAWSECSAVCGK
FT                   GTMVRHRSCEEHPDREPCQALDLQQWQECNLQACPECPPGQVLSTCATMCPSLCSHLWP
FT                   GTICVREPCQLGCGCPGGQLLYNGTCIPPEACPCTQFSLPWGLTLPLEEQARELPSGTV
FT                   LTRNCTHCTCQGGAFICSLTDCQECAPGEIWQHGKLGPCEKTCPEMNMTQAWSNCTEAQ
FT                   APGCVCQLGYFRSQTGLCVPEDHCECWHHGSPHLPGSEWQEACESCRCLHGKSICIRHC
FT                   PELSCAQGEVIMQEPGSCCPICQQDTLKEEPVSCRYLTELRNLTKGPCHLDQIEVSYCS
FT                   GHCRSSTNVMTEEPYLQSQCDCCSYRLDPDSPVRILNLLCPDGHTEPVVLPVIHSCQCS
FT                   ACQGGDFSKH"
FT   gap             651136..651155
FT                   /estimated_length=20
FT   gap             693369..695774
FT                   /estimated_length=2406
FT   gene            <695845..730995
FT                   /locus_tag="mCG_1036748"
FT                   /note="gene_id=mCG1036748.2"
FT   mRNA            join(<695845..696055,700291..700402,703834..704531,
FT                   706171..706345,707256..707375,722699..722797,
FT                   725936..726040,730524..730995)
FT                   /locus_tag="mCG_1036748"
FT                   /product="mCG1036748"
FT                   /note="gene_id=mCG1036748.2 transcript_id=mCT154452.2
FT                   created on 13-JUN-2003"
FT   gap             698828..698847
FT                   /estimated_length=20
FT   CDS             join(<703875..704531,706171..706345,707256..707375,
FT                   722699..722797,725936..726040,730524..730615)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036748"
FT                   /product="mCG1036748"
FT                   /note="gene_id=mCG1036748.2 transcript_id=mCT154452.2
FT                   protein_id=mCP61358.2"
FT                   /protein_id="EDK98532.1"
FT                   /translation="GSTREKGQYLPLQKESCRAHFSTESSTTGEDWTGGNKKLPKPRSI
FT                   QKSWFTKFPWLIVNEEQAALFWAVCREYSSVKDRRSQLIEGYTAPFKVETLKYHAKSKA
FT                   HIFCVNALAAKDPIWAARLQCLRESPADILASPEHLLTADDPTLYLPGPLGDFDGLDEL
FT                   LSSPRAEPEDASGSGAIPALYLDCESDLRQKEIGSDILGPSNSSTLFKDSIDFCSQEPP
FT                   DKEWAKASRTAGELPATFEDLAVCFSREEWSLLDKQQKELYRDGMQMSYELLASLVCMN
FT                   VLSACVSVYHVFIVLVETRRGIASPGTGVTDSCELPCPPAAPARCGFSGFSSPAFPSAI
FT                   FLAAASPCSPEPPAAKPDLITKLEQRAAPWIKDPDGLKPGKSPSLDLGPRKEGMAGPCK
FT                   EDSMAQKTSIMPSGEP"
FT   gap             712092..715281
FT                   /estimated_length=3190
FT   gene            complement(715870..716293)
FT                   /locus_tag="mCG_1036414"
FT                   /note="gene_id=mCG1036414.1"
FT   mRNA            complement(715870..716293)
FT                   /locus_tag="mCG_1036414"
FT                   /product="mCG1036414"
FT                   /note="gene_id=mCG1036414.1 transcript_id=mCT154118.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(715905..716237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036414"
FT                   /product="mCG1036414"
FT                   /note="gene_id=mCG1036414.1 transcript_id=mCT154118.1
FT                   protein_id=mCP61969.0"
FT                   /db_xref="GOA:Q6ZWX1"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWX1"
FT                   /protein_id="EDK98533.1"
FT                   /translation="MSGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGK
FT                   RCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVM
FT                   LYPSRI"
FT   gap             717283..717302
FT                   /estimated_length=20
FT   gene            <721133..722086
FT                   /locus_tag="mCG_128032"
FT                   /note="gene_id=mCG128032.1"
FT   mRNA            <721133..722086
FT                   /locus_tag="mCG_128032"
FT                   /product="mCG128032"
FT                   /note="gene_id=mCG128032.1 transcript_id=mCT129323.1
FT                   created on 05-AUG-2002"
FT   CDS             <721133..721525
FT                   /codon_start=1
FT                   /locus_tag="mCG_128032"
FT                   /product="mCG128032"
FT                   /note="gene_id=mCG128032.1 transcript_id=mCT129323.1
FT                   protein_id=mCP61186.1"
FT                   /protein_id="EDK98534.1"
FT                   /translation="SFRHLGACGGLLGTGLLTASMSGRLWCKAIFAGYKRGLRNQREHT
FT                   ALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMV
FT                   RAKFRSNLPAKAIGHRIRVMLYPSRI"
FT   gene            complement(721600..722799)
FT                   /locus_tag="mCG_1036415"
FT                   /note="gene_id=mCG1036415.1"
FT   mRNA            complement(721600..722799)
FT                   /locus_tag="mCG_1036415"
FT                   /product="mCG1036415"
FT                   /note="gene_id=mCG1036415.1 transcript_id=mCT154119.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(722229..722765)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036415"
FT                   /product="mCG1036415"
FT                   /note="gene_id=mCG1036415.1 transcript_id=mCT154119.1
FT                   protein_id=mCP61991.0"
FT                   /protein_id="EDK98535.1"
FT                   /translation="MADGKAGEEKPEKPQRAGAAGGPEEEAEKPVKTKTVSSSNGGESS
FT                   SRSAEKRSAEDEAADLPTKPTKMSKFGFAIGSQTARKASAISIRLGASKPKETVPTLAP
FT                   KTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSSNKGKHGFSDNQKLWE
FT                   RNIKSHLGNVHDQDN"
FT   gap             723526..723545
FT                   /estimated_length=20
FT   gene            complement(732386..>733323)
FT                   /locus_tag="mCG_1036749"
FT                   /note="gene_id=mCG1036749.1"
FT   mRNA            complement(join(732386..732988,733229..>733323))
FT                   /locus_tag="mCG_1036749"
FT                   /product="mCG1036749"
FT                   /note="gene_id=mCG1036749.1 transcript_id=mCT154453.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(732789..732988,733229..>733322))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036749"
FT                   /product="mCG1036749"
FT                   /note="gene_id=mCG1036749.1 transcript_id=mCT154453.1
FT                   protein_id=mCP61387.1"
FT                   /protein_id="EDK98536.1"
FT                   /translation="KVKFCFIQIAKVKIGTWFLNLICSSLKAGAQMETCYQARGGIQAR
FT                   KYTRLEQAGVRGVVQAFTPAPGRQRHVDLCEFKLAHIHSKFQGSRGGIETVR"
FT   gene            complement(735073..>735970)
FT                   /locus_tag="mCG_140823"
FT                   /note="gene_id=mCG140823.0"
FT   mRNA            complement(join(735073..735231,735331..>735970))
FT                   /locus_tag="mCG_140823"
FT                   /product="mCG140823"
FT                   /note="gene_id=mCG140823.0 transcript_id=mCT171690.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(735694..>735969)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140823"
FT                   /product="mCG140823"
FT                   /note="gene_id=mCG140823.0 transcript_id=mCT171690.0
FT                   protein_id=mCP94609.0"
FT                   /protein_id="EDK98537.1"
FT                   /translation="SFLFSLESGRSLAVLGQPKVAGDRIGGDPNQNGGFVGTTGVSTRG
FT                   LRGAERPQTWPELKPPLSEVKLAVLCRAHCFTEPWRCPASGSGYSS"
FT   gene            736121..740329
FT                   /gene="Atp6v0e2"
FT                   /locus_tag="mCG_128051"
FT                   /note="gene_id=mCG128051.1"
FT   mRNA            join(736121..736360,737755..737802,738571..738697,
FT                   738959..740329)
FT                   /gene="Atp6v0e2"
FT                   /locus_tag="mCG_128051"
FT                   /product="ATPase, H+ transporting, lysosomal V0 subunit E2,
FT                   transcript variant mCT129344"
FT                   /note="gene_id=mCG128051.1 transcript_id=mCT129344.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(736121..736360,737755..737802,738959..740326)
FT                   /gene="Atp6v0e2"
FT                   /locus_tag="mCG_128051"
FT                   /product="ATPase, H+ transporting, lysosomal V0 subunit E2,
FT                   transcript variant mCT171678"
FT                   /note="gene_id=mCG128051.1 transcript_id=mCT171678.0
FT                   created on 05-AUG-2002"
FT   CDS             join(736257..736360,737755..737802,738959..739205)
FT                   /codon_start=1
FT                   /gene="Atp6v0e2"
FT                   /locus_tag="mCG_128051"
FT                   /product="ATPase, H+ transporting, lysosomal V0 subunit E2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG128051.1 transcript_id=mCT171678.0
FT                   protein_id=mCP94597.0 isoform=CRA_b"
FT                   /protein_id="EDK98539.1"
FT                   /translation="MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATA
FT                   VCCYLLCPAVKGEWPSLDVPGDPAFPLAPPICMTILCSPCHHAVESITPRANLVSVSGL
FT                   SFPLCSQLLAALHVGQAPCSVRPQWELT"
FT   CDS             join(736257..736360,737755..737802,738571..738664)
FT                   /codon_start=1
FT                   /gene="Atp6v0e2"
FT                   /locus_tag="mCG_128051"
FT                   /product="ATPase, H+ transporting, lysosomal V0 subunit E2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG128051.1 transcript_id=mCT129344.1
FT                   protein_id=mCP61427.1 isoform=CRA_a"
FT                   /protein_id="EDK98538.1"
FT                   /translation="MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATA
FT                   VCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE"
FT   gene            753366..769559
FT                   /gene="Lrrc61"
FT                   /locus_tag="mCG_128045"
FT                   /note="gene_id=mCG128045.2"
FT   mRNA            join(753366..753464,755526..755665,766649..>767536)
FT                   /gene="Lrrc61"
FT                   /locus_tag="mCG_128045"
FT                   /product="leucine rich repeat containing 61, transcript
FT                   variant mCT129336"
FT                   /note="gene_id=mCG128045.2 transcript_id=mCT129336.0
FT                   created on 17-JUN-2003"
FT   mRNA            join(753367..753553,755526..755665,766649..767641,
FT                   768012..769559)
FT                   /gene="Lrrc61"
FT                   /locus_tag="mCG_128045"
FT                   /product="leucine rich repeat containing 61, transcript
FT                   variant mCT171675"
FT                   /note="gene_id=mCG128045.2 transcript_id=mCT171675.1
FT                   created on 17-JUN-2003"
FT   mRNA            join(753367..753532,766649..>767536)
FT                   /gene="Lrrc61"
FT                   /locus_tag="mCG_128045"
FT                   /product="leucine rich repeat containing 61, transcript
FT                   variant mCT171674"
FT                   /note="gene_id=mCG128045.2 transcript_id=mCT171674.0
FT                   created on 17-JUN-2003"
FT   CDS             766757..767536
FT                   /codon_start=1
FT                   /gene="Lrrc61"
FT                   /locus_tag="mCG_128045"
FT                   /product="leucine rich repeat containing 61, isoform CRA_a"
FT                   /note="gene_id=mCG128045.2 transcript_id=mCT171674.0
FT                   protein_id=mCP94594.0 isoform=CRA_a"
FT                   /protein_id="EDK98540.1"
FT                   /translation="MEPPGEKPGEAEALSITPQLLKSHSGEFALDSILLLKLRGLGVVD
FT                   LGCLGECLNLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLAACENLQSLNA
FT                   AGNLLTTPGQLQCLAGLQALEHLRLRDPLARLSNPLCANASYWAVVQELLPGLKVIDGE
FT                   RVSGRGSELYQLCRDLDSSLRSGSSPGPRAIEAQPWVEPGYWESWPIRSSSILEEACRQ
FT                   FQDTLQECLDLDRQASDSLAQAQQALSPAETTSSFVF"
FT   CDS             766757..767536
FT                   /codon_start=1
FT                   /gene="Lrrc61"
FT                   /locus_tag="mCG_128045"
FT                   /product="leucine rich repeat containing 61, isoform CRA_a"
FT                   /note="gene_id=mCG128045.2 transcript_id=mCT171675.1
FT                   protein_id=mCP94593.0 isoform=CRA_a"
FT                   /protein_id="EDK98541.1"
FT                   /translation="MEPPGEKPGEAEALSITPQLLKSHSGEFALDSILLLKLRGLGVVD
FT                   LGCLGECLNLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLAACENLQSLNA
FT                   AGNLLTTPGQLQCLAGLQALEHLRLRDPLARLSNPLCANASYWAVVQELLPGLKVIDGE
FT                   RVSGRGSELYQLCRDLDSSLRSGSSPGPRAIEAQPWVEPGYWESWPIRSSSILEEACRQ
FT                   FQDTLQECLDLDRQASDSLAQAQQALSPAETTSSFVF"
FT   CDS             766757..767536
FT                   /codon_start=1
FT                   /gene="Lrrc61"
FT                   /locus_tag="mCG_128045"
FT                   /product="leucine rich repeat containing 61, isoform CRA_a"
FT                   /note="gene_id=mCG128045.2 transcript_id=mCT129336.0
FT                   protein_id=mCP62034.1 isoform=CRA_a"
FT                   /protein_id="EDK98542.1"
FT                   /translation="MEPPGEKPGEAEALSITPQLLKSHSGEFALDSILLLKLRGLGVVD
FT                   LGCLGECLNLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLAACENLQSLNA
FT                   AGNLLTTPGQLQCLAGLQALEHLRLRDPLARLSNPLCANASYWAVVQELLPGLKVIDGE
FT                   RVSGRGSELYQLCRDLDSSLRSGSSPGPRAIEAQPWVEPGYWESWPIRSSSILEEACRQ
FT                   FQDTLQECLDLDRQASDSLAQAQQALSPAETTSSFVF"
FT   gap             767824..767843
FT                   /estimated_length=20
FT   gene            complement(768530..771630)
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /note="gene_id=mCG128052.1"
FT   mRNA            complement(join(768530..768643,768779..768897,
FT                   769082..769177,770621..770725,770926..771128,
FT                   771578..771630))
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /product="retinoic acid receptor responder (tazarotene
FT                   induced) 2, transcript variant mCT171679"
FT                   /note="gene_id=mCG128052.1 transcript_id=mCT171679.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(768530..768643,768779..768897,
FT                   769082..769177,770621..770715,770919..771128,
FT                   771432..771539))
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /product="retinoic acid receptor responder (tazarotene
FT                   induced) 2, transcript variant mCT129345"
FT                   /note="gene_id=mCG128052.1 transcript_id=mCT129345.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(768536..768643,768779..768897,
FT                   769082..769177,770621..770725,770926..771128,
FT                   771432..>771509))
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /product="retinoic acid receptor responder (tazarotene
FT                   induced) 2, transcript variant mCT189083"
FT                   /note="gene_id=mCG128052.1 transcript_id=mCT189083.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(768536..768643,768779..771128,
FT                   771432..>771484))
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /product="retinoic acid receptor responder (tazarotene
FT                   induced) 2, transcript variant mCT189082"
FT                   /note="gene_id=mCG128052.1 transcript_id=mCT189082.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(768790..768897,769082..769177,
FT                   770621..770725,770926..>771114))
FT                   /codon_start=1
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /product="retinoic acid receptor responder (tazarotene
FT                   induced) 2, isoform CRA_b"
FT                   /note="gene_id=mCG128052.1 transcript_id=mCT189083.0
FT                   protein_id=mCP110066.0 isoform=CRA_b"
FT                   /protein_id="EDK98544.1"
FT                   /translation="GEAMKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKH
FT                   PPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCL
FT                   ACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALR
FT                   TK"
FT   CDS             complement(join(768790..768897,769082..769177,
FT                   770621..770725,770926..771105))
FT                   /codon_start=1
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /product="retinoic acid receptor responder (tazarotene
FT                   induced) 2, isoform CRA_d"
FT                   /note="gene_id=mCG128052.1 transcript_id=mCT171679.0
FT                   protein_id=mCP94598.0 isoform=CRA_d"
FT                   /protein_id="EDK98546.1"
FT                   /translation="MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPV
FT                   QLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACI
FT                   KMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALRTK"
FT   CDS             complement(join(768790..768897,769082..769177,
FT                   770621..770715,770919..771105))
FT                   /codon_start=1
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /product="retinoic acid receptor responder (tazarotene
FT                   induced) 2, isoform CRA_c"
FT                   /note="gene_id=mCG128052.1 transcript_id=mCT129345.1
FT                   protein_id=mCP61456.1 isoform=CRA_c"
FT                   /protein_id="EDK98545.1"
FT                   /translation="MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPV
FT                   QLAFQEIGVDRAEEVVSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIK
FT                   MDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALRTK"
FT   CDS             complement(770387..>770725)
FT                   /codon_start=1
FT                   /gene="Rarres2"
FT                   /locus_tag="mCG_128052"
FT                   /product="retinoic acid receptor responder (tazarotene
FT                   induced) 2, isoform CRA_a"
FT                   /note="gene_id=mCG128052.1 transcript_id=mCT189082.0
FT                   protein_id=mCP110065.0 isoform=CRA_a"
FT                   /protein_id="EDK98543.1"
FT                   /translation="LFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGVSKGFLLMGQ
FT                   AARKGTRVQGSAVPITRDCLQGGEGEGKREISPSEWVLLKKLLYGVYPVFWPRYTQFTE
FT                   GFHSNQSP"
FT   gene            788248..789375
FT                   /gene="A630038D02"
FT                   /locus_tag="mCG_146888"
FT                   /note="gene_id=mCG146888.0"
FT   mRNA            join(788248..788498,788662..789375)
FT                   /gene="A630038D02"
FT                   /locus_tag="mCG_146888"
FT                   /product="hypothetical protein A630038D02"
FT                   /note="gene_id=mCG146888.0 transcript_id=mCT187151.0
FT                   created on 13-JAN-2004"
FT   CDS             join(788481..788498,788662..789216)
FT                   /codon_start=1
FT                   /gene="A630038D02"
FT                   /locus_tag="mCG_146888"
FT                   /product="hypothetical protein A630038D02"
FT                   /note="gene_id=mCG146888.0 transcript_id=mCT187151.0
FT                   protein_id=mCP109102.0"
FT                   /db_xref="GOA:Q8C9M4"
FT                   /db_xref="MGI:MGI:3645688"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9M4"
FT                   /protein_id="EDK98547.1"
FT                   /translation="MLTIGKSLALQPQLTSNLRSSCLGPLNAKIIDVCCHSSPPSLLSF
FT                   VTKYLQLRNLQGKRLTLAQHPEDREVQDVTSGKDHIEFHNVVELKRHAWKRKHKRYPCF
FT                   VTTCFHENQPCPVGKALISLSTAQPSLKSPITRLLHLPPSLLSMQDLDLAVSVSFRRSQ
FT                   TSLLTLDLLQLFGASVENFLSSVSTNS"
FT   gene            792676..796952
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /note="gene_id=mCG128036.1"
FT   mRNA            join(792676..792846,793585..793770,795088..796952)
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /product="replication initiator 1, transcript variant
FT                   mCT129327"
FT                   /note="gene_id=mCG128036.1 transcript_id=mCT129327.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(792676..792846,793656..793770,795088..796952)
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /product="replication initiator 1, transcript variant
FT                   mCT171664"
FT                   /note="gene_id=mCG128036.1 transcript_id=mCT171664.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(792676..792846,795088..796952)
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /product="replication initiator 1, transcript variant
FT                   mCT171666"
FT                   /note="gene_id=mCG128036.1 transcript_id=mCT171666.0
FT                   created on 05-AUG-2002"
FT   CDS             join(792808..792846,793656..793770,795088..796739)
FT                   /codon_start=1
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /product="replication initiator 1, isoform CRA_b"
FT                   /note="gene_id=mCG128036.1 transcript_id=mCT171664.0
FT                   protein_id=mCP94583.0 isoform=CRA_b"
FT                   /protein_id="EDK98549.1"
FT                   /translation="MDGRCVPGGHAGEFSLSSGGYRSVGRSSRSLPRNIPRRSWKKPHP
FT                   QLFSLQAEEEPMLEQRCRGPTAMGPAQPWLFSGPSQESSQPDRGLRYQGKSAQPRGQTP
FT                   GKVHRCAHCRKRFPGWVALWLHARRCQARLPLPCHECNQRFRHAPFLALHLQVHASAVP
FT                   DLGFICHLCGHSFRGWVALVLHLRAHSASKRPITCPECDRRFWRQKQLRAHLRRCQPPV
FT                   PEARPFICGNCGRSFAQWDQLVVHKRVHVAEALEEAAAKALGPRPRGRPAAPRPGGDAV
FT                   DRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKP
FT                   YPCTECGRRFRHKPNLLSHSKIHKRLEVSAQAAPHPESHQIAAEPMAQPALGVPLGSPR
FT                   TPAEAPALLHSCSDCGRSFRLERFLRLHQRQHTGERPFACTECGKNFGKKTHLVAHSRV
FT                   HSGERPFACEECGRRFSQGSHLAAHRRDHAPERPFVCPDCGKAFRHKPYLAAHRRIHTG
FT                   EKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGA
FT                   FCCAICGQTFDDEDRLLMHQKKHDA"
FT   mRNA            join(793113..793770,795088..796952)
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /product="replication initiator 1, transcript variant
FT                   mCT171665"
FT                   /note="gene_id=mCG128036.1 transcript_id=mCT171665.0
FT                   created on 05-AUG-2002"
FT   CDS             join(793626..793770,795088..796739)
FT                   /codon_start=1
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /product="replication initiator 1, isoform CRA_a"
FT                   /note="gene_id=mCG128036.1 transcript_id=mCT129327.1
FT                   protein_id=mCP61243.1 isoform=CRA_a"
FT                   /protein_id="EDK98548.1"
FT                   /translation="MGIGMSLLLQFSLSSGGYRSVGRSSRSLPRNIPRRSWKKPHPQLF
FT                   SLQAEEEPMLEQRCRGPTAMGPAQPWLFSGPSQESSQPDRGLRYQGKSAQPRGQTPGKV
FT                   HRCAHCRKRFPGWVALWLHARRCQARLPLPCHECNQRFRHAPFLALHLQVHASAVPDLG
FT                   FICHLCGHSFRGWVALVLHLRAHSASKRPITCPECDRRFWRQKQLRAHLRRCQPPVPEA
FT                   RPFICGNCGRSFAQWDQLVVHKRVHVAEALEEAAAKALGPRPRGRPAAPRPGGDAVDRP
FT                   FQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPC
FT                   TECGRRFRHKPNLLSHSKIHKRLEVSAQAAPHPESHQIAAEPMAQPALGVPLGSPRTPA
FT                   EAPALLHSCSDCGRSFRLERFLRLHQRQHTGERPFACTECGKNFGKKTHLVAHSRVHSG
FT                   ERPFACEECGRRFSQGSHLAAHRRDHAPERPFVCPDCGKAFRHKPYLAAHRRIHTGEKP
FT                   YVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCC
FT                   AICGQTFDDEDRLLMHQKKHDA"
FT   CDS             join(793626..793770,795088..796739)
FT                   /codon_start=1
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /product="replication initiator 1, isoform CRA_a"
FT                   /note="gene_id=mCG128036.1 transcript_id=mCT171665.0
FT                   protein_id=mCP94585.0 isoform=CRA_a"
FT                   /protein_id="EDK98550.1"
FT                   /translation="MGIGMSLLLQFSLSSGGYRSVGRSSRSLPRNIPRRSWKKPHPQLF
FT                   SLQAEEEPMLEQRCRGPTAMGPAQPWLFSGPSQESSQPDRGLRYQGKSAQPRGQTPGKV
FT                   HRCAHCRKRFPGWVALWLHARRCQARLPLPCHECNQRFRHAPFLALHLQVHASAVPDLG
FT                   FICHLCGHSFRGWVALVLHLRAHSASKRPITCPECDRRFWRQKQLRAHLRRCQPPVPEA
FT                   RPFICGNCGRSFAQWDQLVVHKRVHVAEALEEAAAKALGPRPRGRPAAPRPGGDAVDRP
FT                   FQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPC
FT                   TECGRRFRHKPNLLSHSKIHKRLEVSAQAAPHPESHQIAAEPMAQPALGVPLGSPRTPA
FT                   EAPALLHSCSDCGRSFRLERFLRLHQRQHTGERPFACTECGKNFGKKTHLVAHSRVHSG
FT                   ERPFACEECGRRFSQGSHLAAHRRDHAPERPFVCPDCGKAFRHKPYLAAHRRIHTGEKP
FT                   YVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCC
FT                   AICGQTFDDEDRLLMHQKKHDA"
FT   CDS             795102..796739
FT                   /codon_start=1
FT                   /gene="Repin1"
FT                   /locus_tag="mCG_128036"
FT                   /product="replication initiator 1, isoform CRA_c"
FT                   /note="gene_id=mCG128036.1 transcript_id=mCT171666.0
FT                   protein_id=mCP94584.0 isoform=CRA_c"
FT                   /protein_id="EDK98551.1"
FT                   /translation="MLEQRCRGPTAMGPAQPWLFSGPSQESSQPDRGLRYQGKSAQPRG
FT                   QTPGKVHRCAHCRKRFPGWVALWLHARRCQARLPLPCHECNQRFRHAPFLALHLQVHAS
FT                   AVPDLGFICHLCGHSFRGWVALVLHLRAHSASKRPITCPECDRRFWRQKQLRAHLRRCQ
FT                   PPVPEARPFICGNCGRSFAQWDQLVVHKRVHVAEALEEAAAKALGPRPRGRPAAPRPGG
FT                   DAVDRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTG
FT                   EKPYPCTECGRRFRHKPNLLSHSKIHKRLEVSAQAAPHPESHQIAAEPMAQPALGVPLG
FT                   SPRTPAEAPALLHSCSDCGRSFRLERFLRLHQRQHTGERPFACTECGKNFGKKTHLVAH
FT                   SRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPERPFVCPDCGKAFRHKPYLAAHRRI
FT                   HTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIR
FT                   DGAFCCAICGQTFDDEDRLLMHQKKHDA"
FT   gene            800819..820337
FT                   /gene="C130032F08Rik"
FT                   /locus_tag="mCG_128037"
FT                   /note="gene_id=mCG128037.1"
FT   mRNA            join(800819..800876,811968..812049,818031..820337)
FT                   /gene="C130032F08Rik"
FT                   /locus_tag="mCG_128037"
FT                   /product="RIKEN cDNA C130032F08, transcript variant
FT                   mCT173490"
FT                   /note="gene_id=mCG128037.1 transcript_id=mCT173490.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(804318..804395,811968..812049,818031..820337)
FT                   /gene="C130032F08Rik"
FT                   /locus_tag="mCG_128037"
FT                   /product="RIKEN cDNA C130032F08, transcript variant
FT                   mCT129328"
FT                   /note="gene_id=mCG128037.1 transcript_id=mCT129328.0
FT                   created on 17-SEP-2002"
FT   CDS             join(812019..812049,818031..819616)
FT                   /codon_start=1
FT                   /gene="C130032F08Rik"
FT                   /locus_tag="mCG_128037"
FT                   /product="RIKEN cDNA C130032F08, isoform CRA_a"
FT                   /note="gene_id=mCG128037.1 transcript_id=mCT129328.0
FT                   protein_id=mCP61269.1 isoform=CRA_a"
FT                   /db_xref="GOA:B9EIX7"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:B9EIX7"
FT                   /protein_id="EDK98552.1"
FT                   /translation="MESGLAGSISGDGLARIKQEKPEWLLQTVASQATEKDKENIFQQQ
FT                   SGLPPCQTMGRPRALGSQEETGGTRWAPLPEQDAPLAARVPGTAPGPLSPSLSAGGGHF
FT                   VCVDCGKRFSWWSSLKIHQRTHTGEKPYLCGKCGKSFSQKPNLVRHQRHHTGERPFCCP
FT                   ECTRRFSQKQHLLKHQKTHSRPATHTCPECERCFRHQVGLRIHQRAHARNRLGARVNLH
FT                   EMFRYAAARRWSCRLRPGSPRGHPEWVWLGLCRSWWGQHGVRTTAHSRLGPSEQRQFIC
FT                   NDCGKSFTWWSSLNIHQRIHTGERPYACPECGRCFSQKPNLTRHLRNHTGERPHPCSHC
FT                   GRSFRQKQHLLKHLRTHLPGAQAARCTSCGQSCPSRAALRAHQRVHAAAELLRSQSAVR
FT                   DGVPGSESQAEIAQSVVVKPQGPQGAKEVLCGQECETLAVPSEQRQFICNECGKSFSWW
FT                   SALTIHQRIHTGERPYACPDCGRCFSQKPNLTRHRRNHTGERPYLCTACGRGFRQKQHL
FT                   LKHQRVHRGTQAPHPGPEEEL"
FT   CDS             join(812019..812049,818031..819616)
FT                   /codon_start=1
FT                   /gene="C130032F08Rik"
FT                   /locus_tag="mCG_128037"
FT                   /product="RIKEN cDNA C130032F08, isoform CRA_a"
FT                   /note="gene_id=mCG128037.1 transcript_id=mCT173490.0
FT                   protein_id=mCP96409.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EIX7"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:B9EIX7"
FT                   /protein_id="EDK98553.1"
FT                   /translation="MESGLAGSISGDGLARIKQEKPEWLLQTVASQATEKDKENIFQQQ
FT                   SGLPPCQTMGRPRALGSQEETGGTRWAPLPEQDAPLAARVPGTAPGPLSPSLSAGGGHF
FT                   VCVDCGKRFSWWSSLKIHQRTHTGEKPYLCGKCGKSFSQKPNLVRHQRHHTGERPFCCP
FT                   ECTRRFSQKQHLLKHQKTHSRPATHTCPECERCFRHQVGLRIHQRAHARNRLGARVNLH
FT                   EMFRYAAARRWSCRLRPGSPRGHPEWVWLGLCRSWWGQHGVRTTAHSRLGPSEQRQFIC
FT                   NDCGKSFTWWSSLNIHQRIHTGERPYACPECGRCFSQKPNLTRHLRNHTGERPHPCSHC
FT                   GRSFRQKQHLLKHLRTHLPGAQAARCTSCGQSCPSRAALRAHQRVHAAAELLRSQSAVR
FT                   DGVPGSESQAEIAQSVVVKPQGPQGAKEVLCGQECETLAVPSEQRQFICNECGKSFSWW
FT                   SALTIHQRIHTGERPYACPDCGRCFSQKPNLTRHRRNHTGERPYLCTACGRGFRQKQHL
FT                   LKHQRVHRGTQAPHPGPEEEL"
FT   gene            825615..830835
FT                   /gene="AI854703"
FT                   /locus_tag="mCG_128038"
FT                   /note="gene_id=mCG128038.1"
FT   mRNA            join(825615..825963,827978..828854,829022..829165,
FT                   830390..830835)
FT                   /gene="AI854703"
FT                   /locus_tag="mCG_128038"
FT                   /product="expressed sequence AI854703, transcript variant
FT                   mCT129329"
FT                   /note="gene_id=mCG128038.1 transcript_id=mCT129329.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(826124..826170,827978..828854,829022..829165,
FT                   830390..830835)
FT                   /gene="AI854703"
FT                   /locus_tag="mCG_128038"
FT                   /product="expressed sequence AI854703, transcript variant
FT                   mCT171668"
FT                   /note="gene_id=mCG128038.1 transcript_id=mCT171668.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(826146..826222,827978..828854,829022..829165,
FT                   830390..830835)
FT                   /gene="AI854703"
FT                   /locus_tag="mCG_128038"
FT                   /product="expressed sequence AI854703, transcript variant
FT                   mCT171667"
FT                   /note="gene_id=mCG128038.1 transcript_id=mCT171667.0
FT                   created on 05-AUG-2002"
FT   CDS             828006..828617
FT                   /codon_start=1
FT                   /gene="AI854703"
FT                   /locus_tag="mCG_128038"
FT                   /product="expressed sequence AI854703, isoform CRA_a"
FT                   /note="gene_id=mCG128038.1 transcript_id=mCT171667.0
FT                   protein_id=mCP94587.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BIN3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2141510"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BIN3"
FT                   /protein_id="EDK98554.1"
FT                   /translation="MTELVSSRGGSPTGDGEEGLGDDQGLVIHHPAEEQCHRCPLCGQT
FT                   FSQQPSLVRHQKAHVGAGRAAAFVCPECGKAFSVKHNLEVHQRTHTGERPFACPECGRC
FT                   FSLKQNLLTHQRIHSGEKPHQCAQCGRCFREPRFLLNHQRTHARMPTPHPRRPGVFGER
FT                   RPYFCPRCGKSFAREGSLKTHQRSHGHGPESQAAHLSRVL"
FT   CDS             828006..828617
FT                   /codon_start=1
FT                   /gene="AI854703"
FT                   /locus_tag="mCG_128038"
FT                   /product="expressed sequence AI854703, isoform CRA_a"
FT                   /note="gene_id=mCG128038.1 transcript_id=mCT129329.1
FT                   protein_id=mCP61273.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BIN3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2141510"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BIN3"
FT                   /protein_id="EDK98555.1"
FT                   /translation="MTELVSSRGGSPTGDGEEGLGDDQGLVIHHPAEEQCHRCPLCGQT
FT                   FSQQPSLVRHQKAHVGAGRAAAFVCPECGKAFSVKHNLEVHQRTHTGERPFACPECGRC
FT                   FSLKQNLLTHQRIHSGEKPHQCAQCGRCFREPRFLLNHQRTHARMPTPHPRRPGVFGER
FT                   RPYFCPRCGKSFAREGSLKTHQRSHGHGPESQAAHLSRVL"
FT   CDS             828006..828617
FT                   /codon_start=1
FT                   /gene="AI854703"
FT                   /locus_tag="mCG_128038"
FT                   /product="expressed sequence AI854703, isoform CRA_a"
FT                   /note="gene_id=mCG128038.1 transcript_id=mCT171668.0
FT                   protein_id=mCP94586.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BIN3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2141510"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BIN3"
FT                   /protein_id="EDK98556.1"
FT                   /translation="MTELVSSRGGSPTGDGEEGLGDDQGLVIHHPAEEQCHRCPLCGQT
FT                   FSQQPSLVRHQKAHVGAGRAAAFVCPECGKAFSVKHNLEVHQRTHTGERPFACPECGRC
FT                   FSLKQNLLTHQRIHSGEKPHQCAQCGRCFREPRFLLNHQRTHARMPTPHPRRPGVFGER
FT                   RPYFCPRCGKSFAREGSLKTHQRSHGHGPESQAAHLSRVL"
FT   gene            846132..852033
FT                   /gene="Gimap8"
FT                   /locus_tag="mCG_128046"
FT                   /note="gene_id=mCG128046.1"
FT   mRNA            join(846132..846163,846285..846405,849064..849721,
FT                   851431..852033)
FT                   /gene="Gimap8"
FT                   /locus_tag="mCG_128046"
FT                   /product="GTPase, IMAP family member 8"
FT                   /note="gene_id=mCG128046.1 transcript_id=mCT129337.1
FT                   created on 05-AUG-2002"
FT   CDS             join(846314..846405,849064..849721,851431..851490)
FT                   /codon_start=1
FT                   /gene="Gimap8"
FT                   /locus_tag="mCG_128046"
FT                   /product="GTPase, IMAP family member 8"
FT                   /note="gene_id=mCG128046.1 transcript_id=mCT129337.1
FT                   protein_id=mCP62056.1"
FT                   /protein_id="EDK98557.1"
FT                   /translation="MATSSHQGAAAGSQAEHRSCEASVGQGERPSASQGQEGNFKQNQG
FT                   TSTLRLLLLGKQGAGKSATGNTILGKAVFESKFSDHMVTDRCQSESVSVRGKQVIVIDT
FT                   PDLFSSLSCSEVRQQNLKQCLELLADDHCVLLLVTPIGHYTEEDRETIEGIWGKIGPKA
FT                   YRHMIVVFTREDELDEDSLWNYIESKESLKELIKNIGSRRCCTFNNKADKKQRELQVFK
FT                   LLDAIELLMMESPEPYFEPLKMESSGVQTRSFPLKVHQDNKKVIYDI"
FT   gene            <857587..859718
FT                   /locus_tag="mCG_1036474"
FT                   /note="gene_id=mCG1036474.1"
FT   mRNA            <857587..859718
FT                   /locus_tag="mCG_1036474"
FT                   /product="mCG1036474"
FT                   /note="gene_id=mCG1036474.1 transcript_id=mCT154178.1
FT                   created on 05-AUG-2002"
FT   CDS             <857587..858246
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036474"
FT                   /product="mCG1036474"
FT                   /note="gene_id=mCG1036474.1 transcript_id=mCT154178.1
FT                   protein_id=mCP61370.1"
FT                   /protein_id="EDK98558.1"
FT                   /translation="SSATELLNIILLGRSGAGKSATGNTILGRSAFFSQLRAQPVTSSS
FT                   QSGKRTLDWQDVVVVDTPSFIQTPGTEKDPSRLKEEIHHCLSLCEEGMKIFVLVLQLGR
FT                   FTQEDEVVVEQLEASFEENIMKYMIVLFTRKEDLGDGDLHDYTNNTKNKALKKILKKCN
FT                   GRVCAFNNKETGEDQETQVKGLLKIANSLKKNYDEHSNSWVGQLKSTLGQITMAFK"
FT   gene            875109..878038
FT                   /gene="Gimap9"
FT                   /locus_tag="mCG_128049"
FT                   /note="gene_id=mCG128049.1"
FT   mRNA            join(875109..875171,876361..878038)
FT                   /gene="Gimap9"
FT                   /locus_tag="mCG_128049"
FT                   /product="GTPase, IMAP family member 9, transcript variant
FT                   mCT129342"
FT                   /note="gene_id=mCG128049.1 transcript_id=mCT129342.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(875110..875171,876361..876834,877776..878038)
FT                   /gene="Gimap9"
FT                   /locus_tag="mCG_128049"
FT                   /product="GTPase, IMAP family member 9, transcript variant
FT                   mCT171677"
FT                   /note="gene_id=mCG128049.1 transcript_id=mCT171677.0
FT                   created on 05-AUG-2002"
FT   CDS             join(876400..876834,877776..877787)
FT                   /codon_start=1
FT                   /gene="Gimap9"
FT                   /locus_tag="mCG_128049"
FT                   /product="GTPase, IMAP family member 9, isoform CRA_b"
FT                   /note="gene_id=mCG128049.1 transcript_id=mCT171677.0
FT                   protein_id=mCP94596.0 isoform=CRA_b"
FT                   /protein_id="EDK98560.1"
FT                   /translation="MAGQGDTEVRIILVGKTGNGKSATANTILGRRQFDSKICANAVTK
FT                   TCQRAYREWKGKNLVVVDTPGLFDTKETMKTTCFEISRCVLYSCPGPHAIILVLRLDRY
FT                   TEEEQKTVALIKGLFGEAALKYMIILFTHKEDLEDQSLDNFQST"
FT   CDS             876400..877275
FT                   /codon_start=1
FT                   /gene="Gimap9"
FT                   /locus_tag="mCG_128049"
FT                   /product="GTPase, IMAP family member 9, isoform CRA_a"
FT                   /note="gene_id=mCG128049.1 transcript_id=mCT129342.1
FT                   protein_id=mCP61371.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X987"
FT                   /db_xref="InterPro:IPR006703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:3511744"
FT                   /db_xref="UniProtKB/TrEMBL:G3X987"
FT                   /protein_id="EDK98559.1"
FT                   /translation="MAGQGDTEVRIILVGKTGNGKSATANTILGRRQFDSKICANAVTK
FT                   TCQRAYREWKGKNLVVVDTPGLFDTKETMKTTCFEISRCVLYSCPGPHAIILVLRLDRY
FT                   TEEEQKTVALIKGLFGEAALKYMIILFTHKEDLEDQSLDNFVSDAGEKLNNIISQCGKR
FT                   YLAFNNKAALDEQENQVQQLIELTEKMVAQNGGSYFSDKIYKDIDSRLNHCLEELKETY
FT                   AQQLTSEIERIEKEYAAKLEKGKAAQIVFAQRNHDEKLRNLKEKAEETVFMYIFQKIKE
FT                   ILSKLWDELW"
FT   gap             881725..882240
FT                   /estimated_length=516
FT   gene            <883265..890744
FT                   /gene="Gimap4"
FT                   /locus_tag="mCG_128047"
FT                   /note="gene_id=mCG128047.2"
FT   mRNA            join(<883265..883310,885525..885596,889058..890744)
FT                   /gene="Gimap4"
FT                   /locus_tag="mCG_128047"
FT                   /product="GTPase, IMAP family member 4, transcript variant
FT                   mCT189088"
FT                   /note="gene_id=mCG128047.2 transcript_id=mCT189088.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<883265..883310,885525..885596,889058..889986)
FT                   /codon_start=1
FT                   /gene="Gimap4"
FT                   /locus_tag="mCG_128047"
FT                   /product="GTPase, IMAP family member 4, isoform CRA_b"
FT                   /note="gene_id=mCG128047.2 transcript_id=mCT189088.0
FT                   protein_id=mCP110063.0 isoform=CRA_b"
FT                   /protein_id="EDK98562.1"
FT                   /translation="SIVSKSEKVKGPRFSGSRATMEVQCGGAGFIPESSRSSHELGNQD
FT                   QGIPQLRIVLLGKTGAGKSSTGNSILGEKVFNSGICAKSITKVCEKRVSTWDGKELVVV
FT                   DTPGIFDTEVPDADTQREITRYVALTSPGPHALLLVVPLGRYTVEEHKATQKILDMFGK
FT                   QARRFMILLLTRKDDLEDTDIHEYLEKAPKFFQEVMHEFQNRYCLFNNRASGAEKEEQK
FT                   MQLLTLVQSMVRENGGRCFTNKMYESAECVIQKETLRMQELYREELEREKARIRREYEE
FT                   QIKDLRDELEREIRRARMEREFKEREAIFTKNQQNARKEVENTSMILELIIKAWEIASF
FT                   IFNQFMKD"
FT   mRNA            join(883268..883310,885525..885596,889058..889144,
FT                   889529..889635,890097..890742)
FT                   /gene="Gimap4"
FT                   /locus_tag="mCG_128047"
FT                   /product="GTPase, IMAP family member 4, transcript variant
FT                   mCT129339"
FT                   /note="gene_id=mCG128047.2 transcript_id=mCT129339.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(883269..883310,885525..885596,889058..889635,
FT                   890083..890744)
FT                   /gene="Gimap4"
FT                   /locus_tag="mCG_128047"
FT                   /product="GTPase, IMAP family member 4, transcript variant
FT                   mCT171676"
FT                   /note="gene_id=mCG128047.2 transcript_id=mCT171676.0
FT                   created on 05-AUG-2002"
FT   CDS             join(885539..885596,889058..889144,889529..889635,
FT                   890097..890114)
FT                   /codon_start=1
FT                   /gene="Gimap4"
FT                   /locus_tag="mCG_128047"
FT                   /product="GTPase, IMAP family member 4, isoform CRA_a"
FT                   /note="gene_id=mCG128047.2 transcript_id=mCT129339.1
FT                   protein_id=mCP62078.1 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z7Q4"
FT                   /db_xref="InterPro:IPR006703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1349656"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z7Q4"
FT                   /protein_id="EDK98561.1"
FT                   /translation="MEVQCGGAGFIPESSRSSHELGNQDQGIPQLRIVLLGKTGAGKSS
FT                   TGNKVMHEFQNRYCLFNNRASGAEKEEQKMQLLTLVQSMDEVMK"
FT   CDS             join(885539..885596,889058..889635,890083..890106)
FT                   /codon_start=1
FT                   /gene="Gimap4"
FT                   /locus_tag="mCG_128047"
FT                   /product="GTPase, IMAP family member 4, isoform CRA_c"
FT                   /note="gene_id=mCG128047.2 transcript_id=mCT171676.0
FT                   protein_id=mCP94595.0 isoform=CRA_c"
FT                   /protein_id="EDK98563.1"
FT                   /translation="MEVQCGGAGFIPESSRSSHELGNQDQGIPQLRIVLLGKTGAGKSS
FT                   TGNSILGEKVFNSGICAKSITKVCEKRVSTWDGKELVVVDTPGIFDTEVPDADTQREIT
FT                   RYVALTSPGPHALLLVVPLGRYTVEEHKATQKILDMFGKQARRFMILLLTRKDDLEDTD
FT                   IHEYLEKAPKFFQEVMHEFQNRYCLFNNRASGAEKEEQKMQLLTLVQSMFLSSRMK"
FT   gene            complement(900263..>906902)
FT                   /gene="Gimap6"
FT                   /locus_tag="mCG_128050"
FT                   /note="gene_id=mCG128050.2"
FT   mRNA            complement(join(900263..901505,903113..903197,
FT                   906647..906901))
FT                   /gene="Gimap6"
FT                   /locus_tag="mCG_128050"
FT                   /product="GTPase, IMAP family member 6, transcript variant
FT                   mCT129343"
FT                   /note="gene_id=mCG128050.2 transcript_id=mCT129343.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(900265..903197,906647..>906902))
FT                   /gene="Gimap6"
FT                   /locus_tag="mCG_128050"
FT                   /product="GTPase, IMAP family member 6, transcript variant
FT                   mCT189078"
FT                   /note="gene_id=mCG128050.2 transcript_id=mCT189078.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(900865..901505,903113..903197,
FT                   906647..906838))
FT                   /codon_start=1
FT                   /gene="Gimap6"
FT                   /locus_tag="mCG_128050"
FT                   /product="GTPase, IMAP family member 6, isoform CRA_a"
FT                   /note="gene_id=mCG128050.2 transcript_id=mCT129343.0
FT                   protein_id=mCP61395.1 isoform=CRA_a"
FT                   /protein_id="EDK98564.1"
FT                   /translation="MDWLYRKTLGSIGSCSIETFPWPFYSFFQRIYISTPPGKPENSPE
FT                   TSATEVGEQRPSCLSASPVVEEEECEHRPEKNPTRQWPLDSGQGLTKGLKEKKLTPKRL
FT                   QLLLVGKTGSGKSATGNSILGRQAFESKISARPVTTTFQKGTREFEGKELEVIDTPDIF
FT                   SPQNQPEATAKKICDLLASPGPHAVLLVIQVGRYTAEDQAVARCLQEIFGNTILAYTIL
FT                   VFTRKEDLAEGSLEEYIQENNNKSLDVLDVACERRHCGFNNKAQGDEQEAQLKKLMEEV
FT                   ELILWENEGHCYTMEFPNVPSKTL"
FT   CDS             complement(900865..>901551)
FT                   /codon_start=1
FT                   /gene="Gimap6"
FT                   /locus_tag="mCG_128050"
FT                   /product="GTPase, IMAP family member 6, isoform CRA_b"
FT                   /note="gene_id=mCG128050.2 transcript_id=mCT189078.0
FT                   protein_id=mCP110064.0 isoform=CRA_b"
FT                   /protein_id="EDK98565.1"
FT                   /translation="IISSPSGVWFCKLLPGLKEKKLTPKRLQLLLVGKTGSGKSATGNS
FT                   ILGRQAFESKISARPVTTTFQKGTREFEGKELEVIDTPDIFSPQNQPEATAKKICDLLA
FT                   SPGPHAVLLVIQVGRYTAEDQAVARCLQEIFGNTILAYTILVFTRKEDLAEGSLEEYIQ
FT                   ENNNKSLDVLDVACERRHCGFNNKAQGDEQEAQLKKLMEEVELILWENEGHCYTMEFPN
FT                   VPSKTL"
FT   gap             910565..910584
FT                   /estimated_length=20
FT   gene            917282..923274
FT                   /gene="Gimap7"
FT                   /locus_tag="mCG_128053"
FT                   /note="gene_id=mCG128053.1"
FT   mRNA            join(917282..917341,922091..923274)
FT                   /gene="Gimap7"
FT                   /locus_tag="mCG_128053"
FT                   /product="GTPase, IMAP family member 7"
FT                   /note="gene_id=mCG128053.1 transcript_id=mCT129346.0
FT                   created on 05-AUG-2002"
FT   CDS             922124..923005
FT                   /codon_start=1
FT                   /gene="Gimap7"
FT                   /locus_tag="mCG_128053"
FT                   /product="GTPase, IMAP family member 7"
FT                   /note="gene_id=mCG128053.1 transcript_id=mCT129346.0
FT                   protein_id=mCP61483.1"
FT                   /db_xref="GOA:Q8R379"
FT                   /db_xref="InterPro:IPR006703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1349657"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R379"
FT                   /protein_id="EDK98566.1"
FT                   /translation="MAEPSDNSLRIVLVGKTGSGKSATANTILGQKRFVSRIAPHAVTQ
FT                   NCQSDSRRWKERDLLVVDTPGLFDTKVKLETTCLEISRCVLQSCPGPHAIILVLQLNRF
FT                   TVEEQETVIRIKAIFGEEVMKYMIVLFTRKDDLEDQSLSDFIADSDTNLKSIIKECGNR
FT                   CLAINNKAERAERETQVQELMGLVETLVQNNGGLYFSHPVYKDAERRLKKQVEILRKIY
FT                   TDLPEKEIRIVEEEYALRKFSAQEREKKIQAIRENYNLKIRNLREEAEKNIFNQIIEEV
FT                   KKVLLKIWHLFS"
FT   gap             923966..924539
FT                   /estimated_length=574
FT   gene            <928231..1665510
FT                   /locus_tag="mCG_145830"
FT                   /note="gene_id=mCG145830.0"
FT   mRNA            join(<928231..932022,1656183..1656212,1665444..1665510)
FT                   /locus_tag="mCG_145830"
FT                   /product="mCG145830"
FT                   /note="gene_id=mCG145830.0 transcript_id=mCT185938.0
FT                   created on 03-JUL-2003"
FT   CDS             <928538..928858
FT                   /codon_start=1
FT                   /locus_tag="mCG_145830"
FT                   /product="mCG145830"
FT                   /note="gene_id=mCG145830.0 transcript_id=mCT185938.0
FT                   protein_id=mCP107412.0"
FT                   /protein_id="EDK98567.1"
FT                   /translation="VLIRTTHEALTLQFLGSRSSKLLRFLLHTSYSVPQHLRCNHSYDT
FT                   PPGSNFLLASCTSGNTQDNPLCFVSVWNSLWNQTGLKLTILSLQPSKCWDFRHASPCLI
FT                   RK"
FT   gene            <937736..942484
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /note="gene_id=mCG128035.2"
FT   mRNA            join(<937736..937845,940016..940107,941189..942484)
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /product="GTPase, IMAP family member 1, transcript variant
FT                   mCT189081"
FT                   /note="gene_id=mCG128035.2 transcript_id=mCT189081.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<937736..937845,940016..940107,941189..942048)
FT                   /codon_start=1
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /product="GTPase, IMAP family member 1, isoform CRA_a"
FT                   /note="gene_id=mCG128035.2 transcript_id=mCT189081.0
FT                   protein_id=mCP110062.0 isoform=CRA_a"
FT                   /protein_id="EDK98568.1"
FT                   /translation="DFLYAQPWARRDFCTHKRREGEAGASLGHFRDCQQERNEHTNEKT
FT                   KTESLLRSMGGRKMARDEEDAYGSEDSRAPQMPQLRLILVGRTGTGKSATGNSILGQKC
FT                   FLSRLGAVPVTRSCTLASRMWAGWQVEVVDTPDIFSSEIPRTDPGCVETARCFVLSAPG
FT                   PHALLLVTQLGRFTMQDSQALAAVKRLFGKQVMARTVVVFTRQEDLAGDSLQDYVHCTD
FT                   NRALRDLVAECGGRVCALNNRATGSEREAQAEQLLGMVACLVREHGGAHYSNEVYELVQ
FT                   DTRCADPQDQVAKVAEIVAERMQRRTRLLAGLWGWRKFYWKGWRRGFSVFLGVAILIYL
FT                   LFYRKGFGDQNNR"
FT   mRNA            join(<937760..937845,940010..940107,940975..942484)
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /product="GTPase, IMAP family member 1, transcript variant
FT                   mCT129326"
FT                   /note="gene_id=mCG128035.2 transcript_id=mCT129326.1
FT                   created on 18-NOV-2002"
FT   CDS             join(<937760..937845,940010..940107,940975..941747)
FT                   /codon_start=1
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /product="GTPase, IMAP family member 1, isoform CRA_b"
FT                   /note="gene_id=mCG128035.2 transcript_id=mCT129326.1
FT                   protein_id=mCP61241.1 isoform=CRA_b"
FT                   /protein_id="EDK98569.1"
FT                   /translation="ARRDFCTHKRREGEAGASLGHFRDCQQESCRNEHTNEKTKTESLL
FT                   RSMGGRKMARDEEDAYAGASAGAQRIQMQKGETGKNLSSENPKQMGAPGFQGEQAMWVL
FT                   PLYAEGLNTSLSQRKACVSDSMLPHLILRLRGLQGPADAPAEAHPSGQDWDRQECHWQQ
FT                   HPGSEVLPVQAGGGACHQKLHFGQQNVGRLAGGGGGHPGYLQLRDPADRPWVRGDSPLL
FT                   RAVGPWAARAAAGHPAGSLHHAGQPGAGRGEAVIREAGDGAHCRGVHAPRGPGWRLPAG
FT                   LCALHGQPRAAGPGGRVRGPRVRPQQPRHRQRARGSG"
FT   mRNA            join(<937780..937845,940010..940107,941189..942484)
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /product="GTPase, IMAP family member 1, transcript variant
FT                   mCT171663"
FT                   /note="gene_id=mCG128035.2 transcript_id=mCT171663.0
FT                   created on 18-NOV-2002"
FT   CDS             join(<937781..937845,940010..940107,941189..942048)
FT                   /codon_start=1
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /product="GTPase, IMAP family member 1, isoform CRA_c"
FT                   /note="gene_id=mCG128035.2 transcript_id=mCT171663.0
FT                   protein_id=mCP94582.0 isoform=CRA_c"
FT                   /protein_id="EDK98570.1"
FT                   /translation="HKRREGEAGASLGHFRDCQQESCRNEHTNEKTKTESLLRSMGGRK
FT                   MARDEEDAYGSEDSRAPQMPQLRLILVGRTGTGKSATGNSILGQKCFLSRLGAVPVTRS
FT                   CTLASRMWAGWQVEVVDTPDIFSSEIPRTDPGCVETARCFVLSAPGPHALLLVTQLGRF
FT                   TMQDSQALAAVKRLFGKQVMARTVVVFTRQEDLAGDSLQDYVHCTDNRALRDLVAECGG
FT                   RVCALNNRATGSEREAQAEQLLGMVACLVREHGGAHYSNEVYELVQDTRCADPQDQVAK
FT                   VAEIVAERMQRRTRLLAGLWGWRKFYWKGWRRGFSVFLGVAILIYLLFYRKGFGDQNNR
FT                   "
FT   mRNA            940872..942484
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /product="GTPase, IMAP family member 1, transcript variant
FT                   mCT176129"
FT                   /note="gene_id=mCG128035.2 transcript_id=mCT176129.0
FT                   created on 18-NOV-2002"
FT   CDS             941215..942048
FT                   /codon_start=1
FT                   /gene="Gimap1"
FT                   /locus_tag="mCG_128035"
FT                   /product="GTPase, IMAP family member 1, isoform CRA_d"
FT                   /note="gene_id=mCG128035.2 transcript_id=mCT176129.0
FT                   protein_id=mCP99051.0 isoform=CRA_d"
FT                   /protein_id="EDK98571.1"
FT                   /translation="MPQLRLILVGRTGTGKSATGNSILGQKCFLSRLGAVPVTRSCTLA
FT                   SRMWAGWQVEVVDTPDIFSSEIPRTDPGCVETARCFVLSAPGPHALLLVTQLGRFTMQD
FT                   SQALAAVKRLFGKQVMARTVVVFTRQEDLAGDSLQDYVHCTDNRALRDLVAECGGRVCA
FT                   LNNRATGSEREAQAEQLLGMVACLVREHGGAHYSNEVYELVQDTRCADPQDQVAKVAEI
FT                   VAERMQRRTRLLAGLWGWRKFYWKGWRRGFSVFLGVAILIYLLFYRKGFGDQNNR"
FT   gene            944888..952845
FT                   /gene="Gimap5"
FT                   /locus_tag="mCG_140815"
FT                   /note="gene_id=mCG140815.0"
FT   mRNA            join(944888..945121,949310..949358,951390..952845)
FT                   /gene="Gimap5"
FT                   /locus_tag="mCG_140815"
FT                   /product="GTPase, IMAP family member 5"
FT                   /note="gene_id=mCG140815.0 transcript_id=mCT171643.0
FT                   created on 05-AUG-2002"
FT   gap             947369..947667
FT                   /estimated_length=299
FT   CDS             join(949316..949358,951390..952273)
FT                   /codon_start=1
FT                   /gene="Gimap5"
FT                   /locus_tag="mCG_140815"
FT                   /product="GTPase, IMAP family member 5"
FT                   /note="gene_id=mCG140815.0 transcript_id=mCT171643.0
FT                   protein_id=mCP94562.0"
FT                   /protein_id="EDK98572.1"
FT                   /translation="MEHLQKSTYGTIVQGPEAHCVQESSCLRILLVGKSGCGKSATGNS
FT                   ILRRPAFESRLRGQSVTRTSQAETGTWEGRSILVVDTPPIFESKAQNQDMDKDIGDCYL
FT                   LCAPGPHVLLLVTQLGRFTAEDAMAVRMVKEVFGVGVMRHMIVLFTRKEDLEEKSLEEF
FT                   VTHTDNRSLRSLTQECGRRYCAFNNRASGEEQQGQLAELMALVRRLEQECEGSFHSNDL
FT                   FLHAEALLREGYSVHQEAYRCYLAKVRQEVEKQRRELEEQEGSWIAKMICTVKSCWSSH
FT                   TAACALLIVLGLTLLTTFINLCISRCK"
FT   gap             952846..953389
FT                   /estimated_length=544
FT   gene            <953649..955122
FT                   /locus_tag="mCG_1036751"
FT                   /note="gene_id=mCG1036751.1"
FT   mRNA            <953649..955122
FT                   /locus_tag="mCG_1036751"
FT                   /product="mCG1036751"
FT                   /note="gene_id=mCG1036751.1 transcript_id=mCT154455.1
FT                   created on 05-AUG-2002"
FT   CDS             <953650..953844
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036751"
FT                   /product="mCG1036751"
FT                   /note="gene_id=mCG1036751.1 transcript_id=mCT154455.1
FT                   protein_id=mCP61420.1"
FT                   /protein_id="EDK98573.1"
FT                   /translation="VVSPGHVLLCCFSSSSSSSMSSPSSIFFLLLSPHLPLHLPFICPI
FT                   DSSPLFYKLRWEAGFQEIT"
FT   gap             961793..961812
FT                   /estimated_length=20
FT   gap             963218..963237
FT                   /estimated_length=20
FT   gene            complement(964204..>969252)
FT                   /locus_tag="mCG_128030"
FT                   /note="gene_id=mCG128030.1"
FT   mRNA            complement(join(964204..965647,969043..>969252))
FT                   /locus_tag="mCG_128030"
FT                   /product="mCG128030"
FT                   /note="gene_id=mCG128030.1 transcript_id=mCT129321.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(964824..>965495)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128030"
FT                   /product="mCG128030"
FT                   /note="gene_id=mCG128030.1 transcript_id=mCT129321.1
FT                   protein_id=mCP61182.1"
FT                   /protein_id="EDK98574.1"
FT                   /translation="PPIFESKAQNQDMDKDIGDCYLLCAPGPHVLLLVTQLGRFTAEDV
FT                   MAVRMVKEVFGVGVMRHMIVLFTRKEDLAEKSLEEFVTHTDNRSLRSLVQECGRRYCAF
FT                   NNRASGEEQQGQLAELMALVRRLEQECEGSFHSNDLFLHAETLLREGYSVHQEAYRCYL
FT                   AKVRQEVEKQRWELEEQEGSWVLKVLPIGKKLEVLHSDFCWYLVLAILIFFVFFFLLFY
FT                   V"
FT   gap             965648..968990
FT                   /estimated_length=3343
FT   gap             970669..970688
FT                   /estimated_length=20
FT   gap             979316..979571
FT                   /estimated_length=256
FT   gap             997029..997048
FT                   /estimated_length=20
FT   gene            1018582..1019180
FT                   /locus_tag="mCG_1036754"
FT                   /note="gene_id=mCG1036754.1"
FT   mRNA            1018582..1019180
FT                   /locus_tag="mCG_1036754"
FT                   /product="mCG1036754"
FT                   /note="gene_id=mCG1036754.1 transcript_id=mCT154458.1
FT                   created on 05-AUG-2002"
FT   CDS             1018758..1018934
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036754"
FT                   /product="mCG1036754"
FT                   /note="gene_id=mCG1036754.1 transcript_id=mCT154458.1
FT                   protein_id=mCP61481.1"
FT                   /protein_id="EDK98575.1"
FT                   /translation="MCVPTDEAHCQVFVILVAGKESENLPSNPSPANPELLHLHQTLSL
FT                   YPSHTHFLRIDIV"
FT   gene            complement(1031291..1039086)
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /note="gene_id=mCG131720.1"
FT   mRNA            complement(join(1031291..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035954,1038938..1039086))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT171686"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171686.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(1031291..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035951,1036928..1037035,1037951..1038043,
FT                   1038938..1039086))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT171683"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171683.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(1031291..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035951,1038586..1038709))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT171680"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171680.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(1031291..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035954,1038586..1038709))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT171685"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171685.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(1031291..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035951,1037951..1038043,1038586..1038709))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT171684"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171684.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(1031291..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035954,1037951..1038562))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT133058"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT133058.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(1031291..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035951,1037951..1038043,1038444..1038558))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT171681"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171681.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(1031291..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035954,1037951..1038043,1038290..1038338))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT171682"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171682.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(1031636..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035946))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_a"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT133058.1
FT                   protein_id=mCP61032.1 isoform=CRA_a"
FT                   /protein_id="EDK98576.1"
FT                   /translation="MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKK
FT                   FLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAG
FT                   VGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPL
FT                   QSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGL
FT                   SLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIPAIL"
FT   CDS             complement(join(1031636..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035946))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_a"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171680.0
FT                   protein_id=mCP94603.0 isoform=CRA_a"
FT                   /protein_id="EDK98577.1"
FT                   /translation="MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKK
FT                   FLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAG
FT                   VGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPL
FT                   QSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGL
FT                   SLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIPAIL"
FT   CDS             complement(join(1031636..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035946))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_a"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171682.0
FT                   protein_id=mCP94599.0 isoform=CRA_a"
FT                   /protein_id="EDK98578.1"
FT                   /translation="MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKK
FT                   FLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAG
FT                   VGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPL
FT                   QSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGL
FT                   SLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIPAIL"
FT   CDS             complement(join(1031636..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035946))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_a"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171683.0
FT                   protein_id=mCP94601.0 isoform=CRA_a"
FT                   /protein_id="EDK98579.1"
FT                   /translation="MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKK
FT                   FLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAG
FT                   VGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPL
FT                   QSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGL
FT                   SLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIPAIL"
FT   CDS             complement(join(1031636..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035946))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_a"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171685.0
FT                   protein_id=mCP94600.0 isoform=CRA_a"
FT                   /protein_id="EDK98580.1"
FT                   /translation="MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKK
FT                   FLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAG
FT                   VGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPL
FT                   QSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGL
FT                   SLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIPAIL"
FT   CDS             complement(join(1031636..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035946))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_a"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171681.0
FT                   protein_id=mCP94605.0 isoform=CRA_a"
FT                   /protein_id="EDK98583.1"
FT                   /translation="MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKK
FT                   FLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAG
FT                   VGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPL
FT                   QSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGL
FT                   SLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIPAIL"
FT   CDS             complement(join(1031636..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035946))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_a"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171684.0
FT                   protein_id=mCP94604.0 isoform=CRA_a"
FT                   /protein_id="EDK98584.1"
FT                   /translation="MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKK
FT                   FLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAG
FT                   VGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPL
FT                   QSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGL
FT                   SLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIPAIL"
FT   CDS             complement(join(1031636..1031722,1032090..1032209,
FT                   1033034..1033264,1033495..1033551,1033816..1033926,
FT                   1035761..1035946))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_a"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT171686.0
FT                   protein_id=mCP94602.0 isoform=CRA_a"
FT                   /protein_id="EDK98585.1"
FT                   /translation="MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKK
FT                   FLSWPQARIHYGQLSLGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAG
FT                   VGTIVHEKRQGKLSGQVSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPL
FT                   QSSMDPGYGTVRYSDDSDWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGL
FT                   SLRSMYGRSSQALNEEESERKLLDGHPAPASPAKEKIPAIL"
FT   mRNA            complement(join(<1032099..1032209,1033034..1033264,
FT                   1033495..1033551,1033816..1033926,1035761..1035954,
FT                   1037951..1038043,1038586..>1038680))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT189065"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT189065.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<1032099..1032209,1033034..1033264,
FT                   1033495..1033551,1033816..1033926,1035761..1035954,
FT                   1037951..>1038026))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_c"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT189065.0
FT                   protein_id=mCP110069.0 isoform=CRA_c"
FT                   /protein_id="EDK98582.1"
FT                   /translation="GLHLCFSSSLLKSCQTPVLSALRCTAGKMVQSTVTVNGVKVASTH
FT                   PQSAHISIHIHQKSALEQLLGAVGSLKKFLSWPQARIHYGQLSLGVTQILLGLVSCALG
FT                   VCLYFGPWTELCAFGCAFWSGSVAILAGVGTIVHEKRQGKLSGQVSCLLLLACIATAAA
FT                   ATVLGVNSLIRQTSVPYYVEIFSTCNPLQSSMDPGYGTVRYSDDSDWKTERCREYLNMM
FT                   MNLFLAFCIMLTVVCILEIVVSVASLGLSLRSMYGRSS"
FT   mRNA            complement(join(<1032138..1032209,1033034..1033264,
FT                   1033495..1033551,1033816..1033926,1035761..1035954,
FT                   1037951..1038038,1038586..>1038600))
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, transcript variant
FT                   mCT189064"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT189064.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<1032138..1032209,1033034..1033264,
FT                   1033495..1033551,1033816..1033926,1035761..1035954,
FT                   1037951..>1038026))
FT                   /codon_start=1
FT                   /gene="1810009M01Rik"
FT                   /locus_tag="mCG_131720"
FT                   /product="RIKEN cDNA 1810009M01, isoform CRA_b"
FT                   /note="gene_id=mCG131720.1 transcript_id=mCT189064.0
FT                   protein_id=mCP110068.0 isoform=CRA_b"
FT                   /protein_id="EDK98581.1"
FT                   /translation="GLHLCFSSSLLKSCQTPVLSALRCTAGKMVQSTVTVNGVKVASTH
FT                   PQSAHISIHIHQKSALEQLLGAVGSLKKFLSWPQARIHYGQLSLGVTQILLGLVSCALG
FT                   VCLYFGPWTELCAFGCAFWSGSVAILAGVGTIVHEKRQGKLSGQVSCLLLLACIATAAA
FT                   ATVLGVNSLIRQTSVPYYVEIFSTCNPLQSSMDPGYGTVRYSDDSDWKTERCREYLNMM
FT                   MNLFLAFCIMLTVVCILEIVVSVAS"
FT   gene            1039080..1043433
FT                   /gene="0610011I04Rik"
FT                   /locus_tag="mCG_131731"
FT                   /note="gene_id=mCG131731.1"
FT   mRNA            join(1039080..1039179,1039794..1039991,1040179..1040289,
FT                   1041375..1041431,1041551..1041769,1042258..1042368,
FT                   1042694..1043433)
FT                   /gene="0610011I04Rik"
FT                   /locus_tag="mCG_131731"
FT                   /product="RIKEN cDNA 0610011I04"
FT                   /note="gene_id=mCG131731.1 transcript_id=mCT133069.1
FT                   created on 05-AUG-2002"
FT   CDS             join(1039809..1039991,1040179..1040289,1041375..1041431,
FT                   1041551..1041769,1042258..1042368,1042694..1042735)
FT                   /codon_start=1
FT                   /gene="0610011I04Rik"
FT                   /locus_tag="mCG_131731"
FT                   /product="RIKEN cDNA 0610011I04"
FT                   /note="gene_id=mCG131731.1 transcript_id=mCT133069.1
FT                   protein_id=mCP61935.1"
FT                   /protein_id="EDK98586.1"
FT                   /translation="METAVVGKVDPEAPQPTHIDVHIHQESALAKLLLAGCSLLRIPAS
FT                   ASTQSQGSSRVLVASWVVQTVLGALSVVLGGTLYIGHYLAMYSEGAPFWTGIVAMLAGA
FT                   VAFLHKKRGGTCWALMRTLLVLASFCTAVAAIVIGSRELNFYWYFLGDDVCQRDSSYGW
FT                   STMPRTTPVPEEADRIALCIYYTSMLKTLLMSLQAMLLGIWVLLLLASLTPVCVYIWKR
FT                   FFTKAETEEKKLLGAAVI"
FT   gene            complement(1045182..1060703)
FT                   /locus_tag="mCG_1036475"
FT                   /note="gene_id=mCG1036475.1"
FT   mRNA            complement(join(1045182..1045274,1045729..1045796,
FT                   1059945..1060254,1060420..1060703))
FT                   /locus_tag="mCG_1036475"
FT                   /product="mCG1036475"
FT                   /note="gene_id=mCG1036475.1 transcript_id=mCT154179.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(1060104..1060254,1060420..1060541))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036475"
FT                   /product="mCG1036475"
FT                   /note="gene_id=mCG1036475.1 transcript_id=mCT154179.0
FT                   protein_id=mCP61375.1"
FT                   /protein_id="EDK98587.1"
FT                   /translation="MMTQVSATLVPGDLTSLLTSMGSSHTCICDIYAGRTLRHIQHPTQ
FT                   ENRMEYIASLVVENTMAIHSEVVFQTHPSLLPASSVLANGVCCCC"
FT   gene            1092845..1109202
FT                   /gene="Abp1"
FT                   /locus_tag="mCG_131727"
FT                   /note="gene_id=mCG131727.1"
FT   mRNA            join(1092845..1092889,1102784..1104372,1105206..1105491,
FT                   1105800..1105932,1106163..1106783)
FT                   /gene="Abp1"
FT                   /locus_tag="mCG_131727"
FT                   /product="amiloride binding protein 1 (amine oxidase,
FT                   copper-containing), transcript variant mCT171689"
FT                   /note="gene_id=mCG131727.1 transcript_id=mCT171689.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(1092861..1092889,1102784..1104372,1105206..1105491,
FT                   1105800..1105932,1106163..1106642,1107350..1107426,
FT                   1108958..1109202)
FT                   /gene="Abp1"
FT                   /locus_tag="mCG_131727"
FT                   /product="amiloride binding protein 1 (amine oxidase,
FT                   copper-containing), transcript variant mCT133065"
FT                   /note="gene_id=mCG131727.1 transcript_id=mCT133065.1
FT                   created on 05-AUG-2002"
FT   CDS             join(1102803..1104372,1105206..1105491,1105800..1105932,
FT                   1106163..1106429)
FT                   /codon_start=1
FT                   /gene="Abp1"
FT                   /locus_tag="mCG_131727"
FT                   /product="amiloride binding protein 1 (amine oxidase,
FT                   copper-containing), isoform CRA_a"
FT                   /note="gene_id=mCG131727.1 transcript_id=mCT133065.1
FT                   protein_id=mCP61811.1 isoform=CRA_a"
FT                   /protein_id="EDK98588.1"
FT                   /translation="MSLAFGWAAVILLLQTADTASAVTTPHDKARIFADLSPQEIKAVH
FT                   SFLMSRKELGLESSKNLTLAKNSVFLIEMLLPKKKNVLKFLDEGRKSPVREARAIIFFG
FT                   AQDHPNVTEFAVGPLPRPCYVQALSPRPGHHLSWSSRPISTAEYDLLYHMLNRAITPLH
FT                   QFFLDTTGFSFLGCDDRFLTFTDVAPRGVESGQRRSWLIVQRYVEGYFLHPTGLEILVD
FT                   HSSTDVQDWRVEQLWYNGKFYNSPEELAQKYAVGEVEAVVLEEVVLEDPLPGATEQPPL
FT                   FSSYKPRGEFHTPVTVAGPHVVQPSGPRYKLEGNVVLYGDWSFSYRLRSSSGLQIFNVL
FT                   FGGERVAYEVSVQEAVALYGGHTPAGMQTKYIDVGWGLGSVTHELAPGIDCPETATFLD
FT                   AFHYYDSDGPVLYPRALCLFEMPTGVPLRRHFDSNFKGGFNFYAGLKGYVLVLRTTSTV
FT                   YNYDYIWDFIFYPNGVMETKMHATGYVHATFYTPEGLRHGTRLQTHLLGNIHTHLVHYR
FT                   VDLDVAGTKNSFRTLKTKLENITNPWSPSHSLVQPTLEQTQYSHEHQAAFRFGQTLPKY
FT                   LLFSSPQKNRWGHRRSYRLQIHSMAEQVLPPGWQEERAVTWARYPLAVTKYRESERYSS
FT                   SLYNQNDPWDPPVVFEEFLRNNENIENEDLVAWVTVGFLHIPHSEDVPNTATPGNCVGF
FT                   LIRPFNFFEEDPSLASRDTVIVWPQDNGLNHVQRWIPENRDCLVSPPFSYNGTYKPV"
FT   CDS             join(1102803..1104372,1105206..1105491,1105800..1105932,
FT                   1106163..1106429)
FT                   /codon_start=1
FT                   /gene="Abp1"
FT                   /locus_tag="mCG_131727"
FT                   /product="amiloride binding protein 1 (amine oxidase,
FT                   copper-containing), isoform CRA_a"
FT                   /note="gene_id=mCG131727.1 transcript_id=mCT171689.0
FT                   protein_id=mCP94608.0 isoform=CRA_a"
FT                   /protein_id="EDK98589.1"
FT                   /translation="MSLAFGWAAVILLLQTADTASAVTTPHDKARIFADLSPQEIKAVH
FT                   SFLMSRKELGLESSKNLTLAKNSVFLIEMLLPKKKNVLKFLDEGRKSPVREARAIIFFG
FT                   AQDHPNVTEFAVGPLPRPCYVQALSPRPGHHLSWSSRPISTAEYDLLYHMLNRAITPLH
FT                   QFFLDTTGFSFLGCDDRFLTFTDVAPRGVESGQRRSWLIVQRYVEGYFLHPTGLEILVD
FT                   HSSTDVQDWRVEQLWYNGKFYNSPEELAQKYAVGEVEAVVLEEVVLEDPLPGATEQPPL
FT                   FSSYKPRGEFHTPVTVAGPHVVQPSGPRYKLEGNVVLYGDWSFSYRLRSSSGLQIFNVL
FT                   FGGERVAYEVSVQEAVALYGGHTPAGMQTKYIDVGWGLGSVTHELAPGIDCPETATFLD
FT                   AFHYYDSDGPVLYPRALCLFEMPTGVPLRRHFDSNFKGGFNFYAGLKGYVLVLRTTSTV
FT                   YNYDYIWDFIFYPNGVMETKMHATGYVHATFYTPEGLRHGTRLQTHLLGNIHTHLVHYR
FT                   VDLDVAGTKNSFRTLKTKLENITNPWSPSHSLVQPTLEQTQYSHEHQAAFRFGQTLPKY
FT                   LLFSSPQKNRWGHRRSYRLQIHSMAEQVLPPGWQEERAVTWARYPLAVTKYRESERYSS
FT                   SLYNQNDPWDPPVVFEEFLRNNENIENEDLVAWVTVGFLHIPHSEDVPNTATPGNCVGF
FT                   LIRPFNFFEEDPSLASRDTVIVWPQDNGLNHVQRWIPENRDCLVSPPFSYNGTYKPV"
FT   gene            1130054..1131221
FT                   /locus_tag="mCG_131721"
FT                   /note="gene_id=mCG131721.1"
FT   mRNA            join(1130054..1130240,1130549..1130681,1130927..1131221)
FT                   /locus_tag="mCG_131721"
FT                   /product="mCG131721"
FT                   /note="gene_id=mCG131721.1 transcript_id=mCT133059.1
FT                   created on 05-AUG-2002"
FT   CDS             join(1130143..1130240,1130549..1130681,1130927..1131052)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131721"
FT                   /product="mCG131721"
FT                   /note="gene_id=mCG131721.1 transcript_id=mCT133059.1
FT                   protein_id=mCP61058.1"
FT                   /db_xref="GOA:Q9DAW4"
FT                   /db_xref="InterPro:IPR000269"
FT                   /db_xref="InterPro:IPR015798"
FT                   /db_xref="MGI:MGI:1917011"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAW4"
FT                   /protein_id="EDK98590.1"
FT                   /translation="MGHRSRYRLKTYSKIHQVPLPGWQKKQGVSWTRYPLAVTEYQDSE
FT                   KCSSSIYSQNNPWDPPVVFEDFIQNNTNIEDKDLVAWATVGFHNMPRSEASTNMTTPEN
FT                   SVGFVLRPFNLPGF"
FT   gap             1144128..1144163
FT                   /estimated_length=36
FT   gap             1156394..1156706
FT                   /estimated_length=313
FT   gap             1157525..1157630
FT                   /estimated_length=106
FT   gene            1173254..>1176716
FT                   /gene="Doxl2"
FT                   /locus_tag="mCG_131725"
FT                   /note="gene_id=mCG131725.1"
FT   mRNA            join(1173254..1174790,1175578..1175860,1176159..1176291,
FT                   1176522..>1176716)
FT                   /gene="Doxl2"
FT                   /locus_tag="mCG_131725"
FT                   /product="diamine oxidase-like protein 2"
FT                   /note="gene_id=mCG131725.1 transcript_id=mCT133063.1
FT                   created on 05-AUG-2002"
FT   CDS             join(1173266..1174790,1175578..1175860,1176159..1176291,
FT                   1176522..1176716)
FT                   /codon_start=1
FT                   /gene="Doxl2"
FT                   /locus_tag="mCG_131725"
FT                   /product="diamine oxidase-like protein 2"
FT                   /note="gene_id=mCG131725.1 transcript_id=mCT133063.1
FT                   protein_id=mCP61731.1"
FT                   /protein_id="EDK98591.1"
FT                   /translation="MAIVLVLQETMAEYPSWMLNGKAQVFSDLSIQEMEAVHSFLMGRT
FT                   ELELQPSGTQALDKNSVFLIETLLPNKKVVLEFLNKGTRPPVREARVIIFFSAQEHPNV
FT                   TEFAVGPLPQPIYMRELFPRPEKHRSWASRPMFKAEQSLLYHKIKEATTPLKGFFLDTT
FT                   GFSLEDCNGQCLTFTHVAPHSVESRHRATWFLLQRIVKDRLLQPTGLEVLVDHGSTDIR
FT                   DWRVEQVWYNGKLYSSPEELAQKYADGEVDTVVLKDLRPKNTELPQVFNKPGGKFAAPL
FT                   RKSGPHVKQANDSRYHLEGNTVIYKDWSFSFQLRPSSGLQILNVHFRNEYIAYEIGVQG
FT                   AMAVHREKTPAGELTKTMDLGWSLGTVTHELAPGINCPETATFLDVIHYHGTDGPVRYP
FT                   RALCLFEIPTGVPVRPTFNTNSAGKINFFSDVMGHKLVLRATSALYNFDYIWDFIFYTT
FT                   GTISAKMHATGYIHTTIYTREGLRETHLLTHQLGHSHTHLVHYRVDLDVAGTNNSFHTL
FT                   QAKQKNITNSSSPRRLVQDVMEKTQYSQERQATFSFGQTLPSFLLFSSPKKDIWGYRRS
FT                   YRLKIYSTSEQRLTPETQEDLAFSWARYSLAVSKYSDSEQYSTSIYNQNHPWDPPVVFE
FT                   DFLQDSENIEDQDLVAWVTVGFSHGPHSEAAPYMASSRNFVGFLLLPFNFFYITEKHPA
FT                   TSATDISDTGSLGAGSA"
FT   gene            complement(1184677..1197227)
FT                   /locus_tag="mCG_140824"
FT                   /note="gene_id=mCG140824.0"
FT   mRNA            complement(join(1184677..1184889,1189620..1189724,
FT                   1196915..1197227))
FT                   /locus_tag="mCG_140824"
FT                   /product="mCG140824"
FT                   /note="gene_id=mCG140824.0 transcript_id=mCT171691.0
FT                   created on 06-AUG-2002"
FT   gene            <1184921..1189785
FT                   /gene="Svs1"
FT                   /locus_tag="mCG_131722"
FT                   /note="gene_id=mCG131722.2"
FT   mRNA            join(<1184921..1187002,1188063..1188339,1188618..1188750,
FT                   1188991..1189129,1189639..1189783)
FT                   /gene="Svs1"
FT                   /locus_tag="mCG_131722"
FT                   /product="seminal vesicle secretion 1, transcript variant
FT                   mCT189067"
FT                   /note="gene_id=mCG131722.2 transcript_id=mCT189067.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(1184963..1186023,1186348..1187002,1188063..1188339,
FT                   1188618..1188750,1188991..1189129,1189639..1189785)
FT                   /gene="Svs1"
FT                   /locus_tag="mCG_131722"
FT                   /product="seminal vesicle secretion 1, transcript variant
FT                   mCT133060"
FT                   /note="gene_id=mCG131722.2 transcript_id=mCT133060.1
FT                   created on 05-AUG-2002"
FT   CDS             join(<1185088..1187002,1188063..1188339,1188618..1188750,
FT                   1188991..1189129,1189639..1189670)
FT                   /codon_start=1
FT                   /gene="Svs1"
FT                   /locus_tag="mCG_131722"
FT                   /product="seminal vesicle secretion 1, isoform CRA_b"
FT                   /note="gene_id=mCG131722.2 transcript_id=mCT189067.0
FT                   protein_id=mCP110070.0 isoform=CRA_b"
FT                   /protein_id="EDK98594.1"
FT                   /translation="ELSSPLLCFRAMSLVGRTLVLGWMTTILVVHMSVAKHSRWALRTK
FT                   PQMLWDLSGEELEAVHNFVMSSKELELQPSTLLTLAKNSVFLIEMLMPKKYEVLAFLDK
FT                   GAMLPLREARVLIYFGAQEYPNVTEYAVGPVEQPMYMRKLNRKGGQQLSWASRPMSKVE
FT                   SALLLHTLKTATKPLQEFFFDTTGFTLQDCNGGCLTFTNVGPRAMTFGKRHSWFLLQRI
FT                   MNDYFLQPTGLEILLDHGSTDVQDWIVEQVWYNGKFYNSPEELAQKYADGEVDIVVLED
FT                   PLPKTTEQFPQFSTYKPYAEFLMPISKGGPRVIQLYPEFPMPISKGGPQKAQPDPKFPI
FT                   PISKGGPQVAQPYREFPMPISKGGPQVVQPDPKFPIPISKGGPRVPQPHAKFPMPISKG
FT                   GPRVVQPKAKFPMPISKGGPQIAQPHVPHYRLKHNTVLYGDWNFFFKLHSSYGLQLFNV
FT                   HFRGERIAYEVGVQEVMALYRGHTAAGRKTKYMDVGWGLGGITHQLTPGIDCPHEATFL
FT                   DAIHYYDSDGPVLSRRALCIFEMPLRQYFNSNFRSSFSSYAKLSGPMLVLRTASTIHNH
FT                   DYIWDFIFHSNGMMEGKMYATGYVHATFYSSEGLLYHSRLHTHLLGNVHSHLAHYRIDL
FT                   DVAGTKNRFQTLKMRLENIMDPWSQQVKPILDKTQYSWERQAAFHFRQTLPKYLLFSNT
FT                   GKSVSGLSHSYRLHVPSMAEQVLPPGWQTSPAFTWPRYQLAVTKYQESERFHGSLYNQN
FT                   HHWAYPMVFENFIHNNENIEDEDLVAWVTVGLSHNHHSEIVPSVATPGNSAGFLLQPFD
FT                   FYNSFRRYTASPTHAQCVC"
FT   CDS             join(1185121..1186023,1186348..1187002,1188063..1188339,
FT                   1188618..1188750,1188991..1189129,1189639..1189670)
FT                   /codon_start=1
FT                   /gene="Svs1"
FT                   /locus_tag="mCG_131722"
FT                   /product="seminal vesicle secretion 1, isoform CRA_a"
FT                   /note="gene_id=mCG131722.2 transcript_id=mCT133060.1
FT                   protein_id=mCP61068.1 isoform=CRA_a"
FT                   /protein_id="EDK98593.1"
FT                   /translation="MSLVGRTLVLGWMTTILVVHMSVAKHSRWALRTKPQMLWDLSGEE
FT                   LEAVHNFVMSSKELELQPSTLLTLAKNSVFLIEMLMPKKYEVLAFLDKGAMLPLREARV
FT                   LIYFGAQEYPNVTEYAVGPVEQPMYMRKLNRKGGQQLSWASRPMSKVESALLLHTLKTA
FT                   TKPLQEFFFDTTGFTLQDCNGGCLTFTNVGPRAMTFGKRHSWFLLQRIMNDYFLQPTGL
FT                   EILLDHGSTDVQDWIVEQVWYNGKFYNSPEELAQKYADGEVDIVVLEDPLPKTTEQFPQ
FT                   FSTYKPYAEFLMPISKGGPRIAQPHVPHYRLKHNTVLYGDWNFFFKLHSSYGLQLFNVH
FT                   FRGERIAYEVGVQEVMALYRGHTAAGRKTKYMDVGWGLGGITHQLTPGIDCPHEATFLD
FT                   AIHYYDSDGPVLSRRALCIFEMPLRQYFNSNFRSSFSSYAKLSGPMLVLRTASTIHNHD
FT                   YIWDFIFHSNGMMEGKMYATGYVHATFYSSEGLLYHSRLHTHLLGNVHSHLAHYRIDLD
FT                   VAGTKNRFQTLKMRLENIMDPWSQQVKPILDKTQYSWERQAAFHFRQTLPKYLLFSNTG
FT                   KSVSGLSHSYRLHVPSMAEQVLPPGWQTSPAFTWPRYQLAVTKYQESERFHGSLYNQNH
FT                   HWAYPMVFENFIHNNENIEDEDLVAWVTVGLSHNHHSEIVPSVATPGNSAGFLLQPFDF
FT                   YNSFRRYTASPTHAQCVC"
FT   gap             1194141..1194160
FT                   /estimated_length=20
FT   CDS             complement(1196946..1197116)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140824"
FT                   /product="mCG140824"
FT                   /note="gene_id=mCG140824.0 transcript_id=mCT171691.0
FT                   protein_id=mCP94610.0"
FT                   /protein_id="EDK98592.1"
FT                   /translation="MLCTWQTLELLRDTTLRVNTVFETMPAFWKHPVSISSSFSKENPS
FT                   DTIWIPADWRF"
FT   gap             1206392..1206411
FT                   /estimated_length=20
FT   gene            complement(1216023..>1219942)
FT                   /locus_tag="mCG_140779"
FT                   /note="gene_id=mCG140779.0"
FT   mRNA            complement(join(1216023..1216498,1217948..1218015,
FT                   1219864..>1219942))
FT                   /locus_tag="mCG_140779"
FT                   /product="mCG140779"
FT                   /note="gene_id=mCG140779.0 transcript_id=mCT171441.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(1217985..1218015,1219864..>1219940))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140779"
FT                   /product="mCG140779"
FT                   /note="gene_id=mCG140779.0 transcript_id=mCT171441.0
FT                   protein_id=mCP94360.0"
FT                   /protein_id="EDK98595.1"
FT                   /translation="ERGHRGGGRRKEEPKPHCLEKLQVLRHCIFPRSDR"
FT   gene            1234084..1254324
FT                   /gene="Gpnmb"
FT                   /locus_tag="mCG_131729"
FT                   /note="gene_id=mCG131729.1"
FT   mRNA            join(1234084..1234264,1240313..1240465,1241526..1241669,
FT                   1242834..1243007,1244823..1244981,1245265..1245630,
FT                   1247939..1248037,1248553..1248655,1249347..1249555,
FT                   1253149..1253242,1253689..1254324)
FT                   /gene="Gpnmb"
FT                   /locus_tag="mCG_131729"
FT                   /product="glycoprotein (transmembrane) nmb"
FT                   /note="gene_id=mCG131729.1 transcript_id=mCT133067.1
FT                   created on 05-AUG-2002"
FT   CDS             join(1234195..1234264,1240313..1240465,1241526..1241669,
FT                   1242834..1243007,1244823..1244981,1245265..1245630,
FT                   1247939..1248037,1248553..1248655,1249347..1249555,
FT                   1253149..1253242,1253689..1253842)
FT                   /codon_start=1
FT                   /gene="Gpnmb"
FT                   /locus_tag="mCG_131729"
FT                   /product="glycoprotein (transmembrane) nmb"
FT                   /note="gene_id=mCG131729.1 transcript_id=mCT133067.1
FT                   protein_id=mCP61856.1"
FT                   /protein_id="EDK98596.1"
FT                   /translation="MESLCGVLGFLLLAAGLPLQAAKRFRDVLGHEQYPNHMREHNQLR
FT                   GWSSDENEWDEHLYPVWRRGDGRWKDSWEGGRVQAVLTSDSPALVGSNITFVVNLVFPR
FT                   CQKEDANGNIVYEKNCRNDLGLTSDLHVYNWTAGADDGDWEDGTSRSQHLRFPDRRPFP
FT                   RPHGWKKWSFVYVFHTLGQYFQKLGRCSARVSINTVNLTAGPQVMEVTVFRRYGRAYIP
FT                   ISKVKDVYVITDQIPVFVTMSQKNDRNLSDEIFLRDLPIVFDVLIHDPSHFLNDSAISY
FT                   KWNFGDNTGLFVSNNHTLNHTYVLNGTFNLNLTVQTAVPGPCPPPSPSTPPPPSTPPSP
FT                   PPSPLPTLSTPSPSLMPTGYKSMELSDISNENCRINRYGYFRATITIVEGILEVSIMQI
FT                   ADVPMPTPQPANSLMDFTVTCKGATPMEACTIISDPTCQIAQNRVCSPVAVDGLCLLSV
FT                   RRAFNGSGTYCVNFTLGDDASLALTSTLISIPGKDPDSPLRAVNGVLISIGCLAVLVTM
FT                   VTILLYKKHKAYKPIGNCPRNTVKGKGLSVLLSHAKAPFFRGDQEKDPLLQDKPRTL"
FT   gap             1258079..1258113
FT                   /estimated_length=35
FT   gap             1262368..1262800
FT                   /estimated_length=433
FT   gap             1266183..1266449
FT                   /estimated_length=267
FT   gene            1271786..1282655
FT                   /locus_tag="mCG_131733"
FT                   /note="gene_id=mCG131733.1"
FT   mRNA            join(1271786..1272046,1273029..1273207,1280783..1280864,
FT                   1282441..1282655)
FT                   /locus_tag="mCG_131733"
FT                   /product="mCG131733"
FT                   /note="gene_id=mCG131733.1 transcript_id=mCT133071.0
FT                   created on 05-AUG-2002"
FT   CDS             join(1271809..1272046,1273029..1273207,1280783..1280864,
FT                   1282441..1282628)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131733"
FT                   /product="mCG131733"
FT                   /note="gene_id=mCG131733.1 transcript_id=mCT133071.0
FT                   protein_id=mCP60972.1"
FT                   /protein_id="EDK98597.1"
FT                   /translation="MGPGWSPARRLWPLLWRRAVFQRAGPAMASVPWLPRLAERWLPAR
FT                   PATCLTPSLTRGLHHGPQPEERTAGDARLQPGPADHIGAKFDIDMLVSLLRQENARDIC
FT                   VIQVPPEMRYTDYFVIGSGTSTRHLHAMVHYLVKMYKHLKCRSDPYVKIEGKDADDWLC
FT                   VDFGSMVIHLMLPETRETYELEKLWTLRSFDDQLAQIAAETLPEDFILGLEDDTSSLTP
FT                   VEFKCK"
FT   gene            complement(1283162..1412602)
FT                   /gene="Igf2bp3"
FT                   /locus_tag="mCG_131719"
FT                   /note="gene_id=mCG131719.1"
FT   mRNA            complement(join(1283162..1285378,1285706..1285819,
FT                   1286368..1286499,1288914..1288988,1292078..1292194,
FT                   1302151..1302276,1303547..1303682,1305319..1305441,
FT                   1306903..1307037,1315127..1315408,1332657..1332720,
FT                   1332809..1332860,1366334..1366382,1411036..1411096,
FT                   1412043..1412602))
FT                   /gene="Igf2bp3"
FT                   /locus_tag="mCG_131719"
FT                   /product="insulin-like growth factor 2 mRNA binding protein
FT                   3, transcript variant mCT133057"
FT                   /note="gene_id=mCG131719.1 transcript_id=mCT133057.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(1285280..1285378,1285706..1285819,
FT                   1286368..1286499,1288914..1288988,1292078..1292194,
FT                   1302151..1302276,1303547..1303682,1305319..1305441,
FT                   1306903..1307037,1315127..1315408,1332657..1332720,
FT                   1332809..1332860,1366334..1366382,1411036..1411096,
FT                   1412043..1412217))
FT                   /codon_start=1
FT                   /gene="Igf2bp3"
FT                   /locus_tag="mCG_131719"
FT                   /product="insulin-like growth factor 2 mRNA binding protein
FT                   3, isoform CRA_b"
FT                   /note="gene_id=mCG131719.1 transcript_id=mCT133057.1
FT                   protein_id=mCP61004.1 isoform=CRA_b"
FT                   /protein_id="EDK98599.1"
FT                   /translation="MNKLYIGNLSDHAGPADLESVFKDAKIPVAGPFLVKTGYAFVDCP
FT                   DEGWALKAIEALSGKMELHGKPMEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQY
FT                   GVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDETAAQQN
FT                   PSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNIT
FT                   KQTQSKIDVHRKENTGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKI
FT                   LAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGSVETCAKAE
FT                   EEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSTLTPPYPQ
FT                   FEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITG
FT                   PPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQSLS
FT                   SAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQS
FT                   RRK"
FT   mRNA            complement(join(1291049..1292194,1302151..1302276,
FT                   1303547..1303682,1305319..1307037,1315127..1315408,
FT                   1332657..1332720,1332809..1332860,1366334..1366382,
FT                   1411036..1411096,1411414..>1411909))
FT                   /gene="Igf2bp3"
FT                   /locus_tag="mCG_131719"
FT                   /product="insulin-like growth factor 2 mRNA binding protein
FT                   3, transcript variant mCT189074"
FT                   /note="gene_id=mCG131719.1 transcript_id=mCT189074.0
FT                   created on 08-MAR-2004"
FT   gap             1292590..1292635
FT                   /estimated_length=46
FT   CDS             complement(join(1306899..1307037,1315127..1315408,
FT                   1332657..1332720,1332809..1332860,1366334..1366382,
FT                   1411036..1411096,1411414..>1411561))
FT                   /codon_start=1
FT                   /gene="Igf2bp3"
FT                   /locus_tag="mCG_131719"
FT                   /product="insulin-like growth factor 2 mRNA binding protein
FT                   3, isoform CRA_a"
FT                   /note="gene_id=mCG131719.1 transcript_id=mCT189074.0
FT                   protein_id=mCP110067.0 isoform=CRA_a"
FT                   /protein_id="EDK98598.1"
FT                   /translation="WVSARGPAPRPPNLLLAPWLFNPIAQCSRPTWMWTRKKAARPHGR
FT                   LFVGGKMELHGKPMEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQV
FT                   NTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDETAAQQNPSPQLRGRR
FT                   GPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDV
FT                   HRKENTGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKL"
FT   gap             1370841..1370901
FT                   /estimated_length=61
FT   gap             1398226..1398245
FT                   /estimated_length=20
FT   gap             1410300..1410319
FT                   /estimated_length=20
FT   gap             1411910..1411961
FT                   /estimated_length=52
FT   gap             1430575..1430853
FT                   /estimated_length=279
FT   gap             1439479..1439552
FT                   /estimated_length=74
FT   gene            complement(1441551..1461730)
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /note="gene_id=mCG131730.1"
FT   mRNA            complement(join(1441551..1442358,1442495..1442562,
FT                   1443096..1443227,1444469..1444584,1446611..1446799,
FT                   1448488..1448647,1450044..1450177,1461523..1461730))
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /product="RIKEN cDNA G430041M01, transcript variant
FT                   mCT133068"
FT                   /note="gene_id=mCG131730.1 transcript_id=mCT133068.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(1441555..1442358,1442495..1442562,
FT                   1443096..1443230,1444469..1444584,1446611..1446799,
FT                   1448488..1448647,1450044..1450177,1461523..>1461718))
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /product="RIKEN cDNA G430041M01, transcript variant
FT                   mCT189070"
FT                   /note="gene_id=mCG131730.1 transcript_id=mCT189070.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(1441555..1442358,1442495..1442562,
FT                   1443096..1443230,1444469..1444584,1446611..1446799,
FT                   1448488..1448647,1450044..1450177,1450465..1450770,
FT                   1461523..>1461696))
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /product="RIKEN cDNA G430041M01, transcript variant
FT                   mCT189068"
FT                   /note="gene_id=mCG131730.1 transcript_id=mCT189068.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(1441555..1442358,1442495..1442562,
FT                   1443102..1443230,1444469..1444584,1446611..1446799,
FT                   1448488..1448647,1450044..1450177,1461523..>1461695))
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /product="RIKEN cDNA G430041M01, transcript variant
FT                   mCT189069"
FT                   /note="gene_id=mCG131730.1 transcript_id=mCT189069.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(1442348..1442358,1442495..1442562,
FT                   1443102..1443230,1444469..1444584,1446611..1446799,
FT                   1448488..1448647,1450044..1450177,1461523..>1461618))
FT                   /codon_start=1
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /product="RIKEN cDNA G430041M01, isoform CRA_c"
FT                   /note="gene_id=mCG131730.1 transcript_id=mCT189069.0
FT                   protein_id=mCP110074.0 isoform=CRA_c"
FT                   /protein_id="EDK98602.1"
FT                   /translation="AVGPRAETYLLFSSRERLADMSDVEENNFEGRESRSQSKSPTGTP
FT                   ARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHRRRSRSRS
FT                   YTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPL
FT                   SGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPT
FT                   PGIYMGRPTHSGGGGGGGGGGGGGGGGGGRRRDSYYDRGYDRGYDRYEDYDYRRRSPSP
FT                   YYSRYRSRSRSRSYSPRRY"
FT   CDS             complement(join(1442348..1442358,1442495..1442562,
FT                   1443096..1443230,1444469..1444584,1446611..1446799,
FT                   1448488..1448647,1450044..1450177,1461523..>1461618))
FT                   /codon_start=1
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /product="RIKEN cDNA G430041M01, isoform CRA_d"
FT                   /note="gene_id=mCG131730.1 transcript_id=mCT189070.0
FT                   protein_id=mCP110075.0 isoform=CRA_d"
FT                   /protein_id="EDK98603.1"
FT                   /translation="AVGPRAETYLLFSSRERLADMSDVEENNFEGRESRSQSKSPTGTP
FT                   ARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHRRRSRSRS
FT                   YTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPL
FT                   SGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPT
FT                   PGIYMGRPTHSGGGGGGGGGGGGGGGGGGRRRDSYYDRGYDRGYDRYEDYDYRYRRRSP
FT                   SPYYSRYRSRSRSRSYSPRRY"
FT   CDS             complement(join(1442348..1442358,1442495..1442562,
FT                   1443096..1443227,1444469..1444584,1446611..1446799,
FT                   1448488..1448647,1450044..1450177,1461523..1461558))
FT                   /codon_start=1
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /product="RIKEN cDNA G430041M01, isoform CRA_a"
FT                   /note="gene_id=mCG131730.1 transcript_id=mCT133068.1
FT                   protein_id=mCP61882.1 isoform=CRA_a"
FT                   /protein_id="EDK98600.1"
FT                   /translation="MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKH
FT                   SESHSRSRSKSRSRSRRHSHRRYTRSRSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRR
FT                   RHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFV
FT                   YFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHGGGGGGGGGG
FT                   GGGGGGGGRRRDSYYDRGYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
FT                   "
FT   CDS             complement(join(1442348..1442358,1442495..1442562,
FT                   1443096..1443230,1444469..1444584,1446611..1446799,
FT                   1448488..1448647,1450044..>1450177))
FT                   /codon_start=1
FT                   /gene="G430041M01Rik"
FT                   /locus_tag="mCG_131730"
FT                   /product="RIKEN cDNA G430041M01, isoform CRA_b"
FT                   /note="gene_id=mCG131730.1 transcript_id=mCT189068.0
FT                   protein_id=mCP110073.0 isoform=CRA_b"
FT                   /protein_id="EDK98601.1"
FT                   /translation="ESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSR
FT                   SRSRRHSHRRYTRSRSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPN
FT                   TCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAM
FT                   ERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGRRR
FT                   DSYYDRGYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY"
FT   gene            1446152..1454444
FT                   /locus_tag="mCG_140828"
FT                   /note="gene_id=mCG140828.0"
FT   mRNA            join(1446152..1446322,1453948..1454444)
FT                   /locus_tag="mCG_140828"
FT                   /product="mCG140828"
FT                   /note="gene_id=mCG140828.0 transcript_id=mCT171697.0
FT                   created on 05-AUG-2002"
FT   CDS             join(1446219..1446322,1453948..1454122)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140828"
FT                   /product="mCG140828"
FT                   /note="gene_id=mCG140828.0 transcript_id=mCT171697.0
FT                   protein_id=mCP94616.0"
FT                   /protein_id="EDK98604.1"
FT                   /translation="MGSCEPPCGCWDLNPGPSEEQLVFLTTETSLQPTLRSLLEVGLIK
FT                   QTFPVSNQVATRSTSRKPKYVLFKISNNFISFKIILVRCTRMSIWSP"
FT   gap             1455679..1455698
FT                   /estimated_length=20
FT   gap             1479240..1479265
FT                   /estimated_length=26
FT   gene            1516735..1538948
FT                   /gene="6330407D12Rik"
FT                   /locus_tag="mCG_131724"
FT                   /note="gene_id=mCG131724.1"
FT   mRNA            join(1516735..1516899,1527066..1527153,1531562..1531948,
FT                   1536630..1536699,1537193..1538948)
FT                   /gene="6330407D12Rik"
FT                   /locus_tag="mCG_131724"
FT                   /product="RIKEN cDNA 6330407D12, transcript variant
FT                   mCT171688"
FT                   /note="gene_id=mCG131724.1 transcript_id=mCT171688.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(1516735..1516899,1527066..1527153,1531562..1531948,
FT                   1537193..1538948)
FT                   /gene="6330407D12Rik"
FT                   /locus_tag="mCG_131724"
FT                   /product="RIKEN cDNA 6330407D12, transcript variant
FT                   mCT133062"
FT                   /note="gene_id=mCG131724.1 transcript_id=mCT133062.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(1516735..1516899,1531562..1531948,1537193..1538948)
FT                   /gene="6330407D12Rik"
FT                   /locus_tag="mCG_131724"
FT                   /product="RIKEN cDNA 6330407D12, transcript variant
FT                   mCT171687"
FT                   /note="gene_id=mCG131724.1 transcript_id=mCT171687.0
FT                   created on 05-AUG-2002"
FT   gap             1522543..1522933
FT                   /estimated_length=391
FT   CDS             join(1531711..1531948,1537193..1537377)
FT                   /codon_start=1
FT                   /gene="6330407D12Rik"
FT                   /locus_tag="mCG_131724"
FT                   /product="RIKEN cDNA 6330407D12, isoform CRA_a"
FT                   /note="gene_id=mCG131724.1 transcript_id=mCT133062.1
FT                   protein_id=mCP61707.1 isoform=CRA_a"
FT                   /protein_id="EDK98605.1"
FT                   /translation="MFRTISRKNMSQKLSFLLLVFGLIWGLMLLHYTLQQPRRQSSVKL
FT                   REQILDLSKRYVKALAEESRSTADVDSGASMAGYADLKRTIAVLLDDILQRLVKLESKV
FT                   DYIVVNGSATNTTNGTNGNLVPVTTNKRTSVSGSVR"
FT   CDS             join(1531711..1531948,1537193..1537377)
FT                   /codon_start=1
FT                   /gene="6330407D12Rik"
FT                   /locus_tag="mCG_131724"
FT                   /product="RIKEN cDNA 6330407D12, isoform CRA_a"
FT                   /note="gene_id=mCG131724.1 transcript_id=mCT171687.0
FT                   protein_id=mCP94607.0 isoform=CRA_a"
FT                   /protein_id="EDK98606.1"
FT                   /translation="MFRTISRKNMSQKLSFLLLVFGLIWGLMLLHYTLQQPRRQSSVKL
FT                   REQILDLSKRYVKALAEESRSTADVDSGASMAGYADLKRTIAVLLDDILQRLVKLESKV
FT                   DYIVVNGSATNTTNGTNGNLVPVTTNKRTSVSGSVR"
FT   CDS             join(1531711..1531948,1536630..1536699,1537193..1537196)
FT                   /codon_start=1
FT                   /gene="6330407D12Rik"
FT                   /locus_tag="mCG_131724"
FT                   /product="RIKEN cDNA 6330407D12, isoform CRA_b"
FT                   /note="gene_id=mCG131724.1 transcript_id=mCT171688.0
FT                   protein_id=mCP94606.0 isoform=CRA_b"
FT                   /protein_id="EDK98607.1"
FT                   /translation="MFRTISRKNMSQKLSFLLLVFGLIWGLMLLHYTLQQPRRQSSVKL
FT                   REQILDLSKRYVKALAEESRSTADVDSGASMAGYVLHLPGPASLYLLSNSASQEMTHC"
FT   gap             1532258..1532461
FT                   /estimated_length=204
FT   gap             1546535..1548023
FT                   /estimated_length=1489
FT   gap             1556671..1556690
FT                   /estimated_length=20
FT   gene            1565958..1589274
FT                   /gene="D330028D13Rik"
FT                   /locus_tag="mCG_131728"
FT                   /note="gene_id=mCG131728.1"
FT   mRNA            join(1565958..1566113,1572034..1572207,1575568..1575758,
FT                   1577762..1577968,1583259..1583375,1584869..1584948,
FT                   1588814..1589274)
FT                   /gene="D330028D13Rik"
FT                   /locus_tag="mCG_131728"
FT                   /product="RIKEN cDNA D330028D13, transcript variant
FT                   mCT133066"
FT                   /note="gene_id=mCG131728.1 transcript_id=mCT133066.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(<1565959..1566113,1572034..1572207,1575568..1575758,
FT                   1577762..1577968,1583259..1583375,1588814..1589274)
FT                   /gene="D330028D13Rik"
FT                   /locus_tag="mCG_131728"
FT                   /product="RIKEN cDNA D330028D13, transcript variant
FT                   mCT189076"
FT                   /note="gene_id=mCG131728.1 transcript_id=mCT189076.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1565959..1566113,1572034..1572207,1575568..1575758,
FT                   1577762..1577968,1583259..1583375,1588814..1588836)
FT                   /codon_start=1
FT                   /gene="D330028D13Rik"
FT                   /locus_tag="mCG_131728"
FT                   /product="RIKEN cDNA D330028D13, isoform CRA_c"
FT                   /note="gene_id=mCG131728.1 transcript_id=mCT189076.0
FT                   protein_id=mCP110072.0 isoform=CRA_c"
FT                   /protein_id="EDK98610.1"
FT                   /translation="VTRAGLVDPAWQLQGGLKSSRQGLLSLPAAMERLTLPPGGAEAVD
FT                   EYLEYRRIVGEDDGGKLFTPEEYEEYKKKVLPMRLQNRLFVSWRSPTGMDCKLVGPETL
FT                   CFCTHRYKQHKTDFETIPQQRPIALPCRVSGCRCKAYHYVPLNGTQPIRCRCKHFADQH
FT                   SAALGFTCNACSKCSGFHSCYTCACGQPAYAHDTVVETRQERLAQGKPVGRDVPYAAMG
FT                   GLTGFSSLAEGYMRLDDSGIGAPSVEVLDSAVSAMDHPFLRAMHAPSTSSPQPLAGGNE
FT                   DKAGKGC"
FT   mRNA            join(<1565965..1566113,1572034..1572207,1575568..1575758,
FT                   1577762..1577968,1583259..1583375,1584866..1584948,
FT                   1588814..1589274)
FT                   /gene="D330028D13Rik"
FT                   /locus_tag="mCG_131728"
FT                   /product="RIKEN cDNA D330028D13, transcript variant
FT                   mCT189075"
FT                   /note="gene_id=mCG131728.1 transcript_id=mCT189075.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1565965..1566113,1572034..1572207,1575568..1575758,
FT                   1577762..1577968,1583259..1583375,1584866..1584948,
FT                   1588814..1588882)
FT                   /codon_start=1
FT                   /gene="D330028D13Rik"
FT                   /locus_tag="mCG_131728"
FT                   /product="RIKEN cDNA D330028D13, isoform CRA_b"
FT                   /note="gene_id=mCG131728.1 transcript_id=mCT189075.0
FT                   protein_id=mCP110071.0 isoform=CRA_b"
FT                   /protein_id="EDK98609.1"
FT                   /translation="RAGLVDPAWQLQGGLKSSRQGLLSLPAAMERLTLPPGGAEAVDEY
FT                   LEYRRIVGEDDGGKLFTPEEYEEYKKKVLPMRLQNRLFVSWRSPTGMDCKLVGPETLCF
FT                   CTHRYKQHKTDFETIPQQRPIALPCRVSGCRCKAYHYVPLNGTQPIRCRCKHFADQHSA
FT                   ALGFTCNACSKCSGFHSCYTCACGQPAYAHDTVVETRQERLAQGKPVGRDVPYAAMGGL
FT                   TGFSSLAEGYMRLDDSGIGAPSVEVLDSAVSAMDHPFLRAMHAPSTSSPQPLAGGNEVG
FT                   PSTQLSSLRKPEEDDMAYFERQYQERIKLEKAAKQKGKVPPLPSTKPS"
FT   CDS             join(1566049..1566113,1572034..1572207,1575568..1575758,
FT                   1577762..1577968,1583259..1583375,1584869..1584948,
FT                   1588814..1588882)
FT                   /codon_start=1
FT                   /gene="D330028D13Rik"
FT                   /locus_tag="mCG_131728"
FT                   /product="RIKEN cDNA D330028D13, isoform CRA_a"
FT                   /note="gene_id=mCG131728.1 transcript_id=mCT133066.0
FT                   protein_id=mCP61815.1 isoform=CRA_a"
FT                   /protein_id="EDK98608.1"
FT                   /translation="MERLTLPPGGAEAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKKKV
FT                   LPMRLQNRLFVSWRSPTGMDCKLVGPETLCFCTHRYKQHKTDFETIPQQRPIALPCRVS
FT                   GCRCKAYHYVPLNGTQPIRCRCKHFADQHSAALGFTCNACSKCSGFHSCYTCACGQPAY
FT                   AHDTVVETRQERLAQGKPVGRDVPYAAMGGLTGFSSLAEGYMRLDDSGIGAPSVEVLDS
FT                   AVSAMDHPFLRAMHAPSTSSPQPLAGGNEGPSTQLSSLRKPEEDDMAYFERQYQERIKL
FT                   EKAAKQKGKVPPLPSTKPS"
FT   gap             1568928..1568947
FT                   /estimated_length=20
FT   gap             1570045..1570064
FT                   /estimated_length=20
FT   gap             1579244..1579263
FT                   /estimated_length=20
FT   gap             1583694..1584100
FT                   /estimated_length=407
FT   gene            complement(1589418..>1589900)
FT                   /locus_tag="mCG_140814"
FT                   /note="gene_id=mCG140814.0"
FT   mRNA            complement(1589418..>1589900)
FT                   /locus_tag="mCG_140814"
FT                   /product="mCG140814"
FT                   /note="gene_id=mCG140814.0 transcript_id=mCT171642.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(1589647..>1589898)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140814"
FT                   /product="mCG140814"
FT                   /note="gene_id=mCG140814.0 transcript_id=mCT171642.0
FT                   protein_id=mCP94561.0"
FT                   /protein_id="EDK98611.1"
FT                   /translation="PSLLVFLFIEVALQTTICYTVLGFWGGGCCTNSFTCKSILQLVIG
FT                   LIQCFWFPKHHKYWVTAKTPTQRQGDSVGGWYGWGHNT"
FT   gap             1593185..1593376
FT                   /estimated_length=192
FT   gene            1595645..1672006
FT                   /gene="Stk31"
FT                   /locus_tag="mCG_131726"
FT                   /note="gene_id=mCG131726.1"
FT   mRNA            join(1595645..1595725,1598096..1598142,1598231..1598283,
FT                   1604802..1604900,1609320..1609478,1617433..1617791,
FT                   1619399..1619573,1621901..1622016,1623593..1623752,
FT                   1625921..1626043,1637569..1637751,1638192..1638308,
FT                   1638668..1638787,1639317..1639448,1641074..1641175,
FT                   1642471..1642551,1645402..1645527,1646328..1646453,
FT                   1646625..1646711,1647478..1647627,1657575..1657697,
FT                   1667971..1668039,1671633..1672006)
FT                   /gene="Stk31"
FT                   /locus_tag="mCG_131726"
FT                   /product="serine threonine kinase 31"
FT                   /note="gene_id=mCG131726.1 transcript_id=mCT133064.1
FT                   created on 05-AUG-2002"
FT   CDS             join(1595676..1595725,1598096..1598142,1598231..1598283,
FT                   1604802..1604900,1609320..1609478,1617433..1617791,
FT                   1619399..1619573,1621901..1622016,1623593..1623752,
FT                   1625921..1626043,1637569..1637751,1638192..1638308,
FT                   1638668..1638787,1639317..1639448,1641074..1641175,
FT                   1642471..1642551,1645402..1645527,1646328..1646453,
FT                   1646625..1646711,1647478..1647627,1657575..1657697,
FT                   1667971..1668039,1671633..1671857)
FT                   /codon_start=1
FT                   /gene="Stk31"
FT                   /locus_tag="mCG_131726"
FT                   /product="serine threonine kinase 31"
FT                   /note="gene_id=mCG131726.1 transcript_id=mCT133064.1
FT                   protein_id=mCP61735.1"
FT                   /protein_id="EDK98612.1"
FT                   /translation="MWGQRLFAGTAVAQSVSFPGLVQMDEDTHYNKVEDVVGSHVEDAV
FT                   TFWAQNVSKNKDIMKIGCSLSEVCPLANSVFGNLDPKKCLVRYIDYGNTEILNRSDIVE
FT                   IPPELQFSSIAKKYRLWGLQIPSGQEVTQFDQGRTFLGSLIFEKEIKMRIKATYQDGTV
FT                   IAQAEYGTVDIGEEVAKKGFAEKCRLTSGIDACEAKKPDPNQLALRSLKNPIPLWGRRS
FT                   NQSTFSRPKGHFNGRLTLDVKYETSAGNHVTFPKESLAAGDFNLGSNVSLAKIKQDQKL
FT                   IEENEKLKTEKEVLLENYKALELKVEQTAQELQQEKTATMDLTKHLESTLKTCVGTRLK
FT                   NLAAKVELLKEIRHINISIRFGNDLSDAMQVLDEGSFTTLASLNELEKIWAEYNVAQEK
FT                   IQTCLNENEGNILIAERNEVQQKLFVAVDVFILEVDDLPLDKRLKTLQDLATSLESVYG
FT                   KAKEGTNNSEETLRKFYDWQCTKREEFASIRSETEASLQHLVAWFQSSQKVFDLSLDEP
FT                   LTSEDLIGNIDEILEKTESCVCKELELSLIEQGVIDKEIILITYSQVLQKIHSEEKFIA
FT                   TLLSKYKDSVEFKKQMIDCLNKNPNVDYLLSIKKTLKGLKAQLRWKLVEKSNLEESDDH
FT                   DGTEIEKIKQEITQLRNSVFQEIYHEREEYEKLNSLTQKWFPELPLLYPEIGLLKYMNS
FT                   GGLLTMSLERDLLDTEPMKELSSKRPLVCSEVNGQPVLLKGYSVDVDTEGRVIQRAASY
FT                   HRACGYAKEESGLLPLIFLFLCKSDPVAYLMVPYYPKANLSAVQASMPLTSEEALKVMK
FT                   GVARGLHTLHSANIIHGSLHQNNVFALNREQGIVGDYDFTKSESQRASVNAMVGGLSLL
FT                   SPELKTGKPPSASSDLYAYGCLFLWLSVQNQEFETNEDGIPKVDQFHLDDNVKSLLCSL
FT                   IYFRSSMTAEQVLNAECFLLPKGKSVPIPEKEIECTQHSREDESKMESLDRYSEKTRNG
FT                   EANP"
FT   gap             1606295..1607048
FT                   /estimated_length=754
FT   gap             1613350..1613385
FT                   /estimated_length=36
FT   gap             1621032..1621051
FT                   /estimated_length=20
FT   gap             1651143..1651834
FT                   /estimated_length=692
FT   gene            complement(1745440..1746185)
FT                   /pseudo
FT                   /locus_tag="mCG_1036416"
FT                   /note="gene_id=mCG1036416.1"
FT   mRNA            complement(1745440..1746185)
FT                   /pseudo
FT                   /locus_tag="mCG_1036416"
FT                   /note="gene_id=mCG1036416.1 transcript_id=mCT154120.1
FT                   created on 06-AUG-2002"
FT   gap             1767480..1768240
FT                   /estimated_length=761
FT   gap             1781713..1782150
FT                   /estimated_length=438
FT   gap             1784351..1784370
FT                   /estimated_length=20
FT   gap             1831740..1831759
FT                   /estimated_length=20
FT   gap             1938943..1942377
FT                   /estimated_length=3435
FT   gap             1960278..1960380
FT                   /estimated_length=103
FT   gap             2008584..2008603
FT                   /estimated_length=20
FT   gap             2012688..2012715
FT                   /estimated_length=28
FT   gap             2020508..2021353
FT                   /estimated_length=846
FT   gene            2022023..2028814
FT                   /gene="Npy"
FT                   /locus_tag="mCG_119908"
FT                   /note="gene_id=mCG119908.1"
FT   mRNA            join(2022023..2022122,2022919..2023106,2026800..2026880,
FT                   2028614..2028814)
FT                   /gene="Npy"
FT                   /locus_tag="mCG_119908"
FT                   /product="neuropeptide Y"
FT                   /note="gene_id=mCG119908.1 transcript_id=mCT121086.1
FT                   created on 05-AUG-2002"
FT   CDS             join(2022919..2023106,2026800..2026880,2028614..2028638)
FT                   /codon_start=1
FT                   /gene="Npy"
FT                   /locus_tag="mCG_119908"
FT                   /product="neuropeptide Y"
FT                   /note="gene_id=mCG119908.1 transcript_id=mCT121086.1
FT                   protein_id=mCP61556.0"
FT                   /protein_id="EDK98613.1"
FT                   /translation="MLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDM
FT                   ARYYSALRHYINLITRQRYGKRSSPETLISDLLMKESTENAPRTRLEDPSMW"
FT   gap             2057570..2057589
FT                   /estimated_length=20
FT   gap             2084501..2089520
FT                   /estimated_length=5020
FT   gap             2090292..2090319
FT                   /estimated_length=28
FT   gap             2102887..2102906
FT                   /estimated_length=20
FT   gap             2116944..2116963
FT                   /estimated_length=20
FT   gap             2118788..2119582
FT                   /estimated_length=795
FT   gap             2125813..2125832
FT                   /estimated_length=20
FT   gap             2128338..2128357
FT                   /estimated_length=20
FT   gap             2133343..2133404
FT                   /estimated_length=62
FT   gap             2171325..2171810
FT                   /estimated_length=486
FT   gap             2172752..2172962
FT                   /estimated_length=211
FT   gap             2198945..2199236
FT                   /estimated_length=292
FT   gap             2214308..2214453
FT                   /estimated_length=146
FT   gap             2221441..2221460
FT                   /estimated_length=20
FT   gap             2245319..2245699
FT                   /estimated_length=381
FT   gene            2248028..2303973
FT                   /locus_tag="mCG_146890"
FT                   /note="gene_id=mCG146890.0"
FT   mRNA            join(2248028..2248287,2302277..2303973)
FT                   /locus_tag="mCG_146890"
FT                   /product="mCG146890"
FT                   /note="gene_id=mCG146890.0 transcript_id=mCT187153.0
FT                   created on 13-JAN-2004"
FT   CDS             join(2248255..2248287,2302277..2302435)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146890"
FT                   /product="mCG146890"
FT                   /note="gene_id=mCG146890.0 transcript_id=mCT187153.0
FT                   protein_id=mCP109104.0"
FT                   /protein_id="EDK98614.1"
FT                   /translation="MLTLATTSHKIMEILKSQYGVENKPEGRRDGWKPGSSRLEFYAFP
FT                   QKSSLPLVEHVCLRSGRR"
FT   gap             2248814..2248833
FT                   /estimated_length=20
FT   gap             2251256..2251764
FT                   /estimated_length=509
FT   gene            2306589..2396123
FT                   /gene="Mpp6"
FT                   /locus_tag="mCG_119906"
FT                   /note="gene_id=mCG119906.1"
FT   mRNA            join(2306589..2306810,2341335..2341400,2343392..2343510,
FT                   2356314..2356466,2360211..2360360,2361054..2361281,
FT                   2374492..2374533,2376005..2376136,2377792..2377891,
FT                   2378207..2378275,2381327..2381488,2392148..2392350,
FT                   2394136..2394264,2395697..2396123)
FT                   /gene="Mpp6"
FT                   /locus_tag="mCG_119906"
FT                   /product="membrane protein, palmitoylated 6 (MAGUK p55
FT                   subfamily member 6), transcript variant mCT121084"
FT                   /note="gene_id=mCG119906.1 transcript_id=mCT121084.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(2306589..2306810,2341335..2341400,2343392..2343510,
FT                   2356314..2356466,2360211..2360360,2361054..2361281,
FT                   2376005..2376136,2377792..2377891,2378207..2378275,
FT                   2381327..2381488,2392148..2392350,2394136..2394264,
FT                   2395697..2396123)
FT                   /gene="Mpp6"
FT                   /locus_tag="mCG_119906"
FT                   /product="membrane protein, palmitoylated 6 (MAGUK p55
FT                   subfamily member 6), transcript variant mCT171649"
FT                   /note="gene_id=mCG119906.1 transcript_id=mCT171649.0
FT                   created on 05-AUG-2002"
FT   gap             2306961..2307062
FT                   /estimated_length=102
FT   gap             2323765..2323784
FT                   /estimated_length=20
FT   gap             2337222..2337241
FT                   /estimated_length=20
FT   CDS             join(2343394..2343510,2356314..2356466,2360211..2360360,
FT                   2361054..2361281,2374492..2374533,2376005..2376136,
FT                   2377792..2377891,2378207..2378275,2381327..2381488,
FT                   2392148..2392350,2394136..2394264,2395697..2395873)
FT                   /codon_start=1
FT                   /gene="Mpp6"
FT                   /locus_tag="mCG_119906"
FT                   /product="membrane protein, palmitoylated 6 (MAGUK p55
FT                   subfamily member 6), isoform CRA_b"
FT                   /note="gene_id=mCG119906.1 transcript_id=mCT121084.1
FT                   protein_id=mCP61507.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UN60"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004172"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR014775"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1927340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UN60"
FT                   /protein_id="EDK98616.1"
FT                   /translation="MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLE
FT                   DSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCY
FT                   DSPPSSPEMNIPSLNNQLPVDAIRILGIHKKAGEPLGVTFRVENNDLVIARILHGGMID
FT                   RQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQSYVNME
FT                   RHPAHVRQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEG
FT                   GSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAEFDRHEIQIY
FT                   EEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQA
FT                   YKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLR
FT                   TSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYF
FT                   DLIIVNDNLDKAFEKLQTAIEKLRMEPQWVPISWVY"
FT   CDS             join(2343394..2343510,2356314..2356466,2360211..2360360,
FT                   2361054..2361281,2376005..2376136,2377792..2377891,
FT                   2378207..2378275,2381327..2381488,2392148..2392350,
FT                   2394136..2394264,2395697..2395873)
FT                   /codon_start=1
FT                   /gene="Mpp6"
FT                   /locus_tag="mCG_119906"
FT                   /product="membrane protein, palmitoylated 6 (MAGUK p55
FT                   subfamily member 6), isoform CRA_a"
FT                   /note="gene_id=mCG119906.1 transcript_id=mCT171649.0
FT                   protein_id=mCP94568.0 isoform=CRA_a"
FT                   /db_xref="GOA:B9EHZ5"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004172"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR014775"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1927340"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHZ5"
FT                   /protein_id="EDK98615.1"
FT                   /translation="MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLE
FT                   DSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCY
FT                   DSPPSSPEMNIPSLNNQLPVDAIRILGIHKKAGEPLGVTFRVENNDLVIARILHGGMID
FT                   RQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCH
FT                   FDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEK
FT                   RKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTL
FT                   VLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIK
FT                   AGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAP
FT                   ELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFE
FT                   KLQTAIEKLRMEPQWVPISWVY"
FT   gene            2397730..2400672
FT                   /gene="Fin15"
FT                   /locus_tag="mCG_1050539"
FT                   /note="gene_id=mCG1050539.0"
FT   mRNA            2397730..2400672
FT                   /gene="Fin15"
FT                   /locus_tag="mCG_1050539"
FT                   /product="fibroblast growth factor inducible 15"
FT                   /note="gene_id=mCG1050539.0 transcript_id=mCT194568.0
FT                   created on 24-NOV-2004"
FT   CDS             2399459..2399734
FT                   /codon_start=1
FT                   /gene="Fin15"
FT                   /locus_tag="mCG_1050539"
FT                   /product="fibroblast growth factor inducible 15"
FT                   /note="gene_id=mCG1050539.0 transcript_id=mCT194568.0
FT                   protein_id=mCP115597.0"
FT                   /protein_id="EDK98617.1"
FT                   /translation="MDIHTHTHKATCIIRSILPKFMNNKARYICPHVTASILRSLITFR
FT                   FVDILALYEVLLRGFGSTLELTLIPFLNILFIRETKFRKLLLTIRI"
FT   gap             2405212..2409374
FT                   /estimated_length=4163
FT   gene            complement(2412036..2468435)
FT                   /gene="Dfna5h"
FT                   /locus_tag="mCG_119909"
FT                   /note="gene_id=mCG119909.1"
FT   mRNA            complement(join(2412036..2412838,2420982..2421055,
FT                   2423874..2424075,2425626..2425753,2427383..2427547,
FT                   2431904..2432024,2433855..2434026,2450492..2450684,
FT                   2455846..2456083,2466306..2466489,2468216..2468435))
FT                   /gene="Dfna5h"
FT                   /locus_tag="mCG_119909"
FT                   /product="deafness, autosomal dominant 5 homolog (human)"
FT                   /note="gene_id=mCG119909.1 transcript_id=mCT121087.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(2412566..2412838,2420982..2421055,
FT                   2423874..2424075,2425626..2425753,2427383..2427547,
FT                   2431904..2432024,2433855..2434026,2450492..2450684,
FT                   2455846..2456056))
FT                   /codon_start=1
FT                   /gene="Dfna5h"
FT                   /locus_tag="mCG_119909"
FT                   /product="deafness, autosomal dominant 5 homolog (human)"
FT                   /note="gene_id=mCG119909.1 transcript_id=mCT121087.1
FT                   protein_id=mCP61564.1"
FT                   /db_xref="GOA:Q3TBE9"
FT                   /db_xref="InterPro:IPR007677"
FT                   /db_xref="MGI:MGI:1889850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TBE9"
FT                   /protein_id="EDK98618.1"
FT                   /translation="MFAKATRNFLKEVDAGGDLISVSHLNDSDKLQLLSLVTKKKRYWC
FT                   WQRPKYQILSATLEDVLTEGHCLSPVVVESDFVKYESKCENHKSGAIGTVVGKVKLNVG
FT                   GKGVVESHSSFGTLRKQEVDVQQLIQDAVKRTVNMDNLVLQQVLESRNEVLCVLTQKIM
FT                   TTQKCVISEHVQSEETCGGMVGIQTKTIQVSATEDGTVTTDTNVVLEIPAATTIAYGIM
FT                   ELFVKQDGQFEFCLLQGKHGGFEHERKLDSVYLDPLAYREFAFLDMPDGGQGISSQDGP
FT                   LRVVKQATLHLERSFHPFAVLPAQQQRALFCVLQKILFDEELLRALEQVCDDVAGGLWS
FT                   SQAVLAMEELTDSQQQDLTAFLQLVGYRIQGEHPGPQDEVSNQKLFATAYFLVSALAEM
FT                   PDNATVFLGTCCKLHVISSLCCLLHALSDDSVCDFHNPTLAPLRDTERFGIVQRLFASA
FT                   DIALERMQFSAKATILKDSCIFPLILHITLSGLSTLSKEHEEELCQSGHATGQD"
FT   gene            complement(2497908..2660886)
FT                   /gene="Osbpl3"
FT                   /locus_tag="mCG_119912"
FT                   /note="gene_id=mCG119912.1"
FT   mRNA            complement(join(2497908..2501738,2503893..2504015,
FT                   2505501..2505627,2507594..2507738,2512812..2512956,
FT                   2513834..2513912,2517154..2517217,2524561..2524698,
FT                   2527497..2527747,2531895..2531988,2533190..2533324,
FT                   2537730..2537837,2540759..2540889,2549412..2549568,
FT                   2550866..2550969,2551904..2552027,2552509..2552676,
FT                   2556382..2556495,2557322..2557375,2557523..2557639,
FT                   2574590..2574741,2632758..2632849,2660541..2660886))
FT                   /gene="Osbpl3"
FT                   /locus_tag="mCG_119912"
FT                   /product="oxysterol binding protein-like 3, transcript
FT                   variant mCT121090"
FT                   /note="gene_id=mCG119912.1 transcript_id=mCT121090.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(2501384..2501738,2503893..2504015,
FT                   2505501..2505627,2507594..2507738,2512812..2512956,
FT                   2513834..2513912,2517154..2517217,2524561..2524698,
FT                   2527497..2527747,2531895..2531988,2533190..2533324,
FT                   2540759..2540889,2549412..2549568,2550866..2550969,
FT                   2551904..2552027,2552509..2552676,2556382..2556495,
FT                   2557322..2557375,2557523..2557639,2574590..2574825,
FT                   2632758..>2632840))
FT                   /gene="Osbpl3"
FT                   /locus_tag="mCG_119912"
FT                   /product="oxysterol binding protein-like 3, transcript
FT                   variant mCT189062"
FT                   /note="gene_id=mCG119912.1 transcript_id=mCT189062.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(2501642..2501738,2503893..2504015,
FT                   2505501..2505627,2507594..2507738,2512812..2512956,
FT                   2513834..2513912,2517154..2517217,2524561..2524698,
FT                   2527497..2527747,2531895..2531988,2533190..2533324,
FT                   2540759..2540889,2549412..2549568,2550866..2550969,
FT                   2551904..2552027,2552509..2552676,2556382..2556495,
FT                   2557322..2557375,2557523..2557639,2574590..>2574778))
FT                   /codon_start=1
FT                   /gene="Osbpl3"
FT                   /locus_tag="mCG_119912"
FT                   /product="oxysterol binding protein-like 3, isoform CRA_b"
FT                   /note="gene_id=mCG119912.1 transcript_id=mCT189062.0
FT                   protein_id=mCP110052.0 isoform=CRA_b"
FT                   /protein_id="EDK98620.1"
FT                   /translation="ELAPACEDFILSAPPSSHGILTALSPKDQLFTMSDEKNLGVSQKL
FT                   VSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMTYTQEPPVQKGFLLKKRKWPLKGWHKRF
FT                   FCLEKGILKYAKSQADIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEE
FT                   LFDEWVSKLRHHRMYRQNEIAMFPRDVNHFFSGSSVTDSAPGVFESVSSRKRSSLSKQN
FT                   SFPPGSNLSFSCGGDTRVPFWLQSSEDMEKCSKDLAHCHAYLLEMSQLLESMDVLHRTY
FT                   SAPAINAIQVPKPFSGPVRLHSSNPNLSTLDFGEEKSYSDGSEASSEFSKMQEDLCHVA
FT                   HKVYFALRSAFNSISVEREKLKQLMELDTSPSPSAQVVGLKHALSSENSRDEGRALVHQ
FT                   LSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNLSNDLDNE
FT                   RQTLGPVLESSGEARSKRRTSLPAPGPNTSSVSLWSILRNNIGKDLSKVAMPVELNEPL
FT                   NTLQRLCEELEYSELLDKASRIPSPLERMVYVAAFAISAYASSYFRAGSKPFNPVLGET
FT                   YECIRQDKGFQFFAEQVSHHPPISACHAESGNFVFWQDVRWKNKFWGKSMEIVPIGTTH
FT                   VTLPAFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNLNDDSCHCKVNFIKAKYWST
FT                   NAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGASSSTCVWRANPMPKGYEQYYGFTQFA
FT                   LELNEMDPLSRSLLPPTDTRFRPDQRLLEEGNIEEAEVQKQRIEKLQRERRRVLEENGV
FT                   EHQPRFFRKSSDDAWVSNGTYLELRKDLGFSKLDHPVLW"
FT   CDS             complement(join(2501642..2501738,2503893..2504015,
FT                   2505501..2505627,2507594..2507738,2512812..2512956,
FT                   2513834..2513912,2517154..2517217,2524561..2524698,
FT                   2527497..2527747,2531895..2531988,2533190..2533324,
FT                   2537730..2537837,2540759..2540889,2549412..2549568,
FT                   2550866..2550969,2551904..2552027,2552509..2552676,
FT                   2556382..2556495,2557322..2557375,2557523..2557639,
FT                   2574590..2574682))
FT                   /codon_start=1
FT                   /gene="Osbpl3"
FT                   /locus_tag="mCG_119912"
FT                   /product="oxysterol binding protein-like 3, isoform CRA_a"
FT                   /note="gene_id=mCG119912.1 transcript_id=mCT121090.1
FT                   protein_id=mCP62210.1 isoform=CRA_a"
FT                   /protein_id="EDK98619.1"
FT                   /translation="MSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMT
FT                   YTQEPPVQKGFLLKKRKWPLKGWHKRFFCLEKGILKYAKSQADIEREKLHGCIDVGLSV
FT                   MSVKKSSKCIDLDTEEHIYHLKVKSEELFDEWVSKLRHHRMYRQNEIAMFPRDVNHFFS
FT                   GSSVTDSAPGVFESVSSRKRSSLSKQNSFPPGSNLSFSCGGDTRVPFWLQSSEDMEKCS
FT                   KDLAHCHAYLLEMSQLLESMDVLHRTYSAPAINAIQVPKPFSGPVRLHSSNPNLSTLDF
FT                   GEEKSYSDGSEASSEFSKMQEDLCHVAHKVYFALRSAFNSISVEREKLKQLMELDTSPS
FT                   PSAQVVGLKHALSSALAQNTDLKERLRRIHAESLLLDPPAVPKPGDNLAEENSRDEGRA
FT                   LVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDNLSLDNLSND
FT                   LDNERQTLGPVLESSGEARSKRRTSLPAPGPNTSSVSLWSILRNNIGKDLSKVAMPVEL
FT                   NEPLNTLQRLCEELEYSELLDKASRIPSPLERMVYVAAFAISAYASSYFRAGSKPFNPV
FT                   LGETYECIRQDKGFQFFAEQVSHHPPISACHAESGNFVFWQDVRWKNKFWGKSMEIVPI
FT                   GTTHVTLPAFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNLNDDSCHCKVNFIKAK
FT                   YWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGASSSTCVWRANPMPKGYEQYYGF
FT                   TQFALELNEMDPLSRSLLPPTDTRFRPDQRLLEEGNIEEAEVQKQRIEKLQRERRRVLE
FT                   ENGVEHQPRFFRKSSDDAWVSNGTYLELRKDLGFSKLDHPVLW"
FT   gap             2658614..2658938
FT                   /estimated_length=325
FT   gap             2676388..2676407
FT                   /estimated_length=20
FT   gap             2699013..2699072
FT                   /estimated_length=60
FT   gap             2738362..2738381
FT                   /estimated_length=20
FT   gap             2740974..2741045
FT                   /estimated_length=72
FT   gene            complement(2769160..2771421)
FT                   /locus_tag="mCG_119910"
FT                   /note="gene_id=mCG119910.1"
FT   mRNA            complement(join(2769160..2770306,2770413..2770589,
FT                   2771337..2771421))
FT                   /locus_tag="mCG_119910"
FT                   /product="mCG119910"
FT                   /note="gene_id=mCG119910.1 transcript_id=mCT121088.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(2770158..2770306,2770413..2770581))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119910"
FT                   /product="mCG119910"
FT                   /note="gene_id=mCG119910.1 transcript_id=mCT121088.1
FT                   protein_id=mCP61586.0"
FT                   /db_xref="GOA:Q56A15"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:Q56A15"
FT                   /protein_id="EDK98621.1"
FT                   /translation="MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAA
FT                   GFSYTDANKNKGITWGEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATN
FT                   E"
FT   gene            2771659..2799749
FT                   /locus_tag="mCG_140831"
FT                   /note="gene_id=mCG140831.0"
FT   mRNA            join(2771659..2771943,2780388..2780454,2794835..2794900,
FT                   2799299..2799749)
FT                   /locus_tag="mCG_140831"
FT                   /product="mCG140831"
FT                   /note="gene_id=mCG140831.0 transcript_id=mCT171700.0
FT                   created on 05-AUG-2002"
FT   gene            complement(2778225..>2801519)
FT                   /gene="4921507P07Rik"
FT                   /locus_tag="mCG_119913"
FT                   /note="gene_id=mCG119913.2"
FT   mRNA            complement(join(2778225..2779438,2782343..2782434,
FT                   2782713..2782887,2788858..2788946,2789271..2789452,
FT                   2792104..2792133,2794037..2794108,2796563..2796739,
FT                   2800725..2800867,2801370..2801518))
FT                   /gene="4921507P07Rik"
FT                   /locus_tag="mCG_119913"
FT                   /product="RIKEN cDNA 4921507P07, transcript variant
FT                   mCT121091"
FT                   /note="gene_id=mCG119913.2 transcript_id=mCT121091.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(2778226..2779438,2782343..2782434,
FT                   2782713..2782887,2788858..2788946,2789271..2789452,
FT                   2792104..2792133,2794037..2794108,2796563..2796739,
FT                   2800725..2800880,2801370..>2801519))
FT                   /gene="4921507P07Rik"
FT                   /locus_tag="mCG_119913"
FT                   /product="RIKEN cDNA 4921507P07, transcript variant
FT                   mCT189063"
FT                   /note="gene_id=mCG119913.2 transcript_id=mCT189063.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(2778623..2779438,2782343..2782434,
FT                   2782713..2782887,2788858..2788946,2789271..2789452,
FT                   2792104..2792133,2794037..2794108,2796563..2796739,
FT                   2800725..>2800867))
FT                   /codon_start=1
FT                   /gene="4921507P07Rik"
FT                   /locus_tag="mCG_119913"
FT                   /product="RIKEN cDNA 4921507P07, isoform CRA_a"
FT                   /note="gene_id=mCG119913.2 transcript_id=mCT189063.0
FT                   protein_id=mCP110053.0 isoform=CRA_a"
FT                   /protein_id="EDK98623.1"
FT                   /translation="ARSMEVIHGRPHCCRNLEGADILSNTFYSNGLHTPYETTIRPTAS
FT                   QARYQELREALPQCRLRWGADREYGGVLPVSLPEEHRPKCEPPRLMSKGHQHYGFGGEI
FT                   WPKKLPIEQYYYMTQNKKSDVYGNDSLLPKPPNSAVKEICSPYPIEHPYHTHISRGSVF
FT                   PTFTSPKDLYTGIKARTQQPFPPTVPTKACDTTILKTRGNPYRYELLDFPMDSKKKALT
FT                   WPGQGVYYDFPKFVEKNKPVFYPKPPKTFAPNSSVNPWDTMSSAKDANIQRNLERSHWL
FT                   TSYAHDFTGLGPMSPLELDDYHEKELAELTGQIGFDPQPQEKFHPALKTPRPLDGRIAR
FT                   LTQNQRPLEATVQIPPPCPDCTPRVLCAFHTFIPTSAEIMAMNNNLLSGITHKNQDVEE
FT                   KIKEEQGLMSTCPLPTCYESKDLTSLYDVQSFPKITDTKKTDDLYWRQLEMKPLPISCS
FT                   KSNHYIDYEPLKSAYRDPYAMCPNPVRLSKSNILQNKTDTADFTFDNFLSKPEFLGMNM
FT                   ESNEETRPLLDWIPRAGVPKHHSNLRNLRNTFSKSMAQKRLHNSIQEEQKDLRDKLQCG
FT                   MRHQFFGYNGHHFYN"
FT   CDS             complement(join(2778623..2779438,2782343..2782434,
FT                   2782713..2782887,2788858..2788946,2789271..2789452,
FT                   2792104..2792133,2794037..2794108,2796563..2796739,
FT                   2800725..2800858))
FT                   /codon_start=1
FT                   /gene="4921507P07Rik"
FT                   /locus_tag="mCG_119913"
FT                   /product="RIKEN cDNA 4921507P07, isoform CRA_b"
FT                   /note="gene_id=mCG119913.2 transcript_id=mCT121091.1
FT                   protein_id=mCP60775.1 isoform=CRA_b"
FT                   /protein_id="EDK98624.1"
FT                   /translation="MEVIHGRPHCCRNLEGADILSNTFYSNGLHTPYETTIRPTASQAR
FT                   YQELREALPQCRLRWGADREYGGVLPVSLPEEHRPKCEPPRLMSKGHQHYGFGGEIWPK
FT                   KLPIEQYYYMTQNKKSDVYGNDSLLPKPPNSAVKEICSPYPIEHPYHTHISRGSVFPTF
FT                   TSPKDLYTGIKARTQQPFPPTVPTKACDTTILKTRGNPYRYELLDFPMDSKKKALTWPG
FT                   QGVYYDFPKFVEKNKPVFYPKPPKTFAPNSSVNPWDTMSSAKDANIQRNLERSHWLTSY
FT                   AHDFTGLGPMSPLELDDYHEKELAELTGQIGFDPQPQEKFHPALKTPRPLDGRIARLTQ
FT                   NQRPLEATVQIPPPCPDCTPRVLCAFHTFIPTSAEIMAMNNNLLSGITHKNQDVEEKIK
FT                   EEQGLMSTCPLPTCYESKDLTSLYDVQSFPKITDTKKTDDLYWRQLEMKPLPISCSKSN
FT                   HYIDYEPLKSAYRDPYAMCPNPVRLSKSNILQNKTDTADFTFDNFLSKPEFLGMNMESN
FT                   EETRPLLDWIPRAGVPKHHSNLRNLRNTFSKSMAQKRLHNSIQEEQKDLRDKLQCGMRH
FT                   QFFGYNGHHFYN"
FT   CDS             2799409..2799642
FT                   /codon_start=1
FT                   /locus_tag="mCG_140831"
FT                   /product="mCG140831"
FT                   /note="gene_id=mCG140831.0 transcript_id=mCT171700.0
FT                   protein_id=mCP94619.0"
FT                   /protein_id="EDK98622.1"
FT                   /translation="MDWLCGRFLFYECVYMHDCMYGTRVCSCPRRPGEGTASSGTGITG
FT                   GCKLPNVGYGSQTHILRTKLVSVGRTASALNR"
FT   gene            2804739..2805215
FT                   /locus_tag="mCG_1036761"
FT                   /note="gene_id=mCG1036761.1"
FT   mRNA            2804739..2805215
FT                   /locus_tag="mCG_1036761"
FT                   /product="mCG1036761"
FT                   /note="gene_id=mCG1036761.1 transcript_id=mCT154465.1
FT                   created on 05-AUG-2002"
FT   CDS             2804955..2805170
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036761"
FT                   /product="mCG1036761"
FT                   /note="gene_id=mCG1036761.1 transcript_id=mCT154465.1
FT                   protein_id=mCP62158.1"
FT                   /protein_id="EDK98625.1"
FT                   /translation="MATGNAPWPIGVTMVGIHARTGREKIFSKHVAHVLNDETQRNYIQ
FT                   GLKRLMTICQKHFPTDPWKCVEYNVL"
FT   gap             2811873..2811892
FT                   /estimated_length=20
FT   gap             2813059..2813635
FT                   /estimated_length=577
FT   gene            <2813933..2815972
FT                   /locus_tag="mCG_119911"
FT                   /note="gene_id=mCG119911.1"
FT   mRNA            join(<2813933..2814272,2815233..2815972)
FT                   /locus_tag="mCG_119911"
FT                   /product="mCG119911"
FT                   /note="gene_id=mCG119911.1 transcript_id=mCT121089.1
FT                   created on 05-AUG-2002"
FT   CDS             join(2813933..2814272,2815233..2815954)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119911"
FT                   /product="mCG119911"
FT                   /note="gene_id=mCG119911.1 transcript_id=mCT121089.1
FT                   protein_id=mCP61603.1"
FT                   /protein_id="EDK98626.1"
FT                   /translation="MASSTVAKKEQRLPKVAQVKNKAAAEVQITAEQLLREAKERELEL
FT                   LAPPPQQKITDAEEFNDYKLRRRKAFEENLRQKRTVISNWIKYAQWEESLKELDRARSI
FT                   YERALDVDYRKCPKNKLFKGYIALELQLREFDRCRKLYEKFLEFGPENCTSWIKFAELE
FT                   TILGDVERARAIYELAISQPRLDMPELLWKSYIDFEMEQEEPERTRNLYRRLLQRTQHV
FT                   KVWISLAQFEFSSGKEGSVAKCRQIYQEANRSMRHCQDKEERLMLLESWRSFEGEFGTV
FT                   ADKERVDRLMPDEVKKRRKVQADDGSDAGWQEYRDYIFPEDAAQQPNLKLSGRGQAVEE
FT                   TATGKRSCRTGSR"
FT   gap             2814274..2815160
FT                   /estimated_length=887
FT   gap             2815974..2820834
FT                   /estimated_length=4861
FT   gap             2822795..2822814
FT                   /estimated_length=20
FT   gap             2823972..2833385
FT                   /estimated_length=9414
FT   gene            complement(2833386..2834031)
FT                   /pseudo
FT                   /locus_tag="mCG_1036478"
FT                   /note="gene_id=mCG1036478.1"
FT   mRNA            complement(2833386..2834031)
FT                   /pseudo
FT                   /locus_tag="mCG_1036478"
FT                   /note="gene_id=mCG1036478.1 transcript_id=mCT154182.1
FT                   created on 06-AUG-2002"
FT   gap             2836171..2836737
FT                   /estimated_length=567
FT   gap             2839933..2840077
FT                   /estimated_length=145
FT   gap             2844080..2844244
FT                   /estimated_length=165
FT   gap             2855546..2856036
FT                   /estimated_length=491
FT   gene            complement(2856098..>2859821)
FT                   /gene="Rfrp"
FT                   /locus_tag="mCG_119905"
FT                   /note="gene_id=mCG119905.1"
FT   mRNA            complement(join(2856098..2856350,2857922..2858298,
FT                   2859684..>2859821))
FT                   /gene="Rfrp"
FT                   /locus_tag="mCG_119905"
FT                   /product="RFamide-related peptide"
FT                   /note="gene_id=mCG119905.1 transcript_id=mCT121083.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(2856299..2856350,2857922..2858298,
FT                   2859684..2859821))
FT                   /codon_start=1
FT                   /gene="Rfrp"
FT                   /locus_tag="mCG_119905"
FT                   /product="RFamide-related peptide"
FT                   /note="gene_id=mCG119905.1 transcript_id=mCT121083.1
FT                   protein_id=mCP61502.0"
FT                   /protein_id="EDK98627.1"
FT                   /translation="MEIISLKRFILLTVATSSFLTSNTFCTDEFMMPHFHSKEGDGKYS
FT                   QLRGIPKGEKERSVSFQELKDWGAKNVIKMSPAPANKVPHSAANLPLRFGRTIDEKRSP
FT                   AARVNMEAGTRSHFPSLPQRFGRTTARSPKTPADLPQKPLHSLGSSELLYVMICQHQEI
FT                   QSPGGKRTRRRAFVETDDAERKPEK"
FT   gap             2878543..2878562
FT                   /estimated_length=20
FT   gap             2879988..2880023
FT                   /estimated_length=36
FT   gap             2897009..2897140
FT                   /estimated_length=132
FT   gap             2913622..2913641
FT                   /estimated_length=20
FT   gap             2938226..2938755
FT                   /estimated_length=530
FT   gene            complement(2952734..2953807)
FT                   /pseudo
FT                   /locus_tag="mCG_1036580"
FT                   /note="gene_id=mCG1036580.1"
FT   mRNA            complement(2952734..2953807)
FT                   /pseudo
FT                   /locus_tag="mCG_1036580"
FT                   /note="gene_id=mCG1036580.1 transcript_id=mCT154284.1
FT                   created on 06-AUG-2002"
FT   gap             2981317..2981339
FT                   /estimated_length=23
FT   gene            <2982213..3021288
FT                   /locus_tag="mCG_1036764"
FT                   /note="gene_id=mCG1036764.1"
FT   mRNA            join(<2982213..2982248,2982368..2982502,3002983..3003078,
FT                   3004974..3005195,3020399..3021288)
FT                   /locus_tag="mCG_1036764"
FT                   /product="mCG1036764"
FT                   /note="gene_id=mCG1036764.1 transcript_id=mCT154468.1
FT                   created on 05-AUG-2002"
FT   CDS             join(<2982377..2982502,3002983..3003078,3004974..3005066)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036764"
FT                   /product="mCG1036764"
FT                   /note="gene_id=mCG1036764.1 transcript_id=mCT154468.1
FT                   protein_id=mCP62199.1"
FT                   /protein_id="EDK98628.1"
FT                   /translation="WNVAKCSEGVVLRPGGRQTPPFLSDTWGCSCCNPLRPSALVQDHT
FT                   SNNSYMRHELFLSKGVMKVKRSNGEKFQVDSSCVAQVGQERLCPGDLPSGAAVSPHHYA
FT                   "
FT   gene            complement(3006575..>3009236)
FT                   /locus_tag="mCG_140813"
FT                   /note="gene_id=mCG140813.0"
FT   mRNA            complement(join(3006575..3007147,3009154..>3009236))
FT                   /locus_tag="mCG_140813"
FT                   /product="mCG140813"
FT                   /note="gene_id=mCG140813.0 transcript_id=mCT171638.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(3007124..3007147,3009154..>3009234))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140813"
FT                   /product="mCG140813"
FT                   /note="gene_id=mCG140813.0 transcript_id=mCT171638.0
FT                   protein_id=mCP94557.0"
FT                   /protein_id="EDK98629.1"
FT                   /translation="CRAAEGRQLSLGLPFPKLRTAMNPSHQVTSQRRV"
FT   gap             3045450..3045469
FT                   /estimated_length=20
FT   gene            3115174..3118669
FT                   /locus_tag="mCG_1036765"
FT                   /note="gene_id=mCG1036765.1"
FT   mRNA            join(3115174..3115255,3118308..3118669)
FT                   /locus_tag="mCG_1036765"
FT                   /product="mCG1036765"
FT                   /note="gene_id=mCG1036765.1 transcript_id=mCT154469.0
FT                   created on 05-AUG-2002"
FT   CDS             join(3115212..3115255,3118308..3118377)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036765"
FT                   /product="mCG1036765"
FT                   /note="gene_id=mCG1036765.1 transcript_id=mCT154469.0
FT                   protein_id=mCP62215.1"
FT                   /protein_id="EDK98630.1"
FT                   /translation="MLRFSLLDKVGATFLSPTLQRFVCEVMPRKDLSSRAN"
FT   gap             3131807..3131826
FT                   /estimated_length=20
FT   gap             3137455..3137474
FT                   /estimated_length=20
FT   gap             3139956..3139975
FT                   /estimated_length=20
FT   gap             3141441..3141719
FT                   /estimated_length=279
FT   gap             3164475..3164715
FT                   /estimated_length=241
FT   gap             3173963..3173982
FT                   /estimated_length=20
FT   gap             3176353..3176372
FT                   /estimated_length=20
FT   gap             3206666..3206685
FT                   /estimated_length=20
FT   gap             3208006..3208025
FT                   /estimated_length=20
FT   gap             3215511..3215803
FT                   /estimated_length=293
FT   gap             3234216..3234259
FT                   /estimated_length=44
FT   gap             3266341..3266360
FT                   /estimated_length=20
FT   gap             3295757..3295811
FT                   /estimated_length=55
FT   gap             3297427..3297924
FT                   /estimated_length=498
FT   gap             3316089..3316108
FT                   /estimated_length=20
FT   gap             3323436..3323745
FT                   /estimated_length=310
FT   gap             3332463..3332482
FT                   /estimated_length=20
FT   gap             3394386..3394405
FT                   /estimated_length=20
FT   gap             3416818..3419238
FT                   /estimated_length=2421
FT   gap             3427338..3428015
FT                   /estimated_length=678
FT   gap             3443534..3443553
FT                   /estimated_length=20
FT   gap             3456210..3456229
FT                   /estimated_length=20
FT   gap             3457238..3457257
FT                   /estimated_length=20
FT   gap             3464124..3466401
FT                   /estimated_length=2278
FT   gap             3476434..3476453
FT                   /estimated_length=20
FT   gene            <3484805..3487773
FT                   /locus_tag="mCG_1036768"
FT                   /note="gene_id=mCG1036768.1"
FT   mRNA            join(<3484805..3484878,3487032..3487773)
FT                   /locus_tag="mCG_1036768"
FT                   /product="mCG1036768"
FT                   /note="gene_id=mCG1036768.1 transcript_id=mCT154472.0
FT                   created on 05-AUG-2002"
FT   CDS             <3487365..3487697
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036768"
FT                   /product="mCG1036768"
FT                   /note="gene_id=mCG1036768.1 transcript_id=mCT154472.0
FT                   protein_id=mCP62262.0"
FT                   /protein_id="EDK98631.1"
FT                   /translation="GSPSVAELPLKILQAPLSFQSCPELFVLDPNMHGEDAVSGNPAWN
FT                   LRGPRGTVLKCIQTFKLHSRIEAKFSPGSHTYRHTCVCGSERNAFRNNGPHNMVCIATL
FT                   FILFFF"
FT   gene            complement(3487663..3492122)
FT                   /locus_tag="mCG_1050909"
FT                   /note="gene_id=mCG1050909.0"
FT   mRNA            complement(join(3487663..3488587,3488717..3490186,
FT                   3491780..3492122))
FT                   /locus_tag="mCG_1050909"
FT                   /product="mCG1050909"
FT                   /note="gene_id=mCG1050909.0 transcript_id=mCT194698.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(3489747..3490004)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050909"
FT                   /product="mCG1050909"
FT                   /note="gene_id=mCG1050909.0 transcript_id=mCT194698.0
FT                   protein_id=mCP115727.0"
FT                   /protein_id="EDK98632.1"
FT                   /translation="MMATFLQHATLNCGVLQCIARTGEMSRGCIDRLFPQMLRAAVFSS
FT                   SEEVFSIFILVFGKKTKQETRGDENLSSLGAGAIAYYFLL"
FT   gap             3492456..3493255
FT                   /estimated_length=800
FT   gap             3530172..3530714
FT                   /estimated_length=543
FT   gene            complement(<3541895..3542687)
FT                   /locus_tag="mCG_1036770"
FT                   /note="gene_id=mCG1036770.1"
FT   mRNA            complement(<3541895..3542687)
FT                   /locus_tag="mCG_1036770"
FT                   /product="mCG1036770"
FT                   /note="gene_id=mCG1036770.1 transcript_id=mCT154474.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(<3541895..3542137)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036770"
FT                   /product="mCG1036770"
FT                   /note="gene_id=mCG1036770.1 transcript_id=mCT154474.1
FT                   protein_id=mCP60785.1"
FT                   /protein_id="EDK98633.1"
FT                   /translation="MGRRGPVAFLGHLYPEHQPVLRHRNFLTFIQKFLISVLYISKINQ
FT                   IMGHWCLNSVSSLVPLLEVRSWLNISFLQGHGWPAL"
FT   gap             3556442..3556461
FT                   /estimated_length=20
FT   gap             3569060..3569105
FT                   /estimated_length=46
FT   gap             3572932..3573185
FT                   /estimated_length=254
FT   gap             3574716..3574735
FT                   /estimated_length=20
FT   gap             3602496..3602515
FT                   /estimated_length=20
FT   gene            complement(3605353..>3606607)
FT                   /locus_tag="mCG_1036771"
FT                   /note="gene_id=mCG1036771.1"
FT   mRNA            complement(join(3605353..3606420,3606573..>3606607))
FT                   /locus_tag="mCG_1036771"
FT                   /product="mCG1036771"
FT                   /note="gene_id=mCG1036771.1 transcript_id=mCT154475.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(3606308..3606420,3606573..>3606606))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036771"
FT                   /product="mCG1036771"
FT                   /note="gene_id=mCG1036771.1 transcript_id=mCT154475.0
FT                   protein_id=mCP60807.1"
FT                   /protein_id="EDK98634.1"
FT                   /translation="ASGSALGLSRKDSMLVFVTSLFRKLDAKLLEGLGSPGSSACPPAV
FT                   ETS"
FT   gap             3634221..3634240
FT                   /estimated_length=20
FT   gene            3637560..3664339
FT                   /gene="Nfe2l3"
FT                   /locus_tag="mCG_119116"
FT                   /note="gene_id=mCG119116.1"
FT   mRNA            join(3637560..3638303,3656264..3656440,3662165..3662248,
FT                   3662801..3664339)
FT                   /gene="Nfe2l3"
FT                   /locus_tag="mCG_119116"
FT                   /product="nuclear factor, erythroid derived 2, like 3,
FT                   transcript variant mCT120280"
FT                   /note="gene_id=mCG119116.1 transcript_id=mCT120280.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(<3637637..3638303,3656264..3656440,3662165..3662447)
FT                   /gene="Nfe2l3"
FT                   /locus_tag="mCG_119116"
FT                   /product="nuclear factor, erythroid derived 2, like 3,
FT                   transcript variant mCT189077"
FT                   /note="gene_id=mCG119116.1 transcript_id=mCT189077.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3637638..3638303,3656264..3656440,3662165..3662275)
FT                   /codon_start=1
FT                   /gene="Nfe2l3"
FT                   /locus_tag="mCG_119116"
FT                   /product="nuclear factor, erythroid derived 2, like 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG119116.1 transcript_id=mCT189077.0
FT                   protein_id=mCP110051.0 isoform=CRA_b"
FT                   /protein_id="EDK98636.1"
FT                   /translation="HCVGSRGSAFVPGWGEAATAPCTPWSIVFSAGATGAAVVPSRVDT
FT                   GIPGAPWEMKLPKPWWAGGGLLQLTILLSLVGLRVDLDLFLPPPAAALWEELLPLCPTR
FT                   PASASNPFSASEGWERTPLLPAKGRLLHEVRALGVPFIPRTRVDAWLVHSVATGNADGA
FT                   HGLLGTAASSAVGDGGQSASAGGGDPRAAHSSPLAAEEEEEKAAEPTAQVPDAGGCGSQ
FT                   ENGMLREKSEAVDHSSQQEENEEGVSAQAKSRQQSKTEEHKMACASAREAEKITEARNE
FT                   SHLHWSDTSFSLEDLFQLLSSQPEHSLEVKGTLTCI"
FT   CDS             join(3637797..3638303,3656264..3656440,3662165..3662248,
FT                   3662801..3664015)
FT                   /codon_start=1
FT                   /gene="Nfe2l3"
FT                   /locus_tag="mCG_119116"
FT                   /product="nuclear factor, erythroid derived 2, like 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG119116.1 transcript_id=mCT120280.0
FT                   protein_id=mCP60789.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UZC1"
FT                   /db_xref="InterPro:IPR004826"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="MGI:MGI:1339958"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UZC1"
FT                   /protein_id="EDK98635.1"
FT                   /translation="MKLPKPWWAGGGLLQLTILLSLVGLRVDLDLFLPPPAAALWEELL
FT                   PLCPTRPASASNPFSASEGWERTPLLPAKGRLLHEVRALGVPFIPRTRVDAWLVHSVAT
FT                   GNADGAHGLLGTAASSAVGDGGQSASAGGGDPRAAHSSPLAAEEEEEKAAEPTAQVPDA
FT                   GGCGSQENGMLREKSEAVDHSSQQEENEEGVSAQAKSRQQSKTEEHKMACASAREAEKI
FT                   TEARNESHLHWSDTSFSLEDLFQLLSSQPEHSLEGISVEDIPPFLSSVCESVNSSAQNI
FT                   NLSQAISHDVNLHEAMLLYPNNTFRRDPSARSSQAQEPFLQLNPHTNPEQATPAMSLPP
FT                   FDNQMRNLTSQDLLYDLDSNIFDGINLMSLATGFSPLEVSQLFEEPDSGLSLNSSYNST
FT                   SLTNSYRIYDGTVGYNSDLQSLCHDLGAVGGCYPEPHKHCHMDHRTIAGFHVSLECQQV
FT                   FHDHTYHLQSGASEPTSESFAWSEKSQKTSGCLDNPDRNLSRDEQRAKALHIPFSVDEI
FT                   VRMPVDSFNSMLSRYYLTDLQVSLIRDIRRRGKNKVAAQNCRKRKLDIILNLEDDICNL
FT                   QAKKEALKNEQTQCSKAIDIMRQKLHGLHQDVFNRLRDDQGRPVNPSQYALQYSHDGTV
FT                   LIVPKELISSGHKKEAPKGKRERRN"
FT   gap             3646582..3646601
FT                   /estimated_length=20
FT   gap             3657818..3657837
FT                   /estimated_length=20
FT   gene            complement(3666436..3675485)
FT                   /locus_tag="mCG_119114"
FT                   /note="gene_id=mCG119114.1"
FT   mRNA            complement(join(3666436..3667004,3668982..3669064,
FT                   3669660..3669782,3669999..3670118,3670750..3670812,
FT                   3671713..3671793,3671874..3671975,3672066..3672276,
FT                   3672477..3672623,3672756..3672866,3675242..3675485))
FT                   /locus_tag="mCG_119114"
FT                   /product="mCG119114, transcript variant mCT171647"
FT                   /note="gene_id=mCG119114.1 transcript_id=mCT171647.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(3666436..3668825,3668982..3669064,
FT                   3669660..3669782,3669999..3670118,3670750..3670812,
FT                   3671713..3671793,3671874..3671975,3672066..3672276,
FT                   3672477..3672623,3672756..3672866,3675242..3675485))
FT                   /locus_tag="mCG_119114"
FT                   /product="mCG119114, transcript variant mCT120278"
FT                   /note="gene_id=mCG119114.1 transcript_id=mCT120278.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(3666695..3667004,3667491..3667626,
FT                   3668982..3669064,3669660..3669782,3670750..3670812,
FT                   3671713..3671793,3671874..3671975,3672066..3672276,
FT                   3672477..3672623,3672756..3672866,3675242..>3675416))
FT                   /locus_tag="mCG_119114"
FT                   /product="mCG119114, transcript variant mCT189072"
FT                   /note="gene_id=mCG119114.1 transcript_id=mCT189072.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(3669003..3669064,3669660..3669782,
FT                   3670750..3670812,3671713..3671793,3671874..3671975,
FT                   3672066..3672276,3672477..3672623,3672756..3672866,
FT                   3675242..>3675415))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119114"
FT                   /product="mCG119114, isoform CRA_a"
FT                   /note="gene_id=mCG119114.1 transcript_id=mCT189072.0
FT                   protein_id=mCP110049.0 isoform=CRA_a"
FT                   /protein_id="EDK98637.1"
FT                   /translation="VAAAPVPCAGAPLRPSFLAIACSPHSARTSPVRVRPRRSFSSRSA
FT                   AGNRAEATESAMEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKR
FT                   SRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGI
FT                   KEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTIN
FT                   GHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSG
FT                   RGFGDGYNGYGGGPGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNY
FT                   GPGGSGGSGGYGGRSRY"
FT   CDS             complement(join(3669003..3669064,3669660..3669782,
FT                   3669999..3670118,3670750..3670812,3671713..3671793,
FT                   3671874..3671975,3672066..3672276,3672477..3672623,
FT                   3672756..3672866,3675242..3675247))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119114"
FT                   /product="mCG119114, isoform CRA_b"
FT                   /note="gene_id=mCG119114.1 transcript_id=mCT120278.1
FT                   protein_id=mCP62264.1 isoform=CRA_b"
FT                   /protein_id="EDK98638.1"
FT                   /translation="MEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPA
FT                   SKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFV
FT                   GGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYH
FT                   TINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGY
FT                   GSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGG
FT                   NYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSR
FT                   Y"
FT   CDS             complement(join(3669003..3669064,3669660..3669782,
FT                   3669999..3670118,3670750..3670812,3671713..3671793,
FT                   3671874..3671975,3672066..3672276,3672477..3672623,
FT                   3672756..3672866,3675242..3675247))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119114"
FT                   /product="mCG119114, isoform CRA_b"
FT                   /note="gene_id=mCG119114.1 transcript_id=mCT171647.0
FT                   protein_id=mCP94566.0 isoform=CRA_b"
FT                   /protein_id="EDK98639.1"
FT                   /translation="MEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPA
FT                   SKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFV
FT                   GGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYH
FT                   TINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGY
FT                   GSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGG
FT                   NYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSR
FT                   Y"
FT   gene            3675931..3689276
FT                   /locus_tag="mCG_119115"
FT                   /note="gene_id=mCG119115.1"
FT   mRNA            join(3675931..3676002,3677387..3677439,3680802..3680944,
FT                   3684009..3684171,3687295..3687389,3688051..3689276)
FT                   /locus_tag="mCG_119115"
FT                   /product="mCG119115, transcript variant mCT171648"
FT                   /note="gene_id=mCG119115.1 transcript_id=mCT171648.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(3676191..3676310,3677387..3677439,3680802..3680944,
FT                   3684009..3684171,3687295..3687389,3688051..3689276)
FT                   /locus_tag="mCG_119115"
FT                   /product="mCG119115, transcript variant mCT120279"
FT                   /note="gene_id=mCG119115.1 transcript_id=mCT120279.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(<3676284..3676310,3677387..3677439,3680802..3680944,
FT                   3684009..3684171,3687295..3687389,3688051..3688886,
FT                   3688920..3689275)
FT                   /locus_tag="mCG_119115"
FT                   /product="mCG119115, transcript variant mCT189073"
FT                   /note="gene_id=mCG119115.1 transcript_id=mCT189073.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3677413..3677439,3680802..3680944,3684009..3684171,
FT                   3687295..3687389,3688051..3688177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119115"
FT                   /product="mCG119115, isoform CRA_b"
FT                   /note="gene_id=mCG119115.1 transcript_id=mCT189073.0
FT                   protein_id=mCP110050.0 isoform=CRA_b"
FT                   /protein_id="EDK98641.1"
FT                   /translation="KMASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGK
FT                   VEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSK
FT                   SKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQ
FT                   IVIAFYEERLTWHSCPEDEAQ"
FT   CDS             join(3677416..3677439,3680802..3680944,3684009..3684171,
FT                   3687295..3687389,3688051..3688177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119115"
FT                   /product="mCG119115, isoform CRA_a"
FT                   /note="gene_id=mCG119115.1 transcript_id=mCT120279.1
FT                   protein_id=mCP60787.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DCC5"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008251"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR017984"
FT                   /db_xref="InterPro:IPR023779"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="MGI:MGI:108515"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DCC5"
FT                   /protein_id="EDK98640.1"
FT                   /translation="MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKV
FT                   EYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKS
FT                   KKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQI
FT                   VIAFYEERLTWHSCPEDEAQ"
FT   CDS             join(3677416..3677439,3680802..3680944,3684009..3684171,
FT                   3687295..3687389,3688051..3688177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119115"
FT                   /product="mCG119115, isoform CRA_a"
FT                   /note="gene_id=mCG119115.1 transcript_id=mCT171648.0
FT                   protein_id=mCP94567.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DCC5"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008251"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR017984"
FT                   /db_xref="InterPro:IPR023779"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="MGI:MGI:108515"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DCC5"
FT                   /protein_id="EDK98642.1"
FT                   /translation="MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKV
FT                   EYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKS
FT                   KKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQI
FT                   VIAFYEERLTWHSCPEDEAQ"
FT   gap             3694391..3694410
FT                   /estimated_length=20
FT   gap             3720425..3720566
FT                   /estimated_length=142
FT   gap             3729627..3729646
FT                   /estimated_length=20
FT   gene            3729692..3796397
FT                   /gene="Snx10"
FT                   /locus_tag="mCG_119117"
FT                   /note="gene_id=mCG119117.1"
FT   mRNA            join(3729692..3729799,3767718..3767764,3781611..3781697,
FT                   3785566..3785666,3786018..3786116,3793948..3794160,
FT                   3794613..3796397)
FT                   /gene="Snx10"
FT                   /locus_tag="mCG_119117"
FT                   /product="sorting nexin 10"
FT                   /note="gene_id=mCG119117.1 transcript_id=mCT120281.1
FT                   created on 05-AUG-2002"
FT   gap             3743422..3743581
FT                   /estimated_length=160
FT   gap             3754234..3754328
FT                   /estimated_length=95
FT   gap             3765206..3765225
FT                   /estimated_length=20
FT   CDS             join(3767741..3767764,3781611..3781697,3785566..3785666,
FT                   3786018..3786116,3793948..3794160,3794613..3794694)
FT                   /codon_start=1
FT                   /gene="Snx10"
FT                   /locus_tag="mCG_119117"
FT                   /product="sorting nexin 10"
FT                   /note="gene_id=mCG119117.1 transcript_id=mCT120281.1
FT                   protein_id=mCP61512.1"
FT                   /db_xref="GOA:Q4FJX6"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="MGI:MGI:1919232"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJX6"
FT                   /protein_id="EDK98643.1"
FT                   /translation="MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTM
FT                   KTSCVRRRYREFVWLRQRLQSNALLVQLPELPSKNLFFNMNNRQHVDQRRQGLEDFLRK
FT                   VLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEEEEG
FT                   KKDADVEYDSESSSSGLGHSSDDSSSHGCKTSPALQES"
FT   gap             3834566..3834585
FT                   /estimated_length=20
FT   gap             3889490..3890243
FT                   /estimated_length=754
FT   gene            complement(3902769..>3916616)
FT                   /locus_tag="mCG_1036772"
FT                   /note="gene_id=mCG1036772.1"
FT   mRNA            complement(join(3902769..3903240,3916528..>3916616))
FT                   /locus_tag="mCG_1036772"
FT                   /product="mCG1036772"
FT                   /note="gene_id=mCG1036772.1 transcript_id=mCT154476.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(3903077..3903240,3916528..>3916615))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036772"
FT                   /product="mCG1036772"
FT                   /note="gene_id=mCG1036772.1 transcript_id=mCT154476.1
FT                   protein_id=mCP60812.1"
FT                   /protein_id="EDK98644.1"
FT                   /translation="RTSVQGLGGDSEGEADLSHLLLAPGPEHRGPMQEFMKSHPSVVST
FT                   GWAMDSHKAGTVRSHPAREPPGDEAHEQQQQHRHEGLR"
FT   gap             3919288..3920644
FT                   /estimated_length=1357
FT   gap             3961405..3962387
FT                   /estimated_length=983
FT   gap             3992042..3992071
FT                   /estimated_length=30
FT   gap             4014290..4014380
FT                   /estimated_length=91
FT   gap             4028762..4028861
FT                   /estimated_length=100
FT   gene            complement(4064995..4220168)
FT                   /gene="Scap2"
FT                   /locus_tag="mCG_121164"
FT                   /note="gene_id=mCG121164.1"
FT   mRNA            complement(join(4064995..4067140,4067569..4067669,
FT                   4082043..4082155,4087382..4087459,4115498..4115632,
FT                   4115980..4116043,4116911..4117035,4128878..4128961,
FT                   4129861..4129938,4203629..4203736,4210699..4210724,
FT                   4211268..4211373,4219954..4220168))
FT                   /gene="Scap2"
FT                   /locus_tag="mCG_121164"
FT                   /product="src family associated phosphoprotein 2,
FT                   transcript variant mCT122361"
FT                   /note="gene_id=mCG121164.1 transcript_id=mCT122361.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(4066736..4067140,4067569..4067669,
FT                   4082043..4082155,4087382..4087459,4115498..4115632,
FT                   4115980..4116043,4116911..4117035,4128878..4128961,
FT                   4129861..4129938,4203629..4203736,4210699..4210724,
FT                   4211268..4211352,4219954..>4220134))
FT                   /gene="Scap2"
FT                   /locus_tag="mCG_121164"
FT                   /product="src family associated phosphoprotein 2,
FT                   transcript variant mCT189060"
FT                   /note="gene_id=mCG121164.1 transcript_id=mCT189060.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(4067577..4067669,4082043..4082155,
FT                   4087382..4087459,4115498..4115632,4115980..4116043,
FT                   4116911..4117035,4128878..4128961,4129861..4129938,
FT                   4203629..4203736,4210699..4210724,4211268..4211352,
FT                   4219954..>4220035))
FT                   /codon_start=1
FT                   /gene="Scap2"
FT                   /locus_tag="mCG_121164"
FT                   /product="src family associated phosphoprotein 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG121164.1 transcript_id=mCT189060.0
FT                   protein_id=mCP110054.0 isoform=CRA_b"
FT                   /protein_id="EDK98646.1"
FT                   /translation="VQAIIMPNPSCTSSPGPLPEEIRNLLADTLKGENLSKKAKEKRES
FT                   LIKKIKDVKSVYLQEFQDKGDAEDGDEYDDPFAGPADTISLASERYDKDDDGPSDGNQF
FT                   PPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFA
FT                   IDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLGSD
FT                   VIPEDDEERGELYDDVDHPAAVSSPQRSQPIDDEIYEELPEEEEDTASVKMDEQGKGSR
FT                   DSVHHTSGDKSTDYANFYQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMKG
FT                   AIGLVPKAYLMEMYDI"
FT   CDS             complement(join(4067577..4067669,4082043..4082155,
FT                   4087382..4087459,4115498..4115632,4115980..4116043,
FT                   4116911..4117035,4128878..4128961,4129861..4129938,
FT                   4203629..4203736,4210699..4210724,4211268..4211373,
FT                   4219954..4220020))
FT                   /codon_start=1
FT                   /gene="Scap2"
FT                   /locus_tag="mCG_121164"
FT                   /product="src family associated phosphoprotein 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121164.1 transcript_id=mCT122361.1
FT                   protein_id=mCP62110.1 isoform=CRA_a"
FT                   /protein_id="EDK98645.1"
FT                   /translation="MPNPSCTSSPGPLPEEIRNLLADVETFVADTLKGENLSKKAKEKR
FT                   ESLIKKIKDVKSVYLQEFQDKGDAEDGDEYDDPFAGPADTISLASERYDKDDDGPSDGN
FT                   QFPPIAAQDLPFVIKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGE
FT                   FAIDGYDVRMNNTLRKDGKKDCCFEICAPDKRIYQFTAASPKDAEEWVQQLKFILQDLG
FT                   SDVIPEDDEERGELYDDVDHPAAVSSPQRSQPIDDEIYEELPEEEEDTASVKMDEQGKG
FT                   SRDSVHHTSGDKSTDYANFYQGLWDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEM
FT                   KGAIGLVPKAYLMEMYDI"
FT   gap             4083491..4083510
FT                   /estimated_length=20
FT   gap             4221587..4221667
FT                   /estimated_length=81
FT   gap             4230032..4230051
FT                   /estimated_length=20
FT   gap             4255535..4255670
FT                   /estimated_length=136
FT   gap             4297870..4300070
FT                   /estimated_length=2201
FT   gene            complement(4340977..4341242)
FT                   /pseudo
FT                   /locus_tag="mCG_1036776"
FT                   /note="gene_id=mCG1036776.1"
FT   mRNA            complement(4340977..4341242)
FT                   /pseudo
FT                   /locus_tag="mCG_1036776"
FT                   /note="gene_id=mCG1036776.1 transcript_id=mCT154480.1
FT                   created on 06-AUG-2002"
FT   gap             4355131..4355511
FT                   /estimated_length=381
FT   gene            complement(4364845..4367764)
FT                   /gene="Hoxa1"
FT                   /locus_tag="mCG_121168"
FT                   /note="gene_id=mCG121168.1"
FT   mRNA            complement(join(4364845..4366567,4367045..4367764))
FT                   /gene="Hoxa1"
FT                   /locus_tag="mCG_121168"
FT                   /product="homeobox A1"
FT                   /note="gene_id=mCG121168.1 transcript_id=mCT122365.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4366212..4366567,4367045..4367699))
FT                   /codon_start=1
FT                   /gene="Hoxa1"
FT                   /locus_tag="mCG_121168"
FT                   /product="homeobox A1"
FT                   /note="gene_id=mCG121168.1 transcript_id=mCT122365.1
FT                   protein_id=mCP61198.1"
FT                   /db_xref="GOA:B9EHK7"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96170"
FT                   /db_xref="UniProtKB/TrEMBL:B9EHK7"
FT                   /protein_id="EDK98647.1"
FT                   /translation="MDNARMNSFLEYPILGSGDSGTCSARAYPSDHGITTFQSCAVSAN
FT                   SCGGDDRFLVGRGVQISSPHHHHHHHHHHHPQTATYQTSGNLGISYSHSSCGPSYGAQN
FT                   FSAPYGPYGLNQEADVSGGYPPCAPAVYSGNLSTPMVQHHHHHQGYAGGTVGSPQYIHH
FT                   SYGQEQQTLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVG
FT                   EYGYVGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNR
FT                   RMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPSAPSPASSTSDTLTTSH"
FT   gene            4366380..4368009
FT                   /locus_tag="mCG_140830"
FT                   /note="gene_id=mCG140830.0"
FT   mRNA            join(4366380..4366460,4367368..4367456,4367768..4368009)
FT                   /locus_tag="mCG_140830"
FT                   /product="mCG140830"
FT                   /note="gene_id=mCG140830.0 transcript_id=mCT171699.0
FT                   created on 05-AUG-2002"
FT   CDS             4367792..4367953
FT                   /codon_start=1
FT                   /locus_tag="mCG_140830"
FT                   /product="mCG140830"
FT                   /note="gene_id=mCG140830.0 transcript_id=mCT171699.0
FT                   protein_id=mCP94618.0"
FT                   /protein_id="EDK98648.1"
FT                   /translation="MYSAQEAGRAGGGLEGRTRDSTSQWLSRLRKFTGCGRDGSPFQWH
FT                   LNPRRSSV"
FT   gene            complement(4371351..4374331)
FT                   /gene="Hoxa2"
FT                   /locus_tag="mCG_121161"
FT                   /note="gene_id=mCG121161.1"
FT   mRNA            complement(join(4371351..4373125,4373766..4374331))
FT                   /gene="Hoxa2"
FT                   /locus_tag="mCG_121161"
FT                   /product="homeobox A2"
FT                   /note="gene_id=mCG121161.1 transcript_id=mCT122358.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4372386..4373125,4373766..4374144))
FT                   /codon_start=1
FT                   /gene="Hoxa2"
FT                   /locus_tag="mCG_121161"
FT                   /product="homeobox A2"
FT                   /note="gene_id=mCG121161.1 transcript_id=mCT122358.1
FT                   protein_id=mCP62086.1"
FT                   /protein_id="EDK98649.1"
FT                   /translation="MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHS
FT                   TLIPPPFEQTIPSLNPGSHPRHGAGVGGRPKSSPAGSRGSPVPAGALQPPEYPWMKEKK
FT                   AAKKTALPPAAASTGPACLGHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKY
FT                   LCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEED
FT                   EEEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEKNLK
FT                   HFQHQSPTVPNCLSTMGQNCGAGLNNDSPEAIEVPSLQDFNVFSTDSCLQLSDALSPSL
FT                   PGSLDSPVDISADSFDFFTDTLTTIDLQHLNY"
FT   gene            4375173..4378948
FT                   /locus_tag="mCG_121171"
FT                   /note="gene_id=mCG121171.1"
FT   mRNA            join(4375173..4375487,4377209..4377388,4377877..4378948)
FT                   /locus_tag="mCG_121171"
FT                   /product="mCG121171"
FT                   /note="gene_id=mCG121171.1 transcript_id=mCT122368.1
FT                   created on 05-AUG-2002"
FT   CDS             4378082..4378489
FT                   /codon_start=1
FT                   /locus_tag="mCG_121171"
FT                   /product="mCG121171"
FT                   /note="gene_id=mCG121171.1 transcript_id=mCT122368.1
FT                   protein_id=mCP61415.1"
FT                   /db_xref="GOA:Q52KM3"
FT                   /db_xref="MGI:MGI:1913890"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KM3"
FT                   /protein_id="EDK98650.1"
FT                   /translation="MNREASSVETWNSIACGKSLRPCAVPRLRPWPMGFRCGGMERSPG
FT                   FLVSASRTCAPPAEPEAGRLCFCQAALHLAAWRPAWAAAGNQAAQRAGSLAFPELRQPL
FT                   ETAASIPRTRRASKADAGPGLTPESRCCRSR"
FT   gene            complement(4378592..4422826)
FT                   /gene="Hoxa3"
FT                   /locus_tag="mCG_1036483"
FT                   /note="gene_id=mCG1036483.3"
FT   mRNA            complement(join(4378592..4380239,4381621..4382269,
FT                   4393203..4393285,4410326..4410427,4422529..4422826))
FT                   /gene="Hoxa3"
FT                   /locus_tag="mCG_1036483"
FT                   /product="homeobox A3, transcript variant mCT194224"
FT                   /note="gene_id=mCG1036483.3 transcript_id=mCT194224.0
FT                   created on 24-MAR-2004"
FT   mRNA            complement(join(4378592..4380239,4381621..4382269,
FT                   4393203..4393285,4400674..4401199))
FT                   /gene="Hoxa3"
FT                   /locus_tag="mCG_1036483"
FT                   /product="homeobox A3, transcript variant mCT122366"
FT                   /note="gene_id=mCG1036483.3 transcript_id=mCT122366.2
FT                   created on 24-MAR-2004"
FT   CDS             complement(join(4379437..4380239,4381621..4382149))
FT                   /codon_start=1
FT                   /gene="Hoxa3"
FT                   /locus_tag="mCG_1036483"
FT                   /product="homeobox A3, isoform CRA_a"
FT                   /note="gene_id=mCG1036483.3 transcript_id=mCT122366.2
FT                   protein_id=mCP61223.2 isoform=CRA_a"
FT                   /protein_id="EDK98651.1"
FT                   /translation="MQKATYYDSSAIYGGYPYQAANGFAYNASQQPYAPSAALGTDGVE
FT                   YHRPACSLQSPASAGGHPKTHELSEACLRTLSGPPSQPPGLGEPPLPPPPPQAAPPAPQ
FT                   PPQPPPQPPAPTPAAPPPPSSVSPPQSANSNPTPASTAKSPLLNSPTVGKQIFPWMKES
FT                   RQNTKQKTSGSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRR
FT                   VEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSM
FT                   HSLVNSVPYEPQSPPPFSKPPQGAYGLPPASYPAPLPSCAPPPPPQKRYTAAGSGAGGT
FT                   PDYDPHAHGLQGNGSYGTPHLQGSPVFVGGSYVEPMSNSGPLFGLTHLPHTTSAAMDYG
FT                   GTGPLGSGHHHGPGPGEPHPTYTDLTAHHPSQGRIQEAPKLTHL"
FT   CDS             complement(join(4379437..4380239,4381621..4382149))
FT                   /codon_start=1
FT                   /gene="Hoxa3"
FT                   /locus_tag="mCG_1036483"
FT                   /product="homeobox A3, isoform CRA_a"
FT                   /note="gene_id=mCG1036483.3 transcript_id=mCT194224.0
FT                   protein_id=mCP115253.0 isoform=CRA_a"
FT                   /protein_id="EDK98652.1"
FT                   /translation="MQKATYYDSSAIYGGYPYQAANGFAYNASQQPYAPSAALGTDGVE
FT                   YHRPACSLQSPASAGGHPKTHELSEACLRTLSGPPSQPPGLGEPPLPPPPPQAAPPAPQ
FT                   PPQPPPQPPAPTPAAPPPPSSVSPPQSANSNPTPASTAKSPLLNSPTVGKQIFPWMKES
FT                   RQNTKQKTSGSSSGESCAGDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRR
FT                   VEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSM
FT                   HSLVNSVPYEPQSPPPFSKPPQGAYGLPPASYPAPLPSCAPPPPPQKRYTAAGSGAGGT
FT                   PDYDPHAHGLQGNGSYGTPHLQGSPVFVGGSYVEPMSNSGPLFGLTHLPHTTSAAMDYG
FT                   GTGPLGSGHHHGPGPGEPHPTYTDLTAHHPSQGRIQEAPKLTHL"
FT   gene            4384711..4402502
FT                   /locus_tag="mCG_146884"
FT                   /note="gene_id=mCG146884.0"
FT   mRNA            join(4384711..4384793,4402007..4402502)
FT                   /locus_tag="mCG_146884"
FT                   /product="mCG146884"
FT                   /note="gene_id=mCG146884.0 transcript_id=mCT187147.0
FT                   created on 13-JAN-2004"
FT   CDS             join(4384761..4384793,4402007..4402090)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146884"
FT                   /product="mCG146884"
FT                   /note="gene_id=mCG146884.0 transcript_id=mCT187147.0
FT                   protein_id=mCP109098.0"
FT                   /protein_id="EDK98653.1"
FT                   /translation="MQEALLSLHHKTQNLYIIFSFKDLEPSYIAVDGGAEES"
FT   gene            complement(4390060..4394371)
FT                   /locus_tag="mCG_1050159"
FT                   /note="gene_id=mCG1050159.0"
FT   mRNA            complement(join(4390060..4391177,4393203..4393285,
FT                   4394037..4394371))
FT                   /locus_tag="mCG_1050159"
FT                   /product="mCG1050159"
FT                   /note="gene_id=mCG1050159.0 transcript_id=mCT182092.0
FT                   created on 11-FEB-2004"
FT   CDS             complement(4390535..4390828)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050159"
FT                   /product="mCG1050159"
FT                   /note="gene_id=mCG1050159.0 transcript_id=mCT182092.0
FT                   protein_id=mCP105014.0"
FT                   /protein_id="EDK98654.1"
FT                   /translation="MFSTDPLWVPSGEKSREAQTQSPAVATTEHPTWSQLKTEDGLLRN
FT                   KRAFSKHSSEIKAGNFLEAHGKVEMHRQCYQTEGKSRGGDWEDSLFVLARFY"
FT   gene            complement(4399183..4401200)
FT                   /gene="Hoxa4"
FT                   /locus_tag="mCG_1050160"
FT                   /note="gene_id=mCG1050160.0"
FT   mRNA            complement(join(4399183..4400184,4400674..4401200))
FT                   /gene="Hoxa4"
FT                   /locus_tag="mCG_1050160"
FT                   /product="homeobox A4"
FT                   /note="gene_id=mCG1050160.0 transcript_id=mCT182094.0
FT                   created on 11-FEB-2004"
FT   CDS             complement(join(4399838..4400184,4400674..4401184))
FT                   /codon_start=1
FT                   /gene="Hoxa4"
FT                   /locus_tag="mCG_1050160"
FT                   /product="homeobox A4"
FT                   /note="gene_id=mCG1050160.0 transcript_id=mCT182094.0
FT                   protein_id=mCP105013.0"
FT                   /protein_id="EDK98655.1"
FT                   /translation="MTMSSFLINSNYIEPKFPPFEEFAPHGGPGGGDGAVGGGPGYPRP
FT                   QSAPHLPAPNPHAARQPPAYYAPRAREPSYPGGLYPAPAAACPYACRGASPARPEQSPA
FT                   PGAHPSPAPQPPAPPRHCAPGPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWM
FT                   KKIHVSAVNSSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSER
FT                   QVKIWFQNRRMKWKKDHKLPNTKMRSSNTASAPAGPPGKAQTHSPHPHPHPLPGASTPI
FT                   PSSI"
FT   gene            complement(4408638..4422826)
FT                   /locus_tag="mCG_1050239"
FT                   /note="gene_id=mCG1050239.0"
FT   mRNA            complement(join(4408638..4410427,4422529..4422826))
FT                   /locus_tag="mCG_1050239"
FT                   /product="mCG1050239"
FT                   /note="gene_id=mCG1050239.0 transcript_id=mCT182091.0
FT                   created on 24-MAR-2004"
FT   CDS             complement(4409875..4410108)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050239"
FT                   /product="mCG1050239"
FT                   /note="gene_id=mCG1050239.0 transcript_id=mCT182091.0
FT                   protein_id=mCP105015.0"
FT                   /protein_id="EDK98656.1"
FT                   /translation="MLMTSAAPAGVQKDDCVCVCVCVCVCVCARARACVKMGLSVKTWQ
FT                   PRAFFLRLVRPRLFGGRGALGVEGTQATGGEG"
FT   gene            <4410612..4423086
FT                   /locus_tag="mCG_145831"
FT                   /note="gene_id=mCG145831.0"
FT   mRNA            join(<4410612..4410780,4421875..4421976,4422522..4423086)
FT                   /locus_tag="mCG_145831"
FT                   /product="mCG145831"
FT                   /note="gene_id=mCG145831.0 transcript_id=mCT185939.0
FT                   created on 03-JUL-2003"
FT   gene            complement(4411279..4414076)
FT                   /gene="Hoxa5"
FT                   /locus_tag="mCG_121162"
FT                   /note="gene_id=mCG121162.1"
FT   mRNA            complement(join(4411279..4412320,4413278..4414076))
FT                   /gene="Hoxa5"
FT                   /locus_tag="mCG_121162"
FT                   /product="homeobox A5"
FT                   /note="gene_id=mCG121162.1 transcript_id=mCT122359.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4412070..4412320,4413278..4413839))
FT                   /codon_start=1
FT                   /gene="Hoxa5"
FT                   /locus_tag="mCG_121162"
FT                   /product="homeobox A5"
FT                   /note="gene_id=mCG121162.1 transcript_id=mCT122359.0
FT                   protein_id=mCP62091.1"
FT                   /protein_id="EDK98658.1"
FT                   /translation="MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRY
FT                   GYGYNGMDLSVGRSGSGHFGSGERARSYAAGASAAPAEPRYSQPATSTHSPPPDPLPCS
FT                   AVAPSPGSDSHHGGKNSLGNSSGASANAGSTHISSREGVGTASAAEEDAPASSEQAGAQ
FT                   SEPSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTR
FT                   RRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP"
FT   gene            complement(<4415854..>4418112)
FT                   /gene="Hoxa6"
FT                   /locus_tag="mCG_142758"
FT                   /note="gene_id=mCG142758.0"
FT   mRNA            complement(join(<4415854..4416113,4417674..>4418112))
FT                   /gene="Hoxa6"
FT                   /locus_tag="mCG_142758"
FT                   /product="homeobox A6"
FT                   /note="gene_id=mCG142758.0 transcript_id=mCT182093.0
FT                   created on 29-APR-2003"
FT   CDS             complement(join(4415854..4416113,4417674..4418112))
FT                   /codon_start=1
FT                   /gene="Hoxa6"
FT                   /locus_tag="mCG_142758"
FT                   /product="homeobox A6"
FT                   /note="gene_id=mCG142758.0 transcript_id=mCT182093.0
FT                   protein_id=mCP105016.0"
FT                   /db_xref="GOA:Q0VEU7"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR001827"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR017995"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96178"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VEU7"
FT                   /protein_id="EDK98659.1"
FT                   /translation="MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGAS
FT                   SLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGNNKQRGPGDYLH
FT                   FSPEQQYKPDGSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTR
FT                   YQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQAS
FT                   GEDSEAKAGE"
FT   CDS             <4422567..4422923
FT                   /codon_start=1
FT                   /locus_tag="mCG_145831"
FT                   /product="mCG145831"
FT                   /note="gene_id=mCG145831.0 transcript_id=mCT185939.0
FT                   protein_id=mCP107413.0"
FT                   /protein_id="EDK98657.1"
FT                   /translation="QLSLRQPKRRIVLLPGARGRRKLARLQVAKQRRLLQELDALHLQR
FT                   QRLAWAWQRLPLARHRRTKRSPGRLARQSSEARRMERSKRMRLYSRKGNYKKVHVHGSY
FT                   PHDRQRPMEGPNNS"
FT   gene            complement(4423989..4431260)
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /note="gene_id=mCG121159.1"
FT   mRNA            complement(join(4423989..4425505,4426505..4426772,
FT                   4431023..4431260))
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /product="homeobox A7, transcript variant mCT171651"
FT                   /note="gene_id=mCG121159.1 transcript_id=mCT171651.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(4423989..4425505,4426505..4426772,
FT                   4427408..4427559,4429798..4429874))
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /product="homeobox A7, transcript variant mCT171650"
FT                   /note="gene_id=mCG121159.1 transcript_id=mCT171650.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(4423989..4425505,4426505..4426772,
FT                   4427377..4427559,4428109..4428167))
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /product="homeobox A7, transcript variant mCT171652"
FT                   /note="gene_id=mCG121159.1 transcript_id=mCT171652.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(4423989..4425505,4426505..4428048))
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /product="homeobox A7, transcript variant mCT122356"
FT                   /note="gene_id=mCG121159.1 transcript_id=mCT122356.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4425192..4425505,4426505..4426772,
FT                   4431023..4431112))
FT                   /codon_start=1
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /product="homeobox A7, isoform CRA_b"
FT                   /note="gene_id=mCG121159.1 transcript_id=mCT171651.0
FT                   protein_id=mCP94570.0 isoform=CRA_b"
FT                   /protein_id="EDK98661.1"
FT                   /translation="MRRGLPDLRRSLLPGPIPRPLCCVAAATPKRSGYGPGAGAFASTV
FT                   PGLYNVNSPLYQSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHG
FT                   PAEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLT
FT                   ERQIKIWFQNRRMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEEEEEEEE
FT                   E"
FT   CDS             complement(join(4425192..4425505,4426505..4426880))
FT                   /codon_start=1
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /product="homeobox A7, isoform CRA_c"
FT                   /note="gene_id=mCG121159.1 transcript_id=mCT122356.1
FT                   protein_id=mCP62069.1 isoform=CRA_c"
FT                   /protein_id="EDK98662.1"
FT                   /translation="MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAG
FT                   AFASTVPGLYNVNSPLYQSPFASGYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKAD
FT                   EGVLHGPAEASFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIA
FT                   HALCLTERQIKIWFQNRRMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEE
FT                   EEEEEEE"
FT   CDS             complement(join(4425192..4425505,4426505..4426517))
FT                   /codon_start=1
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /product="homeobox A7, isoform CRA_a"
FT                   /note="gene_id=mCG121159.1 transcript_id=mCT171650.0
FT                   protein_id=mCP94571.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8JZW2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96179"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JZW2"
FT                   /protein_id="EDK98660.1"
FT                   /translation="MRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL
FT                   CLTERQIKIWFQNRRMKWKKEHKDESQAPTAAPEDAVPSVSTAADKADEEEEEEEEEEE
FT                   EEEE"
FT   CDS             complement(join(4425419..4425505,4426505..4426772,
FT                   4427377..4427492))
FT                   /codon_start=1
FT                   /gene="Hoxa7"
FT                   /locus_tag="mCG_121159"
FT                   /product="homeobox A7, isoform CRA_d"
FT                   /note="gene_id=mCG121159.1 transcript_id=mCT171652.0
FT                   protein_id=mCP94569.0 isoform=CRA_d"
FT                   /protein_id="EDK98663.1"
FT                   /translation="MVPVCGSGLSARLEETPRLRCWRWSIKSGLKGFPAYREREAATGR
FT                   APAPSPPLCRAYTMSTAPSIRAPSRPAMAWEPTPTTCPAPPTTKTSPGSAVTSPKAPAT
FT                   RRTRACFTARPKPVSASTPGCAVQDPTGSGDARPTRATRRWNWRRNSISTAT"
FT   gene            complement(4432579..4436846)
FT                   /gene="Hoxa9"
FT                   /locus_tag="mCG_121165"
FT                   /note="gene_id=mCG121165.1"
FT   mRNA            complement(join(4432579..4433958,4435004..4435093,
FT                   4435267..4436846))
FT                   /gene="Hoxa9"
FT                   /locus_tag="mCG_121165"
FT                   /product="homeobox A9, transcript variant mCT171653"
FT                   /note="gene_id=mCG121165.1 transcript_id=mCT171653.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(4432579..4433958,4435004..4436846))
FT                   /gene="Hoxa9"
FT                   /locus_tag="mCG_121165"
FT                   /product="homeobox A9, transcript variant mCT122362"
FT                   /note="gene_id=mCG121165.1 transcript_id=mCT122362.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4433720..4433958,4435004..4435093,
FT                   4435267..4435825))
FT                   /codon_start=1
FT                   /gene="Hoxa9"
FT                   /locus_tag="mCG_121165"
FT                   /product="homeobox A9, isoform CRA_b"
FT                   /note="gene_id=mCG121165.1 transcript_id=mCT171653.0
FT                   protein_id=mCP94572.0 isoform=CRA_b"
FT                   /protein_id="EDK98665.1"
FT                   /translation="MAFAIKIMTAKHRAINSVRSDLRVIVLPGGHVTRVANGGAGAGNL
FT                   LGDCTSPPPGATKLLHEICSFIISAGRAGPARRGLLQWPPPGPWATTMWTPSCWAPTLL
FT                   MSWVRDATLQGPWVNPQGRRQLWPNTPTSVLAASSPRRRCLVPRGTQCTRRAPMRCLLQ
FT                   CIITTTTPTCIPRRPWRRRRRTAVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAAN
FT                   WLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRR
FT                   MKMKKINKDRAKDE"
FT   CDS             complement(join(4433720..4433958,4435004..4435580))
FT                   /codon_start=1
FT                   /gene="Hoxa9"
FT                   /locus_tag="mCG_121165"
FT                   /product="homeobox A9, isoform CRA_a"
FT                   /note="gene_id=mCG121165.1 transcript_id=mCT122362.1
FT                   protein_id=mCP61166.1 isoform=CRA_a"
FT                   /protein_id="EDK98664.1"
FT                   /translation="MATTGALGNYYVDSFLLGADAADELGAGRYAPGTLGQPPRQAAAL
FT                   AEHPDFSPCSFQSKAAVFGASWNPVHAAGANAVPAAVYHHHHHPYVHPQAPVAAAAPDG
FT                   RYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPV
FT                   DREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEK
FT                   EFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE"
FT   gene            complement(4437755..4440009)
FT                   /locus_tag="mCG_146886"
FT                   /note="gene_id=mCG146886.0"
FT   mRNA            complement(4437755..4440009)
FT                   /locus_tag="mCG_146886"
FT                   /product="mCG146886"
FT                   /note="gene_id=mCG146886.0 transcript_id=mCT187149.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(4439624..4439779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146886"
FT                   /product="mCG146886"
FT                   /note="gene_id=mCG146886.0 transcript_id=mCT187149.0
FT                   protein_id=mCP109100.0"
FT                   /protein_id="EDK98666.1"
FT                   /translation="MGLGWCLVQVAEEGSTGHNRRALSLAATVAAAEAARGEATLRPQH
FT                   QNWSVI"
FT   gene            complement(4440674..4450329)
FT                   /gene="Hoxa10"
FT                   /locus_tag="mCG_121167"
FT                   /note="gene_id=mCG121167.2"
FT   mRNA            complement(join(4440674..4442255,4449753..4450329))
FT                   /gene="Hoxa10"
FT                   /locus_tag="mCG_121167"
FT                   /product="homeobox A10, transcript variant mCT194226"
FT                   /note="gene_id=mCG121167.2 transcript_id=mCT194226.0
FT                   created on 24-MAR-2004"
FT   mRNA            complement(join(4440674..4442255,4443434..4444414))
FT                   /gene="Hoxa10"
FT                   /locus_tag="mCG_121167"
FT                   /product="homeobox A10, transcript variant mCT122364"
FT                   /note="gene_id=mCG121167.2 transcript_id=mCT122364.2
FT                   created on 24-MAR-2004"
FT   mRNA            complement(join(4440674..4442255,4442672..4442800))
FT                   /gene="Hoxa10"
FT                   /locus_tag="mCG_121167"
FT                   /product="homeobox A10, transcript variant mCT194225"
FT                   /note="gene_id=mCG121167.2 transcript_id=mCT194225.0
FT                   created on 24-MAR-2004"
FT   CDS             complement(join(4441981..4442255,4449753..4449762))
FT                   /codon_start=1
FT                   /gene="Hoxa10"
FT                   /locus_tag="mCG_121167"
FT                   /product="homeobox A10, isoform CRA_c"
FT                   /note="gene_id=mCG121167.2 transcript_id=mCT194226.0
FT                   protein_id=mCP115255.0 isoform=CRA_c"
FT                   /protein_id="EDK98669.1"
FT                   /translation="MSQGSSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYL
FT                   TRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS"
FT   CDS             complement(join(4441981..4442255,4443434..4444358))
FT                   /codon_start=1
FT                   /gene="Hoxa10"
FT                   /locus_tag="mCG_121167"
FT                   /product="homeobox A10, isoform CRA_a"
FT                   /note="gene_id=mCG121167.2 transcript_id=mCT122364.2
FT                   protein_id=mCP61196.2 isoform=CRA_a"
FT                   /protein_id="EDK98667.1"
FT                   /translation="MSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHGGV
FT                   YLPPASDLPYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWLD
FT                   APRSCRMEPPDGPPPPQPQPQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLY
FT                   DAADKCPKGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQAYGTAKGFGSGGGG
FT                   TQQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEA
FT                   HASSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYTKHQTLEL
FT                   EKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
FT                   "
FT   CDS             complement(4441981..4442139)
FT                   /codon_start=1
FT                   /gene="Hoxa10"
FT                   /locus_tag="mCG_121167"
FT                   /product="homeobox A10, isoform CRA_b"
FT                   /note="gene_id=mCG121167.2 transcript_id=mCT194225.0
FT                   protein_id=mCP115254.0 isoform=CRA_b"
FT                   /protein_id="EDK98668.1"
FT                   /translation="MYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIREL
FT                   TANFNFS"
FT   gene            complement(4451581..4455240)
FT                   /gene="Hoxa11"
FT                   /locus_tag="mCG_121158"
FT                   /note="gene_id=mCG121158.1"
FT   mRNA            complement(join(4451581..4453067,4454484..4455240))
FT                   /gene="Hoxa11"
FT                   /locus_tag="mCG_121158"
FT                   /product="homeobox A11"
FT                   /note="gene_id=mCG121158.1 transcript_id=mCT122355.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4452835..4453067,4454484..4455192))
FT                   /codon_start=1
FT                   /gene="Hoxa11"
FT                   /locus_tag="mCG_121158"
FT                   /product="homeobox A11"
FT                   /note="gene_id=mCG121158.1 transcript_id=mCT122355.0
FT                   protein_id=mCP62065.1"
FT                   /protein_id="EDK98670.1"
FT                   /translation="MMDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMT
FT                   YSYSSNLPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVP
FT                   GDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGD
FT                   KNAEKGPQAAAATSAAAVAAAATGAPATSSSDGGGGGGCQEAAAEEKERRRRPESSSSP
FT                   ESSSGHTEDKAGGSGGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLT
FT                   DRQVKIWFQNRRMKEKKINRDRLQYYSANPLL"
FT   gene            4454555..4459270
FT                   /locus_tag="mCG_140827"
FT                   /note="gene_id=mCG140827.0"
FT   mRNA            join(4454555..4455129,4456137..4456282,4458558..4459270)
FT                   /locus_tag="mCG_140827"
FT                   /product="mCG140827, transcript variant mCT171695"
FT                   /note="gene_id=mCG140827.0 transcript_id=mCT171695.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(4454716..4455289,4455459..4455674,4456111..4456282,
FT                   4458558..4459270)
FT                   /locus_tag="mCG_140827"
FT                   /product="mCG140827, transcript variant mCT171694"
FT                   /note="gene_id=mCG140827.0 transcript_id=mCT171694.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(4454716..4455289,4455459..4455674,4456137..4456282,
FT                   4458558..4459264)
FT                   /locus_tag="mCG_140827"
FT                   /product="mCG140827, transcript variant mCT171696"
FT                   /note="gene_id=mCG140827.0 transcript_id=mCT171696.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(<4454716..4455289,4455459..4455674,4455789..4456005,
FT                   4456137..4456282,4458558..4459243)
FT                   /locus_tag="mCG_140827"
FT                   /product="mCG140827, transcript variant mCT189085"
FT                   /note="gene_id=mCG140827.0 transcript_id=mCT189085.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<4455958..4456005,4456137..4456282,4458558..4458870)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140827"
FT                   /product="mCG140827, isoform CRA_b"
FT                   /note="gene_id=mCG140827.0 transcript_id=mCT189085.0
FT                   protein_id=mCP110077.0 isoform=CRA_b"
FT                   /protein_id="EDK98673.1"
FT                   /translation="CLPSPNRQQAKRLPSAGFGVTPQSQRHFCSPVRKLPGLLKLTNRE
FT                   TMQLRRTLGCFRGAEEPSPGRPKVDFSPPGSGEDPTRDKSTPKGQVRVPFLEEAASGKA
FT                   MTLALDIGFPGAAFSQELHSTGLSPENALQRLFLLIVARSPKAANARGQKCLEEEKQRQ
FT                   EVAAA"
FT   CDS             join(4456227..4456282,4458558..4458870)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140827"
FT                   /product="mCG140827, isoform CRA_a"
FT                   /note="gene_id=mCG140827.0 transcript_id=mCT171694.0
FT                   protein_id=mCP94615.0 isoform=CRA_a"
FT                   /protein_id="EDK98671.1"
FT                   /translation="MQLRRTLGCFRGAEEPSPGRPKVDFSPPGSGEDPTRDKSTPKGQV
FT                   RVPFLEEAASGKAMTLALDIGFPGAAFSQELHSTGLSPENALQRLFLLIVARSPKAANA
FT                   RGQKCLEEEKQRQEVAAA"
FT   CDS             join(4456227..4456282,4458558..4458870)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140827"
FT                   /product="mCG140827, isoform CRA_a"
FT                   /note="gene_id=mCG140827.0 transcript_id=mCT171696.0
FT                   protein_id=mCP94613.0 isoform=CRA_a"
FT                   /protein_id="EDK98672.1"
FT                   /translation="MQLRRTLGCFRGAEEPSPGRPKVDFSPPGSGEDPTRDKSTPKGQV
FT                   RVPFLEEAASGKAMTLALDIGFPGAAFSQELHSTGLSPENALQRLFLLIVARSPKAANA
FT                   RGQKCLEEEKQRQEVAAA"
FT   CDS             join(4456227..4456282,4458558..4458870)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140827"
FT                   /product="mCG140827, isoform CRA_a"
FT                   /note="gene_id=mCG140827.0 transcript_id=mCT171695.0
FT                   protein_id=mCP94614.0 isoform=CRA_a"
FT                   /protein_id="EDK98674.1"
FT                   /translation="MQLRRTLGCFRGAEEPSPGRPKVDFSPPGSGEDPTRDKSTPKGQV
FT                   RVPFLEEAASGKAMTLALDIGFPGAAFSQELHSTGLSPENALQRLFLLIVARSPKAANA
FT                   RGQKCLEEEKQRQEVAAA"
FT   gene            complement(4468323..>4469977)
FT                   /gene="Hoxa13"
FT                   /locus_tag="mCG_121160"
FT                   /note="gene_id=mCG121160.1"
FT   mRNA            complement(join(4468323..4468618,4469334..>4469977))
FT                   /gene="Hoxa13"
FT                   /locus_tag="mCG_121160"
FT                   /product="homeobox A13"
FT                   /note="gene_id=mCG121160.1 transcript_id=mCT122357.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4468374..4468618,4469334..>4469976))
FT                   /codon_start=1
FT                   /gene="Hoxa13"
FT                   /locus_tag="mCG_121160"
FT                   /product="homeobox A13"
FT                   /note="gene_id=mCG121160.1 transcript_id=mCT122357.1
FT                   protein_id=mCP62081.1"
FT                   /protein_id="EDK98675.1"
FT                   /translation="AHPAPLAPGAAAAYSSAPGEAPPSAAAAAAAAAAAAAAAAAASSS
FT                   GGPGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYPCARMGPHPNAIKSCA
FT                   QPASAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPVPGYLDMPVVP
FT                   GLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQTQPPHLWKSTLPDVVSHPSD
FT                   ASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRR
FT                   VKEKKVINKLKTTS"
FT   gap             4469978..4470293
FT                   /estimated_length=316
FT   gene            <4472074..4476378
FT                   /locus_tag="mCG_121173"
FT                   /note="gene_id=mCG121173.2"
FT   mRNA            join(<4472074..4472163,4474668..4475389)
FT                   /locus_tag="mCG_121173"
FT                   /product="mCG121173, transcript variant mCT122370"
FT                   /note="gene_id=mCG121173.2 transcript_id=mCT122370.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(<4472082..4472717,4474668..4476378)
FT                   /locus_tag="mCG_121173"
FT                   /product="mCG121173, transcript variant mCT189061"
FT                   /note="gene_id=mCG121173.2 transcript_id=mCT189061.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<4472091..4472163,4474668..4474879)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121173"
FT                   /product="mCG121173, isoform CRA_a"
FT                   /note="gene_id=mCG121173.2 transcript_id=mCT122370.1
FT                   protein_id=mCP61489.1 isoform=CRA_a"
FT                   /protein_id="EDK98676.1"
FT                   /translation="QRDEVRFQAPILGDSRRLEGSLHTGTTGPAWSQPSGRDSKENSNC
FT                   ITLYFLPSLKEGRRHLRPHPSPVLEALAAGFRLWGAAPPTPLPEIPSTE"
FT   CDS             join(<4472232..4472717,4474668..4474802)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121173"
FT                   /product="mCG121173, isoform CRA_b"
FT                   /note="gene_id=mCG121173.2 transcript_id=mCT189061.0
FT                   protein_id=mCP110055.0 isoform=CRA_b"
FT                   /protein_id="EDK98677.1"
FT                   /translation="KPRDRADCPPPLALNSPILCYLASGSVWFLSIFFFSLSLCRVLGA
FT                   VFTGWTGSFLSAALLLAGFLNLRSFPARFGKNENTAQEGSTSRCLCQFTSGSGCTAGPH
FT                   SSQDQLHVLSSPSVHWSREPCTQGKGLSSTDCQSRLGPSGSKNGEKGTHLFPQRNQKQV
FT                   QRDQPGASHREEIVKRTPTASPSISYRVSKKGEGTSARTPPPF"
FT   gap             4510988..4511007
FT                   /estimated_length=20
FT   gene            complement(4517653..4524075)
FT                   /locus_tag="mCG_140829"
FT                   /note="gene_id=mCG140829.0"
FT   mRNA            complement(join(4517653..4520136,4521992..4522069,
FT                   4522543..4522809,4524010..4524075))
FT                   /locus_tag="mCG_140829"
FT                   /product="mCG140829"
FT                   /note="gene_id=mCG140829.0 transcript_id=mCT171698.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4522056..4522069,4522543..4522711))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140829"
FT                   /product="mCG140829"
FT                   /note="gene_id=mCG140829.0 transcript_id=mCT171698.0
FT                   protein_id=mCP94617.0"
FT                   /protein_id="EDK98678.1"
FT                   /translation="MRQVWASLEWGGECENRETHTLGKGDTQTQRMQMEFRTQKRERLR
FT                   RAASSTGATGLDGLI"
FT   gene            4522736..4527622
FT                   /gene="Evx1"
FT                   /locus_tag="mCG_121166"
FT                   /note="gene_id=mCG121166.1"
FT   mRNA            join(4522736..4523510,4524977..4525233,4525772..4527622)
FT                   /gene="Evx1"
FT                   /locus_tag="mCG_121166"
FT                   /product="even skipped homeotic gene 1 homolog"
FT                   /note="gene_id=mCG121166.1 transcript_id=mCT122363.0
FT                   created on 05-AUG-2002"
FT   CDS             join(4523084..4523510,4524977..4525233,4525772..4526338)
FT                   /codon_start=1
FT                   /gene="Evx1"
FT                   /locus_tag="mCG_121166"
FT                   /product="even skipped homeotic gene 1 homolog"
FT                   /note="gene_id=mCG121166.1 transcript_id=mCT122363.0
FT                   protein_id=mCP61192.1"
FT                   /protein_id="EDK98679.1"
FT                   /translation="MESRKDMVMFLDGGQLGTLVGKRVSNLSEAVSSPLPEPPEKMVPH
FT                   GCLSPRAGPPTSRERGGGGQEEEPVDGLAGSAAGLGAEPRSAGAAMLGPGPPVPSADSL
FT                   SGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKAPGSDALGSSPTSGSEAPKSN
FT                   GGSGGSGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNL
FT                   PETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPY
FT                   YSPVGLGAASAASAAASPFSGPLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLG
FT                   ASAAAAAAAGPCSCLACHSGPANGLAPRAAAAAAASDFTCASTSRSDSFLTFAPSVLSK
FT                   ASSVAALDQREEVPLTR"
FT   gap             4536581..4536739
FT                   /estimated_length=159
FT   gap             4555388..4555452
FT                   /estimated_length=65
FT   gene            complement(4555814..4556146)
FT                   /locus_tag="mCG_121163"
FT                   /note="gene_id=mCG121163.1"
FT   mRNA            complement(4555814..4556146)
FT                   /locus_tag="mCG_121163"
FT                   /product="mCG121163"
FT                   /note="gene_id=mCG121163.1 transcript_id=mCT122360.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(4555873..4556085)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121163"
FT                   /product="mCG121163"
FT                   /note="gene_id=mCG121163.1 transcript_id=mCT122360.1
FT                   protein_id=mCP62106.1"
FT                   /protein_id="EDK98680.1"
FT                   /translation="MPRKIEEIKDFLLTARQKDAKSVKIKKNKDNVKFKVRCSRYLYTL
FT                   VITDKEKAEKLKQSLPPGLAVKDLK"
FT   gap             4602986..4603005
FT                   /estimated_length=20
FT   gap             4639749..4639793
FT                   /estimated_length=45
FT   gap             4663033..4663152
FT                   /estimated_length=120
FT   gap             4669016..4669035
FT                   /estimated_length=20
FT   gene            <4701739..4709377
FT                   /locus_tag="mCG_144841"
FT                   /note="gene_id=mCG144841.0"
FT   mRNA            join(<4701739..4701768,4702947..4703100,4708897..4709377)
FT                   /locus_tag="mCG_144841"
FT                   /product="mCG144841"
FT                   /note="gene_id=mCG144841.0 transcript_id=mCT184265.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4703098..4703100,4708897..4709157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144841"
FT                   /product="mCG144841"
FT                   /note="gene_id=mCG144841.0 transcript_id=mCT184265.0
FT                   protein_id=mCP105482.0"
FT                   /protein_id="EDK98681.1"
FT                   /translation="EVFSEIRARLEASKIKQSCLCSHRPPGSQASIGSCSVLSQDLNSA
FT                   THACAACTLLKAMSSTPEWFLSITRLARFNFSFAPSYRHFVK"
FT   gap             4720097..4721893
FT                   /estimated_length=1797
FT   gap             4724198..4724704
FT                   /estimated_length=507
FT   gap             4746450..4746469
FT                   /estimated_length=20
FT   gap             4755475..4755494
FT                   /estimated_length=20
FT   gene            complement(4757379..4851389)
FT                   /gene="Hibadh"
FT                   /locus_tag="mCG_121170"
FT                   /note="gene_id=mCG121170.1"
FT   mRNA            complement(join(4757379..4758212,4759965..4760121,
FT                   4767482..4767558,4768823..4768956,4831005..4831126,
FT                   4833879..4833988,4841217..4841377,4851189..4851389))
FT                   /gene="Hibadh"
FT                   /locus_tag="mCG_121170"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /note="gene_id=mCG121170.1 transcript_id=mCT122367.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4758054..4758212,4759965..4760121,
FT                   4767482..4767558,4768823..4768956,4831005..4831126,
FT                   4833879..4833988,4841217..4841377,4851189..4851276))
FT                   /codon_start=1
FT                   /gene="Hibadh"
FT                   /locus_tag="mCG_121170"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /note="gene_id=mCG121170.1 transcript_id=mCT122367.1
FT                   protein_id=mCP61385.1"
FT                   /protein_id="EDK98682.1"
FT                   /translation="MAASLGFRGAASGLWYWSGRRRPVGSLAAVCSRSMASKTPVGFIG
FT                   LGNMGNPMAKNLMKHGYPLILYDVFPDVCKEFKEAGEQVASSPAEVAEKADRIITMLPS
FT                   SMNAVEVYSGANGILKKVKKGSLLIDSSTIDPSVSKELAKEVEKMGAVFMDAPVSGGVG
FT                   AARSGNLTFMVGGVEDEFAAAQELLECMGSNVVYCGAVGTGQSAKICNNMLLAISMIGT
FT                   AEAMNLGIRSGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMHGVPSSNNYQGGFGTTLM
FT                   AKDLGLAQDSATSTKTPILLGSLAHQIYRMMCSKGYSKKDFSSVFQYLREEEPF"
FT   gap             4763307..4763382
FT                   /estimated_length=76
FT   gap             4854379..4854427
FT                   /estimated_length=49
FT   gap             4855751..4857008
FT                   /estimated_length=1258
FT   gap             4858064..4858120
FT                   /estimated_length=57
FT   gap             4864827..4865430
FT                   /estimated_length=604
FT   gap             4895953..4895972
FT                   /estimated_length=20
FT   gap             4903902..4903954
FT                   /estimated_length=53
FT   gene            4925865..4978980
FT                   /gene="Tax1bp1"
FT                   /locus_tag="mCG_121157"
FT                   /note="gene_id=mCG121157.1"
FT   mRNA            join(4925865..4925973,4933416..4933584,4939319..4939421,
FT                   4941401..4941588,4945311..4945469,4948972..4949120,
FT                   4949204..4949294,4951666..4951851,4954073..4954297,
FT                   4954814..4954960,4956344..4956476,4958789..4958889,
FT                   4963207..4963332,4965427..4965498,4969676..4969850,
FT                   4970335..4970477,4977224..4977306,4978076..4978980)
FT                   /gene="Tax1bp1"
FT                   /locus_tag="mCG_121157"
FT                   /product="Tax1 (human T-cell leukemia virus type I) binding
FT                   protein 1"
FT                   /note="gene_id=mCG121157.1 transcript_id=mCT122354.1
FT                   created on 05-AUG-2002"
FT   CDS             join(4933423..4933584,4939319..4939421,4941401..4941588,
FT                   4945311..4945469,4948972..4949120,4949204..4949294,
FT                   4951666..4951851,4954073..4954297,4954814..4954960,
FT                   4956344..4956476,4958789..4958889,4963207..4963332,
FT                   4965427..4965498,4969676..4969850,4970335..4970477,
FT                   4977224..4977306,4978076..4978277)
FT                   /codon_start=1
FT                   /gene="Tax1bp1"
FT                   /locus_tag="mCG_121157"
FT                   /product="Tax1 (human T-cell leukemia virus type I) binding
FT                   protein 1"
FT                   /note="gene_id=mCG121157.1 transcript_id=mCT122354.1
FT                   protein_id=mCP62017.1"
FT                   /protein_id="EDK98683.1"
FT                   /translation="MTSFQEVQLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPH
FT                   SKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCY
FT                   VTHKGEIRGASTPFQFRAASPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTLKEKEE
FT                   LLKLIAVLEKETAQLREQVGRMERELSQEKGRCEQLQAEQKGLLEVSQSLRVENEEFMK
FT                   RYSDATAKVQQLEEDIVSVTHKAIEKETDLDSLKDKLRKAQHEREQLECQLQTEKDEKE
FT                   LYKVHLKNTEIENTKLVSEIQTLKNLDGNKESMITHFKEEISKLQSCLADKENLYRALL
FT                   LTTSNKEDTLFLKEQLRKAEEQVQATRQELIFLTKELSDAVNVRDKTMADLHTARLENE
FT                   RVKKQLADTLAELQLHAVKKDQEKTDTLEHELRREVEDLKLRLQMAADHYREKFKECQR
FT                   LQKQINKLSDQAASTNSVFTKKMGSQQKVNDASINTDPAASTSASAVDVKPAASCAETG
FT                   FDMSTKDHVCEMTKEIAEKIEKYNKCKQLLQDEKTKCNKYAEELAKMELKWKEQVKIAE
FT                   NVKLELAEVEDNYKVQLAEKEKEINGLASYLENLSREKELTKSLEDQKGRKLEGQSPQQ
FT                   VSRCLNTCSEQNGLLPPLSSAQPVLQYGNPYSAQETRDGADGAFYPDEIQRPPVRVPSW
FT                   EDNVVCSQPARNLSRPDGLEDPEDSREDENVPIPPDPANQHLRSHGAGFCFDSSFDVHK
FT                   KCPLCELMFPPNYDQTKFEEHVESHWKVCPMCSEQFPPDYDQQGFERHVQTHFDQNVLN
FT                   FD"
FT   gap             4975351..4975599
FT                   /estimated_length=249
FT   gene            complement(4981000..>4989916)
FT                   /gene="AI591476"
FT                   /locus_tag="mCG_121172"
FT                   /note="gene_id=mCG121172.1"
FT   mRNA            complement(join(4981000..4982583,4989738..>4989916))
FT                   /gene="AI591476"
FT                   /locus_tag="mCG_121172"
FT                   /product="expressed sequence AI591476"
FT                   /note="gene_id=mCG121172.1 transcript_id=mCT122369.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4982407..4982583,4989738..>4989914))
FT                   /codon_start=1
FT                   /gene="AI591476"
FT                   /locus_tag="mCG_121172"
FT                   /product="expressed sequence AI591476"
FT                   /note="gene_id=mCG121172.1 transcript_id=mCT122369.1
FT                   protein_id=mCP61418.0"
FT                   /protein_id="EDK98684.1"
FT                   /translation="STGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEK
FT                   PFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH
FT                   PPVSAEMIRKMQQ"
FT   gap             5032802..5032821
FT                   /estimated_length=20
FT   gap             5082805..5082824
FT                   /estimated_length=20
FT   gene            5114885..>5116840
FT                   /locus_tag="mCG_1036780"
FT                   /note="gene_id=mCG1036780.1"
FT   mRNA            join(5114885..5115134,5115797..5116021,5116731..>5116840)
FT                   /locus_tag="mCG_1036780"
FT                   /product="mCG1036780"
FT                   /note="gene_id=mCG1036780.1 transcript_id=mCT154484.1
FT                   created on 05-AUG-2002"
FT   CDS             join(5115976..5116021,5116731..5116840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036780"
FT                   /product="mCG1036780"
FT                   /note="gene_id=mCG1036780.1 transcript_id=mCT154484.1
FT                   protein_id=mCP61627.1"
FT                   /protein_id="EDK98685.1"
FT                   /translation="MKYSSTSDPVTQRFLRNVSLGQARIPKKKEVESKVNPSREALNNQ
FT                   AENTEE"
FT   gap             5136718..5137250
FT                   /estimated_length=533
FT   gene            complement(5165179..>5165827)
FT                   /locus_tag="mCG_1036781"
FT                   /note="gene_id=mCG1036781.1"
FT   mRNA            complement(5165179..>5165827)
FT                   /locus_tag="mCG_1036781"
FT                   /product="mCG1036781"
FT                   /note="gene_id=mCG1036781.1 transcript_id=mCT154485.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(5165561..>5165827)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036781"
FT                   /product="mCG1036781"
FT                   /note="gene_id=mCG1036781.1 transcript_id=mCT154485.1
FT                   protein_id=mCP61653.1"
FT                   /protein_id="EDK98686.1"
FT                   /translation="AFIFFSEQFRKCSPLKCSIDFESLFYLLETCTPRATTDRPAPCGC
FT                   YTLVCCTHQVIFKEKLPRSLLHSPLSYLQSLLMMLWQGLQKML"
FT   gap             5205120..5209077
FT                   /estimated_length=3958
FT   gene            complement(5227295..5228542)
FT                   /locus_tag="mCG_140826"
FT                   /note="gene_id=mCG140826.0"
FT   mRNA            complement(5227295..5228542)
FT                   /locus_tag="mCG_140826"
FT                   /product="mCG140826"
FT                   /note="gene_id=mCG140826.0 transcript_id=mCT171693.0
FT                   created on 05-AUG-2002"
FT   CDS             complement(5227636..5227932)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140826"
FT                   /product="mCG140826"
FT                   /note="gene_id=mCG140826.0 transcript_id=mCT171693.0
FT                   protein_id=mCP94612.0"
FT                   /protein_id="EDK98687.1"
FT                   /translation="MLSLCEGAGQLMMLGVSLLCEAGLICSDLKTGNGRQASWTPLVQP
FT                   SPACVFFHAYLGGALKSGSLSRCHRDHKNKSRLQKKSHENTLALGLGHQFLSE"
FT   gap             5299589..5300298
FT                   /estimated_length=710
FT   gap             5314854..5315241
FT                   /estimated_length=388
FT   gap             5316704..5321343
FT                   /estimated_length=4640
FT   gap             5348525..5348874
FT                   /estimated_length=350
FT   gene            <5349257..5367331
FT                   /locus_tag="mCG_1036783"
FT                   /note="gene_id=mCG1036783.1"
FT   mRNA            join(<5349257..5349346,5353644..5353740,5357274..5357435,
FT                   5367063..5367331)
FT                   /locus_tag="mCG_1036783"
FT                   /product="mCG1036783"
FT                   /note="gene_id=mCG1036783.1 transcript_id=mCT154487.0
FT                   created on 05-AUG-2002"
FT   CDS             join(<5349276..5349346,5353644..5353734)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036783"
FT                   /product="mCG1036783"
FT                   /note="gene_id=mCG1036783.1 transcript_id=mCT154487.0
FT                   protein_id=mCP61680.0"
FT                   /protein_id="EDK98688.1"
FT                   /translation="VTARSLDFHSQLRLNHCWELGCRLLLLMIQPKLAWNPRTFCLSLL
FT                   SAGVPYHI"
FT   gap             5349459..5349658
FT                   /estimated_length=200
FT   gap             5368040..5368686
FT                   /estimated_length=647
FT   gap             5370200..5371084
FT                   /estimated_length=885
FT   gap             5376422..5376702
FT                   /estimated_length=281
FT   gap             5387669..5390462
FT                   /estimated_length=2794
FT   gap             5400063..5400503
FT                   /estimated_length=441
FT   gap             5427153..5427172
FT                   /estimated_length=20
FT   gap             5428357..5428376
FT                   /estimated_length=20
FT   gene            5434341..5439914
FT                   /locus_tag="mCG_1036785"
FT                   /note="gene_id=mCG1036785.1"
FT   mRNA            join(5434341..5434443,5435138..5435242,5437053..5437480)
FT                   /locus_tag="mCG_1036785"
FT                   /product="mCG1036785, transcript variant mCT171644"
FT                   /note="gene_id=mCG1036785.1 transcript_id=mCT171644.0
FT                   created on 05-AUG-2002"
FT   mRNA            join(5434981..5435019,5435138..5435242,5439227..5439914)
FT                   /locus_tag="mCG_1036785"
FT                   /product="mCG1036785, transcript variant mCT154489"
FT                   /note="gene_id=mCG1036785.1 transcript_id=mCT154489.1
FT                   created on 05-AUG-2002"
FT   CDS             join(5435200..5435242,5439227..5439321)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036785"
FT                   /product="mCG1036785, isoform CRA_a"
FT                   /note="gene_id=mCG1036785.1 transcript_id=mCT154489.1
FT                   protein_id=mCP61713.1 isoform=CRA_a"
FT                   /protein_id="EDK98689.1"
FT                   /translation="MMPTVKTSVLILFTGMNLQKQRETAGIPQEVLCRVSLYDVKSSKD
FT                   "
FT   CDS             join(5435200..5435242,5437053..5437285)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036785"
FT                   /product="mCG1036785, isoform CRA_b"
FT                   /note="gene_id=mCG1036785.1 transcript_id=mCT171644.0
FT                   protein_id=mCP94563.0 isoform=CRA_b"
FT                   /protein_id="EDK98690.1"
FT                   /translation="MMPTVKTSVLILFTGESSFLFSLSQRLPVTCWGTQRRKKDGQRAR
FT                   GQQIAKPRAVSFMFFDNCSSSRSYSFHLLMNILAFNHRYHFIETFA"
FT   gap             5450922..5450941
FT                   /estimated_length=20
FT   gene            complement(5451668..5452743)
FT                   /locus_tag="mCG_119090"
FT                   /note="gene_id=mCG119090.1"
FT   mRNA            complement(join(5451668..5451966,5452135..5452743))
FT                   /locus_tag="mCG_119090"
FT                   /product="mCG119090"
FT                   /note="gene_id=mCG119090.1 transcript_id=mCT120249.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(5451937..5451966,5452135..5452710))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119090"
FT                   /product="mCG119090"
FT                   /note="gene_id=mCG119090.1 transcript_id=mCT120249.1
FT                   protein_id=mCP61344.1"
FT                   /protein_id="EDK98691.1"
FT                   /translation="MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGRGRG
FT                   RGRGARGGKAEDKEWIPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKD
FT                   EVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAKLSIV
FT                   PVRRGYWGNKIGKPHTVPCKVTGRCGSVLKAPDDGRYR"
FT   gap             5452044..5452134
FT                   /estimated_length=91
FT   gap             5453295..5453314
FT                   /estimated_length=20
FT   gap             5480066..5480267
FT                   /estimated_length=202
FT   gene            <5503932..5911005
FT                   /gene="Creb5"
FT                   /locus_tag="mCG_140817"
FT                   /note="gene_id=mCG140817.0"
FT   mRNA            join(<5503932..5503990,5504155..5504359,5587381..5587452,
FT                   5593537..5593630,5606317..5606438,5664180..5664352,
FT                   5819190..5819316,5825149..5825259,5895735..5896058,
FT                   5899900..5900127,5907459..5907567,5908499..5911005)
FT                   /gene="Creb5"
FT                   /locus_tag="mCG_140817"
FT                   /product="cAMP responsive element binding protein 5"
FT                   /note="gene_id=mCG140817.0 transcript_id=mCT171646.0
FT                   created on 05-AUG-2002"
FT   CDS             join(5503932..5503990,5504155..5504359,5587381..5587452,
FT                   5593537..5593630,5606317..5606438,5664180..5664352,
FT                   5819190..5819316,5825149..5825259,5895735..5896058,
FT                   5899900..5900127,5907459..5907567,5908499..5908662)
FT                   /codon_start=1
FT                   /gene="Creb5"
FT                   /locus_tag="mCG_140817"
FT                   /product="cAMP responsive element binding protein 5"
FT                   /note="gene_id=mCG140817.0 transcript_id=mCT171646.0
FT                   protein_id=mCP94565.0"
FT                   /protein_id="EDK98692.1"
FT                   /translation="MLSGASAVSDPVCVRVWERAPRNLEPPRIPFLSDAAEPREKVSKL
FT                   PTVAAKSPGHLGAAERVRRGFSLSRVPSGRCQFSRPAAGCSGRIYEESKMNLEQERPFV
FT                   CSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCEEVGLFS
FT                   ELDCSFEHEFRKAQEEENSKRNISMHNTVGGTMTGPGAHQLGSTRMPNHDSSVVIQQAM
FT                   PSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAV
FT                   LMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMS
FT                   TIGHMMEMMGSRQDQTPHHHLHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHP
FT                   HHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVD
FT                   EDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQ
FT                   LKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVV
FT                   GSSTLSQLTTHRTDLNPIL"
FT   gap             5526327..5526476
FT                   /estimated_length=150
FT   gap             5532708..5532727
FT                   /estimated_length=20
FT   gap             5549931..5549950
FT                   /estimated_length=20
FT   gap             5572213..5572232
FT                   /estimated_length=20
FT   gap             5636982..5637001
FT                   /estimated_length=20
FT   gap             5638408..5638427
FT                   /estimated_length=20
FT   gap             5639462..5639481
FT                   /estimated_length=20
FT   gap             5640888..5640907
FT                   /estimated_length=20
FT   gap             5642797..5642816
FT                   /estimated_length=20
FT   gap             5681508..5683308
FT                   /estimated_length=1801
FT   gap             5699805..5700942
FT                   /estimated_length=1138
FT   gap             5707089..5707108
FT                   /estimated_length=20
FT   gap             5719862..5720137
FT                   /estimated_length=276
FT   gap             5780729..5781012
FT                   /estimated_length=284
FT   gap             5894688..5894756
FT                   /estimated_length=69
FT   gap             5987836..5988021
FT                   /estimated_length=186
FT   gene            5992284..5993043
FT                   /pseudo
FT                   /locus_tag="mCG_119093"
FT                   /note="gene_id=mCG119093.1"
FT   mRNA            5992284..5993043
FT                   /pseudo
FT                   /locus_tag="mCG_119093"
FT                   /note="gene_id=mCG119093.1 transcript_id=mCT120254.1
FT                   created on 05-AUG-2002"
FT   gap             6001648..6006796
FT                   /estimated_length=5149
FT   gene            complement(6031453..6035178)
FT                   /gene="1200009O22Rik"
FT                   /locus_tag="mCG_1036418"
FT                   /note="gene_id=mCG1036418.1"
FT   mRNA            complement(6031453..6035178)
FT                   /gene="1200009O22Rik"
FT                   /locus_tag="mCG_1036418"
FT                   /product="RIKEN cDNA 1200009O22"
FT                   /note="gene_id=mCG1036418.1 transcript_id=mCT154122.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(6032261..6034690)
FT                   /codon_start=1
FT                   /gene="1200009O22Rik"
FT                   /locus_tag="mCG_1036418"
FT                   /product="RIKEN cDNA 1200009O22"
FT                   /note="gene_id=mCG1036418.1 transcript_id=mCT154122.1
FT                   protein_id=mCP61101.0"
FT                   /protein_id="EDK98693.1"
FT                   /translation="MEGVGAVRFWLVVCGCLAFPPRAESVCPERCDCQHPQHLLCTNRG
FT                   LRAVPKTSSLPSPQDVLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFE
FT                   KLSRLEELYLGNNLLQALVPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLD
FT                   GNVLGALPDAVFAPLGNLLYLHLESNRIRFLGKNAFSQLGKLRFLNLSANELQPSLRHA
FT                   ATFVPLRSLSTLILSANSLQHLGPRVFQHLPRLGLLSLSGNQLTHLAPEAFWGLEALRE
FT                   LRLEGNRLNQLPLTLLEPLHSLEALDLSGNELSALHPATFGHQGRLRELSLRDNALSAL
FT                   SGDIFAASPALYRLDLDGNGWTCDCRLRGLKRWMGNWHSQGRLLTVFVQCRHPPALRGK
FT                   YLDYLDDQLLQNGSCVDPSPSPTAGSRQWPLPTSSEEGMTPPAGLSQELPLQPQPQPQQ
FT                   RGRLLPGVAWGGAAKELVGNRSALRLSRRGPGPHQGPSAAAPGSAPQSLDLHEKPGRGR
FT                   HTRANLSQTEPTPTSEPASGTPSARDSWQRAAKQRLASEQQESAVQSVSGVGLPPLVSD
FT                   PCDFNKFILCNLTVEAVSANSASVRWAVREHRSPRPQGGARFRLLFDRFGQQPKFQRFV
FT                   YLPERSDSATLHELRGDTPYLVCVEGVLGGRVCPVAPRDHCAGLVTLPEAGGRGGVDYQ
FT                   LLTLVLLAVNALLVLLALAAWGSRWLRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGV
FT                   SADFSGFQSHRPRTTVCALSEADLIEFPCDRFMDSTGGGTSGSLRREDHLLQRFAD"
FT   gene            <6033197..6082615
FT                   /locus_tag="mCG_145832"
FT                   /note="gene_id=mCG145832.0"
FT   mRNA            join(<6033197..6033490,6071628..6071805,6072950..6073037,
FT                   6073271..6073380,6081220..6082615)
FT                   /locus_tag="mCG_145832"
FT                   /product="mCG145832"
FT                   /note="gene_id=mCG145832.0 transcript_id=mCT185940.0
FT                   created on 03-JUL-2003"
FT   CDS             <6081662..6082018
FT                   /codon_start=1
FT                   /locus_tag="mCG_145832"
FT                   /product="mCG145832"
FT                   /note="gene_id=mCG145832.0 transcript_id=mCT185940.0
FT                   protein_id=mCP107414.0"
FT                   /protein_id="EDK98694.1"
FT                   /translation="ERSKVLQRLGSFYEVNLKKLISGDVMSPIKYSSWQHAGPRDTRSG
FT                   FYGPFPMTATLCRCHRFIDWKGTVSISFQYERAYLCSHFKMKQIYRHSRTLPLDISQGV
FT                   VTPVVKYLQMTPCS"
FT   gene            complement(6087710..6193880)
FT                   /locus_tag="mCG_121673"
FT                   /note="gene_id=mCG121673.1"
FT   mRNA            complement(join(6087710..6087955,6110906..6111088,
FT                   6139595..6139768,6141272..6141370,6146874..6146996,
FT                   6162931..6162997,6167733..6167812,6168707..6168765,
FT                   6169713..6169827,6182951..6183069,6189817..6190002,
FT                   6193841..6193880))
FT                   /locus_tag="mCG_121673"
FT                   /product="mCG121673"
FT                   /note="gene_id=mCG121673.1 transcript_id=mCT122884.1
FT                   created on 21-SEP-2002"
FT   CDS             complement(join(6087845..6087955,6110906..6111088,
FT                   6139595..6139768,6141272..6141370,6146874..6146996,
FT                   6162931..6162997,6167733..6167812,6168707..6168765,
FT                   6169713..6169827,6182951..6183069,6189817..6189991))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121673"
FT                   /product="mCG121673"
FT                   /note="gene_id=mCG121673.1 transcript_id=mCT122884.1
FT                   protein_id=mCP62135.1"
FT                   /protein_id="EDK98695.1"
FT                   /translation="MVRAKWKMVVSLILFMVSPGDGLFHAVYRSILVSQSFKGDAGQPL
FT                   FLSPYIKNGKIKEGQRKSMVSPFPGMNDKSYAGYITVNQTYNSNLFFWFFPARMQPEDA
FT                   PVVLWLQGGPGGSSMFGLFVEHGPYIITSNMTVVARDFPWTFTLSMLYIDNPVGTGFSF
FT                   TDHFQGYATSEDDVAQDLYSALIQFFTLFPEYAKNDFYVTGESYAGKYVPALAHYIHSL
FT                   NPVRKFKIRLKGIAIGDAYTDPESILDKLLDGDVTTGSSFFQNVTGCTNYYNILQCTEP
FT                   KEQSYFAKFLTLPQVRQAIHVGNQNFSDGAEVEKHLREDTVKSVKPWLSEIMNYYKVLI
FT                   YNGQLDIIVAAALTERSLMAMDWKGSRAYRRARRKVWKIFKSDNEVAGYVRRVGKFHQV
FT                   IVRGGGHILPYDQPMRSFDMINRFIYDRGWEPYNS"
FT   gap             6106033..6106121
FT                   /estimated_length=89
FT   gap             6155415..6155434
FT                   /estimated_length=20
FT   gene            <6193897..6234278
FT                   /locus_tag="mCG_144842"
FT                   /note="gene_id=mCG144842.0"
FT   mRNA            join(<6193897..6194001,6211129..6211243,6225305..6225429,
FT                   6233104..6234278)
FT                   /locus_tag="mCG_144842"
FT                   /product="mCG144842"
FT                   /note="gene_id=mCG144842.0 transcript_id=mCT184266.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6225361..6225429,6233104..6233373)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144842"
FT                   /product="mCG144842"
FT                   /note="gene_id=mCG144842.0 transcript_id=mCT184266.0
FT                   protein_id=mCP105483.0"
FT                   /protein_id="EDK98696.1"
FT                   /translation="KQLQGARVRCLHRSAESRMLKIQCFQRFNQGEKNHSEYGCHHPIG
FT                   CGPGLNKAKKGESLGPMFTSLLPACKCCRCDQLRHLLLPLRHLLLPCLPTLDCDHPRPP
FT                   AKINVPSL"
FT   gap             6231984..6232003
FT                   /estimated_length=20
FT   gap             6243599..6243618
FT                   /estimated_length=20
FT   gene            6257028..6520853
FT                   /gene="Chn2"
FT                   /locus_tag="mCG_121671"
FT                   /note="gene_id=mCG121671.1"
FT   mRNA            join(6257028..6257570,6391578..6391616,6413411..6413466,
FT                   6435035..6435066,6437898..6438011,6439791..6440076,
FT                   6492385..6492462,6505383..6505467,6509321..6509494,
FT                   6512084..6512161,6514831..6514968,6517091..6517196,
FT                   6519119..6520853)
FT                   /gene="Chn2"
FT                   /locus_tag="mCG_121671"
FT                   /product="chimerin (chimaerin) 2"
FT                   /note="gene_id=mCG121671.1 transcript_id=mCT122882.1
FT                   created on 17-SEP-2002"
FT   CDS             join(6257522..6257570,6391578..6391616,6413411..6413466,
FT                   6435035..6435066,6437898..6438011,6439791..6440076,
FT                   6492385..6492462,6505383..6505467,6509321..6509494,
FT                   6512084..6512161,6514831..6514968,6517091..6517196,
FT                   6519119..6519290)
FT                   /codon_start=1
FT                   /gene="Chn2"
FT                   /locus_tag="mCG_121671"
FT                   /product="chimerin (chimaerin) 2"
FT                   /note="gene_id=mCG121671.1 transcript_id=mCT122882.1
FT                   protein_id=mCP62090.1"
FT                   /db_xref="GOA:Q3V2R3"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR017356"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="MGI:MGI:1917243"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V2R3"
FT                   /protein_id="EDK98697.1"
FT                   /translation="MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIIC
FT                   PREVENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLN
FT                   YRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTTNPIYEHIGYATLLR
FT                   EKVSRRLSRSKNESRKASVSNEEHTPVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTF
FT                   RGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTT
FT                   LVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISAN
FT                   IYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAH
FT                   YETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQ
FT                   ILIENEDVLF"
FT   gap             6272086..6272105
FT                   /estimated_length=20
FT   gap             6329505..6329693
FT                   /estimated_length=189
FT   gene            complement(6365597..6368883)
FT                   /locus_tag="mCG_146887"
FT                   /note="gene_id=mCG146887.0"
FT   mRNA            complement(join(6365597..6365972,6367465..6368183,
FT                   6368745..6368883))
FT                   /locus_tag="mCG_146887"
FT                   /product="mCG146887"
FT                   /note="gene_id=mCG146887.0 transcript_id=mCT187150.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6367885..6368151)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146887"
FT                   /product="mCG146887"
FT                   /note="gene_id=mCG146887.0 transcript_id=mCT187150.0
FT                   protein_id=mCP109101.0"
FT                   /protein_id="EDK98698.1"
FT                   /translation="MLLQGLYVSDFWPLRLHTERKRPSTHSPTPTSTLKSKNLQSNEPC
FT                   LKKEVVAEVGRRTVMQKIWLKLLHSEEDRESPLHEAIQTQGLF"
FT   gap             6386687..6387281
FT                   /estimated_length=595
FT   gap             6407634..6407653
FT                   /estimated_length=20
FT   gap             6425549..6425568
FT                   /estimated_length=20
FT   gene            complement(6467302..>6498390)
FT                   /locus_tag="mCG_144488"
FT                   /note="gene_id=mCG144488.0"
FT   mRNA            complement(join(6467302..6467575,6467985..6468144,
FT                   6468517..6468717,6473897..6474035,6498181..>6498390))
FT                   /locus_tag="mCG_144488"
FT                   /product="mCG144488"
FT                   /note="gene_id=mCG144488.0 transcript_id=mCT183912.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(6467398..6467575,6467985..6468144,
FT                   6468517..>6468523))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144488"
FT                   /product="mCG144488"
FT                   /note="gene_id=mCG144488.0 transcript_id=mCT183912.0
FT                   protein_id=mCP105479.0"
FT                   /protein_id="EDK98699.1"
FT                   /translation="NTGASSIPHMCISTLAYPLICGWIFKLLPPLGYCEHEHCEHLCGV
FT                   MASAPVFNSSGEWHHPLFWVFLNQSTIKTTPMNVPSGQPDPDSSSVVTLPQVLYAVSSC
FT                   QLKLTLLDLR"
FT   gap             6528246..6528265
FT                   /estimated_length=20
FT   gene            6546474..6549797
FT                   /gene="E130201N16Rik"
FT                   /locus_tag="mCG_121669"
FT                   /note="gene_id=mCG121669.1"
FT   mRNA            join(6546474..6546901,6548717..6549797)
FT                   /gene="E130201N16Rik"
FT                   /locus_tag="mCG_121669"
FT                   /product="RIKEN cDNA E130201N16"
FT                   /note="gene_id=mCG121669.1 transcript_id=mCT122880.1
FT                   created on 14-AUG-2002"
FT   CDS             6548857..6549225
FT                   /codon_start=1
FT                   /gene="E130201N16Rik"
FT                   /locus_tag="mCG_121669"
FT                   /product="RIKEN cDNA E130201N16"
FT                   /note="gene_id=mCG121669.1 transcript_id=mCT122880.1
FT                   protein_id=mCP62051.1"
FT                   /db_xref="GOA:A2RT92"
FT                   /db_xref="InterPro:IPR028237"
FT                   /db_xref="MGI:MGI:1925254"
FT                   /db_xref="UniProtKB/TrEMBL:A2RT92"
FT                   /protein_id="EDK98700.1"
FT                   /translation="MADSGGSSPWWKSLTRKKSKEVTVGVQPQVRPETGQEPSPPHSDR
FT                   TSSLPENQHSNILGDPGESLRSDKLCEEKTGNSRRNLKISRSGRFKEKRKMRATLLPEG
FT                   DKSPEEADFPDDPQEDKQ"
FT   gap             6554288..6554307
FT                   /estimated_length=20
FT   gap             6590128..6592425
FT                   /estimated_length=2298
FT   gap             6609177..6609738
FT                   /estimated_length=562
FT   gap             6612661..6613016
FT                   /estimated_length=356
FT   gene            complement(6641424..6646390)
FT                   /locus_tag="mCG_1036587"
FT                   /note="gene_id=mCG1036587.2"
FT   mRNA            complement(join(6641424..6642225,6646173..6646390))
FT                   /locus_tag="mCG_1036587"
FT                   /product="mCG1036587"
FT                   /note="gene_id=mCG1036587.2 transcript_id=mCT154291.2
FT                   created on 13-JUN-2003"
FT   CDS             complement(6641562..6641876)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1036587"
FT                   /product="mCG1036587"
FT                   /note="gene_id=mCG1036587.2 transcript_id=mCT154291.2
FT                   protein_id=mCP61852.1"
FT                   /db_xref="GOA:Q9D2Y3"
FT                   /db_xref="MGI:MGI:1918824"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D2Y3"
FT                   /protein_id="EDK98701.1"
FT                   /translation="MMSMRMGKKSWVFLWDIREVPTLVKRRGTGWAKSSMMIMMVRART
FT                   DRVGLTFPSSCGSSSPGSEHLPNMSTKDFCCSWMFFVPTVSWNGCMVLSVMRFKRHRAF
FT                   "
FT   gene            <6669763..6713323
FT                   /locus_tag="mCG_121667"
FT                   /note="gene_id=mCG121667.1"
FT   mRNA            join(<6669763..6669843,6698536..6698668,6700576..6700710,
FT                   6701949..6702134,6702155..6702700,6704676..6704798,
FT                   6705775..6705880,6713247..6713323)
FT                   /locus_tag="mCG_121667"
FT                   /product="mCG121667"
FT                   /note="gene_id=mCG121667.1 transcript_id=mCT122878.1
FT                   created on 17-SEP-2002"
FT   CDS             join(<6669763..6669843,6698536..6698668,6700576..6700710,
FT                   6701949..6702134,6702155..6702700,6704676..6704798,
FT                   6705775..6705880,6713247..6713277)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121667"
FT                   /product="mCG121667"
FT                   /note="gene_id=mCG121667.1 transcript_id=mCT122878.1
FT                   protein_id=mCP61453.1"
FT                   /protein_id="EDK98702.1"
FT                   /translation="PPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSLRKPDLKGRSA
FT                   LLADIQQGTRLRKVTQINDRSAPQIEGSKGTSKEGGAAGSNARGGNTPPALGDLFAGGF
FT                   PVLRPAGQRDVSGGKSGQGPGSRAPSPRLPIKAISGPLPAPASPRLGNASETHSSARPV
FT                   PPRPSVPAPPPPTSTPPPPPLPPASPIKAQLVSPPAPPTKVNPSVVPPPLPCAPPLPPP
FT                   PPTPPPLPPASALSDKAVRPQLAPLHLPPIPPPLPLLPPCGYPGLHSEPNSPAQEVREP
FT                   PVPPPPPPPPPPPPLPTYASCSSRTAVAPPPLPGANNSGSETPPPLPPKSPSFQTQKAL
FT                   PTPPGAPGPQAILQKKRRGPGTSGGKLNPPPAPPARSPTTELSSKSQQPGGQLRNGGQH
FT                   AIDDFESKFTFHSMEDFPPPDEYKPCQKIYPSKVPRSKPHTWFLAPS"
FT   gap             6673214..6673233
FT                   /estimated_length=20
FT   gene            complement(6680425..6689905)
FT                   /locus_tag="mCG_146889"
FT                   /note="gene_id=mCG146889.0"
FT   mRNA            complement(join(6680425..6682459,6689856..6689905))
FT                   /locus_tag="mCG_146889"
FT                   /product="mCG146889"
FT                   /note="gene_id=mCG146889.0 transcript_id=mCT187152.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6682111..6682341)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146889"
FT                   /product="mCG146889"
FT                   /note="gene_id=mCG146889.0 transcript_id=mCT187152.0
FT                   protein_id=mCP109103.0"
FT                   /protein_id="EDK98703.1"
FT                   /translation="MTSVIHTYCFCPSSTLGLSLGCRLVSLWALVTSKTQHFRRHLREL
FT                   GAMEEEVSSYCTAGEQGKLLCTCSEIIYNGC"
FT   gap             6702135..6702154
FT                   /estimated_length=20
FT   gene            complement(6725736..6783090)
FT                   /gene="Scrn1"
FT                   /locus_tag="mCG_121672"
FT                   /note="gene_id=mCG121672.1"
FT   mRNA            complement(join(6725736..6726124,6728811..6728991,
FT                   6737462..6737627,6739518..6739712,6742260..6742462,
FT                   6751146..6751327,6764921..6765080,6782918..6783090))
FT                   /gene="Scrn1"
FT                   /locus_tag="mCG_121672"
FT                   /product="secernin 1"
FT                   /note="gene_id=mCG121672.1 transcript_id=mCT122883.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(6725966..6726124,6728811..6728991,
FT                   6737462..6737627,6739518..6739712,6742260..6742462,
FT                   6751146..6751327,6764921..6765079))
FT                   /codon_start=1
FT                   /gene="Scrn1"
FT                   /locus_tag="mCG_121672"
FT                   /product="secernin 1"
FT                   /note="gene_id=mCG121672.1 transcript_id=mCT122883.1
FT                   protein_id=mCP62118.1"
FT                   /protein_id="EDK98704.1"
FT                   /translation="MSGAPPSYSFVALPPRAKDGLVVFGKNSARPRDEVQEVVYFPAVD
FT                   HDAESKVECTYISIDQVPRTHAIVISRPAWLWGAEMGANEHGVCIANEAINAREPAAET
FT                   EALLGMDLVRLGLERGTTAKEALDIIVSLLDEHGQGGNYYEDAHSCHSFQSAYLLVDRD
FT                   EAWVLETVGKYWAAERITEGVRCICNHLSLATKLDEEHPELRTYAQSQGWWTGDDEFNF
FT                   AQVFSPADDRLDCCAGQDSLEKQEESITVQTMINILRDKASGVCIDSESFLTTASIVSV
FT                   LPQNRSSPCIHYFTGTPDPSRSIFKPFIFVDDVKLVPKAQSPCFGDDDPAKKEPRFQEK
FT                   PDRRHELYKAHEWARAVIESDEEQGRTLRKTMLELEKQGLEAMDEILSSPEPPDPAEVG
FT                   DLFYDCVDTEMKFFK"
FT   gap             6749924..6749943
FT                   /estimated_length=20
FT   gene            complement(6768217..6771148)
FT                   /locus_tag="mCG_146885"
FT                   /note="gene_id=mCG146885.0"
FT   mRNA            complement(join(6768217..6769051,6770817..6771148))
FT                   /locus_tag="mCG_146885"
FT                   /product="mCG146885"
FT                   /note="gene_id=mCG146885.0 transcript_id=mCT187148.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6768531..6768818)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146885"
FT                   /product="mCG146885"
FT                   /note="gene_id=mCG146885.0 transcript_id=mCT187148.0
FT                   protein_id=mCP109099.0"
FT                   /protein_id="EDK98705.1"
FT                   /translation="MFQGEMILSFWWILPHRHDIHIGIKRLSIWNISFSTLSRASVARL
FT                   GSTTILLAFADVRGCVVVVVVCLSVCLFVYLFCLETGFDSLVLADLEFVM"
FT   gene            complement(6794276..6809842)
FT                   /gene="Fkbp14"
FT                   /locus_tag="mCG_121668"
FT                   /note="gene_id=mCG121668.1"
FT   mRNA            complement(join(6794276..6796356,6802468..6802595,
FT                   6805938..6806089,6809512..6809842))
FT                   /gene="Fkbp14"
FT                   /locus_tag="mCG_121668"
FT                   /product="FK506 binding protein 14, transcript variant
FT                   mCT122879"
FT                   /note="gene_id=mCG121668.1 transcript_id=mCT122879.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(6794277..6796356,6802468..6802595,
FT                   6803661..6803750,6805938..6806089,6809512..>6809817))
FT                   /gene="Fkbp14"
FT                   /locus_tag="mCG_121668"
FT                   /product="FK506 binding protein 14, transcript variant
FT                   mCT189079"
FT                   /note="gene_id=mCG121668.1 transcript_id=mCT189079.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6796198..6796356,6802468..6802595,
FT                   6805938..6806089,6809512..6809708))
FT                   /codon_start=1
FT                   /gene="Fkbp14"
FT                   /locus_tag="mCG_121668"
FT                   /product="FK506 binding protein 14, isoform CRA_a"
FT                   /note="gene_id=mCG121668.1 transcript_id=mCT122879.0
FT                   protein_id=mCP62045.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q542Q0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="MGI:MGI:2387639"
FT                   /db_xref="UniProtKB/TrEMBL:Q542Q0"
FT                   /protein_id="EDK98706.1"
FT                   /translation="MRFFLWNAILALWVTVLSGALIPEPEVKIEVLQKPFICHRKTKGG
FT                   DLMLVHYEGYLEKDGSLFHSTHKHNNGQPVWFTLGILEVLKGWDQGLKGMCVGEKRKLT
FT                   VPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWRLSKHEVKVY
FT                   LQKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYVHDEL"
FT   CDS             complement(join(6803743..6803750,6805938..6806089,
FT                   6809512..>6809738))
FT                   /codon_start=1
FT                   /gene="Fkbp14"
FT                   /locus_tag="mCG_121668"
FT                   /product="FK506 binding protein 14, isoform CRA_b"
FT                   /note="gene_id=mCG121668.1 transcript_id=mCT189079.0
FT                   protein_id=mCP110058.0 isoform=CRA_b"
FT                   /protein_id="EDK98707.1"
FT                   /translation="SRGPFLCFGNMRFFLWNAILALWVTVLSGALIPEPEVKIEVLQKP
FT                   FICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPVWFTLGILEVLKGWDQGLKG
FT                   MCVGEKRKLTVPPALGYGKEGKVF"
FT   gap             6810304..6810323
FT                   /estimated_length=20
FT   gene            <6812092..6857961
FT                   /gene="Plekha8"
FT                   /locus_tag="mCG_121670"
FT                   /note="gene_id=mCG121670.1"
FT   mRNA            join(<6812092..6812131,6829749..6829865,6831866..6832021,
FT                   6833284..6833408,6835857..6836015,6836935..6836975,
FT                   6838783..6838940,6840737..6840893,6841215..6841300,
FT                   6845508..6845566,6846482..6846612,6847166..6847236,
FT                   6852372..6852433,6857446..6857961)
FT                   /gene="Plekha8"
FT                   /locus_tag="mCG_121670"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 8, transcript
FT                   variant mCT122881"
FT                   /note="gene_id=mCG121670.1 transcript_id=mCT122881.1
FT                   created on 05-AUG-2002"
FT   CDS             join(6812092..6812131,6829749..6829865,6831866..6832021,
FT                   6833284..6833408,6835857..6836015,6836935..6836975,
FT                   6838783..6838940,6840737..6840893,6841215..6841300,
FT                   6845508..6845566,6846482..6846612,6847166..6847236,
FT                   6852372..6852433,6857446..6857643)
FT                   /codon_start=1
FT                   /gene="Plekha8"
FT                   /locus_tag="mCG_121670"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 8, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG121670.1 transcript_id=mCT122881.1
FT                   protein_id=mCP62067.1 isoform=CRA_b"
FT                   /protein_id="EDK98709.1"
FT                   /translation="MEGVLYKWTNYLSGWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQ
FT                   MAVCEIQVHSVDNTRMDLIIPGEQYFYLKARSVAERQRWLVALGSAKACLTDSRTQKEK
FT                   EFAENTENLKTKMSELRLYCDLLVQQVDKTKEVATAGVTDSEEGIDVGTLLKSTCNTFL
FT                   KTLEECMQIANAAFTSELLYHTPPGSPQLAVLKSSKMKHPIIPIHNSLERSMELNSCEN
FT                   GSLSIEVNGDEEILMKTKSSLYLKSTEVDCSISSEENTDDNVTVQGEIMKEDGEENLES
FT                   HDKDPAQPGSDSVCSPESPWEDNEEVIPTFFSTMNTSFSDIELLEDSGIPTEAFLASCY
FT                   AVVPVLDKLGPTVFAPVKMDLVGNIKKVNQKYITNKEEFTTLQKIVLHEVEADVAQVRN
FT                   SATEALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGVFALALR
FT                   AAPSYEDFVAALTIKEGDHQKEAFSAGMQRDLSLYLPAMEKQLAILDTLYEIHGLESDE
FT                   VV"
FT   mRNA            join(<6819806..6820071,6829749..6829865,6831866..6832021,
FT                   6833284..6833408,6835857..6836015,6836935..6836975,
FT                   6838783..6838940,6840737..6840893,6841215..6841300,
FT                   6845508..6845566,6846482..6846612,6847166..6847236,
FT                   6852372..6852433,6857446..6857695)
FT                   /gene="Plekha8"
FT                   /locus_tag="mCG_121670"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 8, transcript
FT                   variant mCT189066"
FT                   /note="gene_id=mCG121670.1 transcript_id=mCT189066.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<6820023..6820071,6829749..6829865,6831866..6832021,
FT                   6833284..6833408,6835857..6836015,6836935..6836975,
FT                   6838783..6838940,6840737..6840893,6841215..6841300,
FT                   6845508..6845566,6846482..6846612,6847166..6847236,
FT                   6852372..6852433,6857446..6857643)
FT                   /codon_start=1
FT                   /gene="Plekha8"
FT                   /locus_tag="mCG_121670"
FT                   /product="pleckstrin homology domain containing, family A
FT                   (phosphoinositide binding specific) member 8, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121670.1 transcript_id=mCT189066.0
FT                   protein_id=mCP110059.0 isoform=CRA_a"
FT                   /protein_id="EDK98708.1"
FT                   /translation="YVINTYILWLPSVHRRGWQPRWFLLCGGILSYYDSPEDAWKGCKG
FT                   SIQMAVCEIQVHSVDNTRMDLIIPGEQYFYLKARSVAERQRWLVALGSAKACLTDSRTQ
FT                   KEKEFAENTENLKTKMSELRLYCDLLVQQVDKTKEVATAGVTDSEEGIDVGTLLKSTCN
FT                   TFLKTLEECMQIANAAFTSELLYHTPPGSPQLAVLKSSKMKHPIIPIHNSLERSMELNS
FT                   CENGSLSIEVNGDEEILMKTKSSLYLKSTEVDCSISSEENTDDNVTVQGEIMKEDGEEN
FT                   LESHDKDPAQPGSDSVCSPESPWEDNEEVIPTFFSTMNTSFSDIELLEDSGIPTEAFLA
FT                   SCYAVVPVLDKLGPTVFAPVKMDLVGNIKKVNQKYITNKEEFTTLQKIVLHEVEADVAQ
FT                   VRNSATEALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGVFAL
FT                   ALRAAPSYEDFVAALTIKEGDHQKEAFSAGMQRDLSLYLPAMEKQLAILDTLYEIHGLE
FT                   SDEVV"
FT   gap             6876014..6876033
FT                   /estimated_length=20
FT   gap             6879310..6879415
FT                   /estimated_length=106
FT   gap             6883880..6884158
FT                   /estimated_length=279
FT   gap             6888131..6888150
FT                   /estimated_length=20
FT   gap             6892172..6892191
FT                   /estimated_length=20
FT   gene            6898482..6915988
FT                   /gene="2410066E13Rik"
FT                   /locus_tag="mCG_121666"
FT                   /note="gene_id=mCG121666.1"
FT   mRNA            join(6898482..6898670,6905746..6905868,6915711..6915988)
FT                   /gene="2410066E13Rik"
FT                   /locus_tag="mCG_121666"
FT                   /product="RIKEN cDNA 2410066E13"
FT                   /note="gene_id=mCG121666.1 transcript_id=mCT122877.0
FT                   created on 05-AUG-2002"
FT   CDS             join(6898531..6898670,6905746..6905868,6915711..6915852)
FT                   /codon_start=1
FT                   /gene="2410066E13Rik"
FT                   /locus_tag="mCG_121666"
FT                   /product="RIKEN cDNA 2410066E13"
FT                   /note="gene_id=mCG121666.1 transcript_id=mCT122877.0
FT                   protein_id=mCP61426.1"
FT                   /db_xref="GOA:Q9CR65"
FT                   /db_xref="MGI:MGI:1915485"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CR65"
FT                   /protein_id="EDK98710.1"
FT                   /translation="MSRRSGVPARPLSSSPPRRRSAGWTSTPTRASPSTYCVRTTAAAT
FT                   AFTCGARARTACPSCSWPKITSLPAARRPSMKSWKKSSNPSDLCWGFQTQMTTRLKSTV
FT                   RMWRRRSQRRTTRKWGSVSSKLLGHLAEGE"
FT   gap             6935877..6937017
FT                   /estimated_length=1141
FT   gap             6977108..6977127
FT                   /estimated_length=20
FT   gap             6978522..6979178
FT                   /estimated_length=657
FT   gap             6980995..6981175
FT                   /estimated_length=181
FT   gap             6985642..6985661
FT                   /estimated_length=20
FT   gap             7018590..7018609
FT                   /estimated_length=20
FT   gap             7037959..7037978
FT                   /estimated_length=20
FT   gene            <7038209..7114898
FT                   /gene="Znrf2"
FT                   /locus_tag="mCG_121593"
FT                   /note="gene_id=mCG121593.1"
FT   mRNA            join(<7038209..7038876,7085305..7085400,7099748..7099853,
FT                   7106164..7106245,7109855..7114898)
FT                   /gene="Znrf2"
FT                   /locus_tag="mCG_121593"
FT                   /product="zinc and ring finger 2, transcript variant
FT                   mCT122799"
FT                   /note="gene_id=mCG121593.1 transcript_id=mCT122799.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(<7038210..7038876,7064077..7064101,7085305..7085400,
FT                   7099748..7099853,7106164..7106245,7109855..7114898)
FT                   /gene="Znrf2"
FT                   /locus_tag="mCG_121593"
FT                   /product="zinc and ring finger 2, transcript variant
FT                   mCT171658"
FT                   /note="gene_id=mCG121593.1 transcript_id=mCT171658.0
FT                   created on 05-AUG-2002"
FT   CDS             join(<7038210..7038876,7085305..7085400,7099748..7099853,
FT                   7106164..7106221)
FT                   /codon_start=1
FT                   /gene="Znrf2"
FT                   /locus_tag="mCG_121593"
FT                   /product="zinc and ring finger 2, isoform CRA_b"
FT                   /note="gene_id=mCG121593.1 transcript_id=mCT122799.1
FT                   protein_id=mCP60912.1 isoform=CRA_b"
FT                   /protein_id="EDK98712.1"
FT                   /translation="GEPEDGGGDSGRPGGGGAEAAKRGSKRQRPVAAARQRPRPHGYLS
FT                   GSRELRPASLACSLARSLAARGGADMGAKQSGPAANGRTRAYSGSDLPSGTGSGGGGAD
FT                   GARAARFAAPVSGAQQPSASAGAAAAAAAAASAPAAPRSRSLGGAVGSASGGRAAQSAF
FT                   SIPSAGGGGGPYGSQDSVHSSPEDSVGARDRDRPAGGGPGGPRLVIGSLPAHLSPHLFG
FT                   GFKCPVCSKFVPSDEMDLHLVMCLTKPRITYNEDVLSKDTGECAICLEELQQGDTIARL
FT                   PCLCIYHKGCIDEWFEVNRSCPEHPSD"
FT   CDS             join(<7038210..7038876,7064077..7064099)
FT                   /codon_start=1
FT                   /gene="Znrf2"
FT                   /locus_tag="mCG_121593"
FT                   /product="zinc and ring finger 2, isoform CRA_a"
FT                   /note="gene_id=mCG121593.1 transcript_id=mCT171658.0
FT                   protein_id=mCP94577.0 isoform=CRA_a"
FT                   /protein_id="EDK98711.1"
FT                   /translation="GEPEDGGGDSGRPGGGGAEAAKRGSKRQRPVAAARQRPRPHGYLS
FT                   GSRELRPASLACSLARSLAARGGADMGAKQSGPAANGRTRAYSGSDLPSGTGSGGGGAD
FT                   GARAARFAAPVSGAQQPSASAGAAAAAAAAASAPAAPRSRSLGGAVGSASGGRAAQSAF
FT                   SIPSAGGGGGPYGSQDSVHSSPEDSVGARDRDRPAGGGPGGPRLVIGSLPAHLSPHLFG
FT                   VLLEPVV"
FT   gene            complement(7145337..7171147)
FT                   /gene="Card4"
FT                   /locus_tag="mCG_121592"
FT                   /note="gene_id=mCG121592.1"
FT   mRNA            complement(join(7145337..7146397,7149423..7149506,
FT                   7151566..7151649,7154950..7155033,7155785..7155868,
FT                   7158744..7158827,7159528..7159611,7160694..7160777,
FT                   7164521..7166345,7169335..7169509,7170818..7171147))
FT                   /gene="Card4"
FT                   /locus_tag="mCG_121592"
FT                   /product="caspase recruitment domain 4"
FT                   /note="gene_id=mCG121592.1 transcript_id=mCT122797.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(7146325..7146397,7149423..7149506,
FT                   7151566..7151649,7154950..7155033,7155785..7155868,
FT                   7158744..7158827,7159528..7159611,7160694..7160777,
FT                   7164521..7166345,7169335..7169509,7170818..7171018))
FT                   /codon_start=1
FT                   /gene="Card4"
FT                   /locus_tag="mCG_121592"
FT                   /product="caspase recruitment domain 4"
FT                   /note="gene_id=mCG121592.1 transcript_id=mCT122797.0
FT                   protein_id=mCP60860.1"
FT                   /db_xref="GOA:Q540J8"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="MGI:MGI:1341839"
FT                   /db_xref="UniProtKB/TrEMBL:Q540J8"
FT                   /protein_id="EDK98713.1"
FT                   /translation="MEEHGHHEMEGTPLGCHSHIKLLKINREHLVTNIRNTQCLVDNLL
FT                   ENGYFSAEDAEIVCACPTKPDKVRKILDLVQSKGEEVSEFFLYVLQQLEDAYVDLRLWL
FT                   SEIGFSPSQLIRTKTIVNTDPVSRYTQQLRHQLGRDSKFMLCYAQKEDLLLEETYMDTL
FT                   MELVGFNNENLGSLGGLDCLLDHSTGVLNEHGETVFVFGDAGVGKSMLLQRLQSLWASG
FT                   RLTSTAKFFFHFRCRMFSCFKESDMLSLQDLLFKHFCYPEQDPEEVFSFLLRFPHTALF
FT                   TFDGLDELHSDFDLSRVPDSCCPWEPAHPLVLLANLLSGRLLKGAGKLLTARTGVEVPR
FT                   QLLRKKVLLRGFSPSHLRAYARRMFPERTAQEHLLQQLDANPNLCSLCGVPLFCWIIFR
FT                   CFQHFQTVFEGSSSQLPDCAVTLTDVFLLVTEVHLNRPQPSSLVQRNTRSPAETLRAGW
FT                   RTLHALGEVAHRGTDKSLFVFGQEEVQASKLQEGDLQLGFLRALPDVGPEQGQSYEFFH
FT                   LTLQAFFTAFFLVADDKVSTRELLRFFREWTSPGEATSSSCHSSFFSFQCLGGRSRLGP
FT                   DPFRNKDHFQFTNLFLCGLLAKARQKLLRQLVPKAILRRKRKALWAHLFASLRSYLKSL
FT                   PRVQSGGFNQVHAMPTFLWMLRCIYETQSQKVGRLAARGISADYLKLAFCNACSADCSA
FT                   LSFVLHHFHRQLALDLDNNNLNDYGVQELQPCFSRLTVIRLSVNQITDTGVKVLCEELT
FT                   KYKIVTFLGLYNNQITDIGARYVAQILDECRGLKHLKLGKNRITSEGGKCVALAVKNST
FT                   SIVDVGMWGNQIGDEGAKAFAEALKDHPSLTTLSLAFNGISPEGGKSLAQALKQNTTLT
FT                   VIWLTKNELNDESAECFAEMLRVNQTLRHLWLIQNRITAKGTAQLARALQKNTAITEIC
FT                   LNGNLIKPEEAKVFENEKRIICF"
FT   gap             7177000..7177019
FT                   /estimated_length=20
FT   gap             7179362..7184362
FT                   /estimated_length=5001
FT   gap             7186152..7186259
FT                   /estimated_length=108
FT   gap             7187728..7188251
FT                   /estimated_length=524
FT   gap             7194003..7194032
FT                   /estimated_length=30
FT   gap             7202417..7204255
FT                   /estimated_length=1839
FT   gap             7205680..7205699
FT                   /estimated_length=20
FT   gene            complement(7212697..7220770)
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /note="gene_id=mCG121595.1"
FT   mRNA            complement(join(7212697..7213861,7214693..7214828,
FT                   7217331..7217388,7220516..7220770))
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /product="RIKEN cDNA A030007L17, transcript variant
FT                   mCT171640"
FT                   /note="gene_id=mCG121595.1 transcript_id=mCT171640.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(7212697..7213861,7214693..7214828,
FT                   7217243..7217388,7220516..7220770))
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /product="RIKEN cDNA A030007L17, transcript variant
FT                   mCT122801"
FT                   /note="gene_id=mCG121595.1 transcript_id=mCT122801.1
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(7212697..7213861,7214693..7214828,
FT                   7217331..7217388,7220391..7220528))
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /product="RIKEN cDNA A030007L17, transcript variant
FT                   mCT171639"
FT                   /note="gene_id=mCG121595.1 transcript_id=mCT171639.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(7213718..7213861,7214693..7214828,
FT                   7217243..7217388,7220516..7220656))
FT                   /codon_start=1
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /product="RIKEN cDNA A030007L17, isoform CRA_d"
FT                   /note="gene_id=mCG121595.1 transcript_id=mCT122801.1
FT                   protein_id=mCP60988.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9D7X8"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="MGI:MGI:95700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D7X8"
FT                   /protein_id="EDK98717.1"
FT                   /translation="MASSDCEGHAGQEGETFLYFAYGSNLLTERIHLRNPSAVFCCVAC
FT                   LQDFKLDFGNFQGKMSERWHGGIATIFQSPGDEVWGVVWRMNKSNISSLDEQEGVKSGV
FT                   YVVIEIKVSTREGKEITCRSYLMTNYESAPPSPQYKKVICMGAKENGLPQEYQEKLKAI
FT                   EPNEYKGKISDEMEDIIKKGESKLS"
FT   CDS             complement(join(7213718..7213861,7214693..7214737))
FT                   /codon_start=1
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /product="RIKEN cDNA A030007L17, isoform CRA_a"
FT                   /note="gene_id=mCG121595.1 transcript_id=mCT171639.0
FT                   protein_id=mCP94559.0 isoform=CRA_a"
FT                   /protein_id="EDK98714.1"
FT                   /translation="MTNYESAPPSPQYKKVICMGAKENGLPQEYQEKLKAIEPNEYKGK
FT                   ISDEMEDIIKKGESKLS"
FT   mRNA            complement(join(7214375..7214828,7220516..7220770))
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /product="RIKEN cDNA A030007L17, transcript variant
FT                   mCT171641"
FT                   /note="gene_id=mCG121595.1 transcript_id=mCT171641.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(7214794..7214828,7217331..7217388,
FT                   7220516..7220656))
FT                   /codon_start=1
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /product="RIKEN cDNA A030007L17, isoform CRA_b"
FT                   /note="gene_id=mCG121595.1 transcript_id=mCT171640.0
FT                   protein_id=mCP94558.0 isoform=CRA_b"
FT                   /protein_id="EDK98715.1"
FT                   /translation="MASSDCEGHAGQEGETFLYFAYGSNLLTERIHLRNPSAVFCCVAC
FT                   LQDFKLDFGNFQGKMSERWHGGKKELKVESML"
FT   CDS             complement(join(7214814..7214828,7220516..7220656))
FT                   /codon_start=1
FT                   /gene="A030007L17Rik"
FT                   /locus_tag="mCG_121595"
FT                   /product="RIKEN cDNA A030007L17, isoform CRA_c"
FT                   /note="gene_id=mCG121595.1 transcript_id=mCT171641.0
FT                   protein_id=mCP94560.0 isoform=CRA_c"
FT                   /protein_id="EDK98716.1"
FT                   /translation="MASSDCEGHAGQEGETFLYFAYGSNLLTERIHLRNPSAVFCCVAC
FT                   LQARRS"
FT   gap             7237308..7238353
FT                   /estimated_length=1046
FT   gap             7250302..7250725
FT                   /estimated_length=424
FT   gap             7253163..7253182
FT                   /estimated_length=20
FT   gene            7261486..7302578
FT                   /gene="Gars"
FT                   /locus_tag="mCG_121597"
FT                   /note="gene_id=mCG121597.1"
FT   mRNA            join(7261486..7261752,7269953..7270054,7271576..7271678,
FT                   7273912..7274053,7275768..7275856,7276721..7276797,
FT                   7279344..7279489,7284309..7284458,7286490..7286652,
FT                   7288848..7289012,7291460..7291569,7292742..7292885,
FT                   7296416..7296501,7298457..7298566,7300031..7300124,
FT                   7300659..7300849,7302296..7302578)
FT                   /gene="Gars"
FT                   /locus_tag="mCG_121597"
FT                   /product="glycyl-tRNA synthetase, transcript variant
FT                   mCT122804"
FT                   /note="gene_id=mCG121597.1 transcript_id=mCT122804.1
FT                   created on 05-AUG-2002"
FT   mRNA            join(<7261525..7261752,7269953..7270054,7271576..7271678,
FT                   7273912..7274053,7275768..7275856,7276721..7276797,
FT                   7279344..7279489,7284309..7284458,7286490..7286652,
FT                   7288848..7289012,7291460..7291567,7292740..7292885,
FT                   7296416..7296501,7298457..7298566,7300031..7300124,
FT                   7300659..7300849,7302296..7302472)
FT                   /gene="Gars"
FT                   /locus_tag="mCG_121597"
FT                   /product="glycyl-tRNA synthetase, transcript variant
FT                   mCT189084"
FT                   /note="gene_id=mCG121597.1 transcript_id=mCT189084.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<7261525..7261752,7269953..7270054,7271576..7271678,
FT                   7273912..7274053,7275768..7275856,7276721..7276797,
FT                   7279344..7279489,7284309..7284458,7286490..7286652,
FT                   7288848..7289012,7291460..7291567,7292740..7292885,
FT                   7296416..7296501,7298457..7298566,7300031..7300124,
FT                   7300659..7300849,7302296..7302421)
FT                   /codon_start=1
FT                   /gene="Gars"
FT                   /locus_tag="mCG_121597"
FT                   /product="glycyl-tRNA synthetase, isoform CRA_b"
FT                   /note="gene_id=mCG121597.1 transcript_id=mCT189084.0
FT                   protein_id=mCP110057.0 isoform=CRA_b"
FT                   /protein_id="EDK98719.1"
FT                   /translation="RSRPAHRLGGVLMPCLLPSLLRATRAALPLLSPPRVVAASASQRL
FT                   LSAPAQPAASRSSMDSAEELLAPLRLAVRQQGDFVRKLKEDKAPQVDVDRAVAELKARK
FT                   RVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNI
FT                   IQAWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKA
FT                   HLQKLMSDKKCSAEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPTTGNDLSPPVPFN
FT                   LMFQTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRS
FT                   GLIRVREFTMAEIEHFVDPTEKDHPKFQSVADLCLYLYSAKAQVTGQSARKMRLGDAVE
FT                   QGVINNSVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWI
FT                   EIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLV
FT                   LEYLSACDECYISEMELLLSEKGEFTIETEGKTFQLTKDMVSVKRFQKTLHVEEVVPSV
FT                   IEPSFGLGRIMYTILEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKE
FT                   LSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSM
FT                   RQIRAEVSELPSVVRDLANGNITWADVEARYPLFEGQETGKKETVEE"
FT   CDS             join(7261561..7261752,7269953..7270054,7271576..7271678,
FT                   7273912..7274053,7275768..7275856,7276721..7276797,
FT                   7279344..7279489,7284309..7284458,7286490..7286652,
FT                   7288848..7289012,7291460..7291569,7292742..7292885,
FT                   7296416..7296501,7298457..7298566,7300031..7300124,
FT                   7300659..7300849,7302296..7302421)
FT                   /codon_start=1
FT                   /gene="Gars"
FT                   /locus_tag="mCG_121597"
FT                   /product="glycyl-tRNA synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG121597.1 transcript_id=mCT122804.1
FT                   protein_id=mCP61710.1 isoform=CRA_a"
FT                   /protein_id="EDK98718.1"
FT                   /translation="MPCLLPSLLRATRAALPLLSPPRVVAASASQRLLSAPAQPAASRS
FT                   SMDSAEELLAPLRLAVRQQGDFVRKLKEDKAPQVDVDRAVAELKARKRVLEAKELALQP
FT                   KDDIVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEE
FT                   QILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCS
FT                   AEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPTTGNDLSPPVPFNLMFQTFIGPGGN
FT                   MPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAE
FT                   IEHFVDPTEKDHPKFQSVADLCLYLYSAKAQVTGQSARKMRLGDAVEQGVINNSVLGYF
FT                   IGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYD
FT                   LSCHARATKVPLVAEKPLKEPITVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYI
FT                   SEMELLLSEKGEFTIETEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMY
FT                   TILEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSH
FT                   KVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPS
FT                   VVRDLANGNITWADVEARYPLFEGQETGKKETVEE"
FT   gap             7273132..7273241
FT                   /estimated_length=110
FT   gene            complement(7313155..>7356090)
FT                   /gene="Crhr2"
FT                   /locus_tag="mCG_121588"
FT                   /note="gene_id=mCG121588.2"
FT   mRNA            complement(join(7313155..7314495,7315584..7315625,
FT                   7316023..7316158,7316350..7316435,7322284..7322356,
FT                   7323135..7323195,7323694..7323847,7325830..7325947,
FT                   7326247..7326353,7327803..7327888,7340493..7340618,
FT                   7346734..7346824,7355843..7356087))
FT                   /gene="Crhr2"
FT                   /locus_tag="mCG_121588"
FT                   /product="corticotropin releasing hormone receptor 2,
FT                   transcript variant mCT122793"
FT                   /note="gene_id=mCG121588.2 transcript_id=mCT122793.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(7314355..7314495,7315584..7315625,
FT                   7316023..7316158,7316350..7316435,7322284..7322356,
FT                   7323135..7323195,7323694..7323847,7325830..7325947,
FT                   7326247..7326353,7327803..7327888,7340493..7340618,
FT                   7346734..7346824,7355843..7355914))
FT                   /codon_start=1
FT                   /gene="Crhr2"
FT                   /locus_tag="mCG_121588"
FT                   /product="corticotropin releasing hormone receptor 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG121588.2 transcript_id=mCT122793.1
FT                   protein_id=mCP60791.1 isoform=CRA_a"
FT                   /protein_id="EDK98720.1"
FT                   /translation="MGTPGSLPSAQLLLCLFSLLPVLQVAQPGQAPQDQPLWTLLEQYC
FT                   HRTTIGNFSGPYTYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECL
FT                   ENGTWASRVNYSHCEPILDDKRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSI
FT                   RCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMF
FT                   VEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGD
FT                   LVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGI
FT                   TYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQDH
FT                   HALRVPVARAMSIPTSPTRISFHSIKQTAAV"
FT   mRNA            complement(join(7321699..7323847,7325830..7325947,
FT                   7326247..7326353,7327803..7327888,7340493..7340618,
FT                   7346734..7346824,7355843..>7356090))
FT                   /gene="Crhr2"
FT                   /locus_tag="mCG_121588"
FT                   /product="corticotropin releasing hormone receptor 2,
FT                   transcript variant mCT189080"
FT                   /note="gene_id=mCG121588.2 transcript_id=mCT189080.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(7323614..7323847,7325830..7325947,
FT                   7326247..7326353,7327803..7327888,7340493..7340618,
FT                   7346734..7346824,7355843..>7356010))
FT                   /codon_start=1
FT                   /gene="Crhr2"
FT                   /locus_tag="mCG_121588"
FT                   /product="corticotropin releasing hormone receptor 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG121588.2 transcript_id=mCT189080.0
FT                   protein_id=mCP110056.0 isoform=CRA_b"
FT                   /protein_id="EDK98721.1"
FT                   /translation="DRPKREAGQTSFGSSHFWSPSLERSSGRICCPMGTPGSLPSAQLL
FT                   LCLFSLLPVLQVAQPGQAPQDQPLWTLLEQYCHRTTIGNFSGPYTYCNTTLDQIGTCWP
FT                   QSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKRKYDLH
FT                   YRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQL
FT                   IDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFI
FT                   GWCEDLWPGGPPGRGALLIKSMLSPTSS"
FT   gap             7359906..7359944
FT                   /estimated_length=39
FT   gap             7385730..7385749
FT                   /estimated_length=20
FT   gene            complement(7394387..7398950)
FT                   /gene="Inmt"
FT                   /locus_tag="mCG_121591"
FT                   /note="gene_id=mCG121591.1"
FT   mRNA            complement(join(7394387..7394667,7394989..7395037,
FT                   7397076..7397283,7398739..7398950))
FT                   /gene="Inmt"
FT                   /locus_tag="mCG_121591"
FT                   /product="indolethylamine N-methyltransferase, transcript
FT                   variant mCT171656"
FT                   /note="gene_id=mCG121591.1 transcript_id=mCT171656.0
FT                   created on 06-AUG-2002"
FT   mRNA            complement(join(7394387..7395037,7397076..7397283,
FT                   7398739..7398950))
FT                   /gene="Inmt"
FT                   /locus_tag="mCG_121591"
FT                   /product="indolethylamine N-methyltransferase, transcript
FT                   variant mCT122796"
FT                   /note="gene_id=mCG121591.1 transcript_id=mCT122796.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(7394608..7394667,7394989..7395037,
FT                   7397076..7397283,7398739..7398895))
FT                   /codon_start=1
FT                   /gene="Inmt"
FT                   /locus_tag="mCG_121591"
FT                   /product="indolethylamine N-methyltransferase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121591.1 transcript_id=mCT171656.0
FT                   protein_id=mCP94575.0 isoform=CRA_a"
FT                   /protein_id="EDK98722.1"
FT                   /translation="MEGKVYIGGEDYEKEFTPKDYLTTYYSFHSGPVAEQEIVKFSLQN
FT                   LYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIVTDYTPQNLQELQKWLKKEPG
FT                   AYDWSSIVQHACELEGDRSRWQEKEAKLRRTVTRAYCSHDGLCFVVARKGPSA"
FT   CDS             complement(join(7394608..7395037,7397076..7397283,
FT                   7398739..7398895))
FT                   /codon_start=1
FT                   /gene="Inmt"
FT                   /locus_tag="mCG_121591"
FT                   /product="indolethylamine N-methyltransferase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG121591.1 transcript_id=mCT122796.1
FT                   protein_id=mCP60840.1 isoform=CRA_b"
FT                   /protein_id="EDK98723.1"
FT                   /translation="MEGKVYIGGEDYEKEFTPKDYLTTYYSFHSGPVAEQEIVKFSLQN
FT                   LYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIVTDYTPQNLQELQKWLKKEPG
FT                   AYDWSSIVQHACELEGDRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLT
FT                   FLAMECACPDIDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKEVV
FT                   EKAIQDAGCQVLKCNCVSLSYSEAYCSHDGLCFVVARKGPSA"
FT   mRNA            complement(join(7396784..7397283,7398739..7398950))
FT                   /gene="Inmt"
FT                   /locus_tag="mCG_121591"
FT                   /product="indolethylamine N-methyltransferase, transcript
FT                   variant mCT171657"
FT                   /note="gene_id=mCG121591.1 transcript_id=mCT171657.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(7396949..7397283,7398739..7398895))
FT                   /codon_start=1
FT                   /gene="Inmt"
FT                   /locus_tag="mCG_121591"
FT                   /product="indolethylamine N-methyltransferase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG121591.1 transcript_id=mCT171657.0
FT                   protein_id=mCP94576.0 isoform=CRA_c"
FT                   /protein_id="EDK98724.1"
FT                   /translation="MEGKVYIGGEDYEKEFTPKDYLTTYYSFHSGPVAEQEIVKFSLQN
FT                   LYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIVTDYTPQNLQELQKWLKKEPG
FT                   AYDWSSIVQHACELEGDRYLQVVPFCPPTSSFSDKAPLWLRQLRDSPLTSLSSWLSLTS
FT                   "
FT   gap             7397809..7398138
FT                   /estimated_length=330
FT   gene            <7427318..7540342
FT                   /gene="C330043M08Rik"
FT                   /locus_tag="mCG_140818"
FT                   /note="gene_id=mCG140818.0"
FT   mRNA            join(7427318..7427414,7435446..7435565,7440555..7440733,
FT                   7442532..7442778,7448293..7448663,7476690..7476745,
FT                   7481629..7481735,7484869..7484957,7519394..7519457,
FT                   7522633..7522794,7529833..7530013,7530940..7531012,
FT                   7539936..7540342)
FT                   /gene="C330043M08Rik"
FT                   /locus_tag="mCG_140818"
FT                   /product="RIKEN cDNA C330043M08, transcript variant
FT                   mCT171654"
FT                   /note="gene_id=mCG140818.0 transcript_id=mCT171654.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(<7427318..7427414,7435446..7435565,7440555..7440733,
FT                   7476690..7476745,7481629..7481735,7484869..7484957,
FT                   7519394..7519457,7522633..7522794,7529833..7530013,
FT                   7530940..7531012,7539936..7540339)
FT                   /gene="C330043M08Rik"
FT                   /locus_tag="mCG_140818"
FT                   /product="RIKEN cDNA C330043M08, transcript variant
FT                   mCT171655"
FT                   /note="gene_id=mCG140818.0 transcript_id=mCT171655.0
FT                   created on 17-SEP-2002"
FT   CDS             join(<7427319..7427414,7435446..7435565,7440555..7440733,
FT                   7476690..7476745,7481629..7481735,7484869..7484957,
FT                   7519394..7519457,7522633..7522794,7529833..7530013,
FT                   7530940..7531012,7539936..7539984)
FT                   /codon_start=1
FT                   /gene="C330043M08Rik"
FT                   /locus_tag="mCG_140818"
FT                   /product="RIKEN cDNA C330043M08, isoform CRA_a"
FT                   /note="gene_id=mCG140818.0 transcript_id=mCT171655.0
FT                   protein_id=mCP94574.0 isoform=CRA_a"
FT                   /protein_id="EDK98725.1"
FT                   /translation="GPRGLVGSASSMDSLYVEEVAASLVREFLSRKGLNKTFVTMDQER
FT                   PRCELSINSRNDLRKVLHLEFLYKENKAKEKPLRTNLELITRYFLDNVGNTDNSESQEV
FT                   PIPAIPVPKKNNKLPLRHSETTLVNIYEKNQLVSDRTDDKPDALQLEDVEDELIKEDIV
FT                   LFPPPSMLKLQTVSKPIDLSLAKGGPCGVLAAVQGCVLQKLLFEGDNRTNSNLVRQDFD
FT                   VPTSHLIGAHGYCTQELVNLLLTGRAVSNVFNDVVELDSGDGNITLLRGIEARSDIGFL
FT                   SLFEHYNVCQVGCFLKTPRFPIWVVCSESHFSILFSLQPELLCDWRSERLFDLYYYDGL
FT                   ANQQEEIRLTVDTTKTAPADSCSDLVPPLELCIRTKWKGASVNWNGSDPIL"
FT   CDS             join(7427352..7427414,7435446..7435565,7440555..7440733,
FT                   7442532..7442778,7448293..7448663,7476690..7476745,
FT                   7481629..7481735,7484869..7484957,7519394..7519457,
FT                   7522633..7522794,7529833..7530013,7530940..7531012,
FT                   7539936..7539984)
FT                   /codon_start=1
FT                   /gene="C330043M08Rik"
FT                   /locus_tag="mCG_140818"
FT                   /product="RIKEN cDNA C330043M08, isoform CRA_b"
FT                   /note="gene_id=mCG140818.0 transcript_id=mCT171654.0
FT                   protein_id=mCP94573.0 isoform=CRA_b"
FT                   /protein_id="EDK98726.1"
FT                   /translation="MDSLYVEEVAASLVREFLSRKGLNKTFVTMDQERPRCELSINSRN
FT                   DLRKVLHLEFLYKENKAKEKPLRTNLELITRYFLDNVGNTDNSESQEVPIPAIPVPKKN
FT                   NKLPLRHSETTLVNIYEHDSLDGDILGNFVSSKKPSHKSKAAHVDLGDSLPLVPAWEKV
FT                   DQLHSSEPGIDVKKTMERTRPKSGLIVRGMMAGPVASSPQDSFRKRSLRRSSALSRKLQ
FT                   TPEEIQQQSEPFVHTPAYLGPQEVPDSSSDSVSRSPLGQLNELSIEKPNVTSSSQGLSQ
FT                   RDRPRLRSVSEDSPLGYSHTEGNSRMAQDQLERAFKRQGVQPPSLRKNQLVSDRTDDKP
FT                   DALQLEDVEDELIKEDIVLFPPPSMLKLQTVSKPIDLSLAKGGPCGVLAAVQGCVLQKL
FT                   LFEGDNRTNSNLVRQDFDVPTSHLIGAHGYCTQELVNLLLTGRAVSNVFNDVVELDSGD
FT                   GNITLLRGIEARSDIGFLSLFEHYNVCQVGCFLKTPRFPIWVVCSESHFSILFSLQPEL
FT                   LCDWRSERLFDLYYYDGLANQQEEIRLTVDTTKTAPADSCSDLVPPLELCIRTKWKGAS
FT                   VNWNGSDPIL"
FT   gap             7433246..7434352
FT                   /estimated_length=1107
FT   gap             7439283..7439456
FT                   /estimated_length=174
FT   gap             7440735..7441176
FT                   /estimated_length=442
FT   gap             7450107..7450126
FT                   /estimated_length=20
FT   gap             7486566..7486585
FT                   /estimated_length=20
FT   gap             7489197..7491530
FT                   /estimated_length=2334
FT   gene            complement(7547071..7549959)
FT                   /locus_tag="mCG_121598"
FT                   /note="gene_id=mCG121598.1"
FT   mRNA            complement(join(7547071..7547995,7548690..7548868,
FT                   7549837..7549959))
FT                   /locus_tag="mCG_121598"
FT                   /product="mCG121598"
FT                   /note="gene_id=mCG121598.1 transcript_id=mCT122805.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(7547874..7547995,7548690..7548798))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121598"
FT                   /product="mCG121598"
FT                   /note="gene_id=mCG121598.1 transcript_id=mCT122805.1
FT                   protein_id=mCP61749.1"
FT                   /protein_id="EDK98727.1"
FT                   /translation="MEMLEGGKARGSAGGSLLLPAGQSSVGAELRSQLSEGPPRLHPEL
FT                   VMVASSLILRSGHCGEQRPASGPIIWPILVF"
FT   gene            7557921..7570199
FT                   /gene="Aqp1"
FT                   /locus_tag="mCG_121590"
FT                   /note="gene_id=mCG121590.1"
FT   mRNA            join(7557921..7558520,7567050..7567214,7567457..7567537,
FT                   7568262..7570199)
FT                   /gene="Aqp1"
FT                   /locus_tag="mCG_121590"
FT                   /product="aquaporin 1"
FT                   /note="gene_id=mCG121590.1 transcript_id=mCT122795.1
FT                   created on 05-AUG-2002"
FT   CDS             join(7558137..7558520,7567050..7567214,7567457..7567537,
FT                   7568262..7568441)
FT                   /codon_start=1
FT                   /gene="Aqp1"
FT                   /locus_tag="mCG_121590"
FT                   /product="aquaporin 1"
FT                   /note="gene_id=mCG121590.1 transcript_id=mCT122795.1
FT                   protein_id=mCP60834.1"
FT                   /protein_id="EDK98728.1"
FT                   /translation="MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTL
FT                   VQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVG
FT                   AIVATAILSGITSSLVDNSLGRNDLAHGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRD
FT                   LGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGGAL
FT                   AVLIYDFILAPRSSDFTDRMKVWTSGQVEEYDLDADDINSRVEMKPK"
FT   gene            <7597901..7610122
FT                   /gene="Ghrhr"
FT                   /locus_tag="mCG_121594"
FT                   /note="gene_id=mCG121594.1"
FT   mRNA            join(<7597901..7598050,7600461..7600563,7600669..7600776,
FT                   7601273..7601370,7602337..7602434,7603288..7603420,
FT                   7604852..7605005,7605286..7605346,7605693..7605762,
FT                   7606310..7606401,7606930..7607059,7608303..7608344,
FT                   7609762..7610122)
FT                   /gene="Ghrhr"
FT                   /locus_tag="mCG_121594"
FT                   /product="growth hormone releasing hormone receptor"
FT                   /note="gene_id=mCG121594.1 transcript_id=mCT122800.1
FT                   created on 05-AUG-2002"
FT   CDS             join(<7597940..7598050,7600461..7600563,7600669..7600776,
FT                   7601273..7601370,7602337..7602434,7603288..7603420,
FT                   7604852..7605005,7605286..7605346,7605693..7605762,
FT                   7606310..7606401,7606930..7607059,7608303..7608344,
FT                   7609762..7609887)
FT                   /codon_start=1
FT                   /gene="Ghrhr"
FT                   /locus_tag="mCG_121594"
FT                   /product="growth hormone releasing hormone receptor"
FT                   /note="gene_id=mCG121594.1 transcript_id=mCT122800.1
FT                   protein_id=mCP60958.1"
FT                   /protein_id="EDK98729.1"
FT                   /translation="VASPETAWEGRLTADTIAMDGLMWATRILCLLSLCGVTLGHLHLE
FT                   CDFITQLRDDELACLQAAEGTNNTSLGCPGTWDGLLCWPPTGSGQWVSLPCPEFFSHFG
FT                   SDTGFVKRDCTITGWSNPFPPYPVACPVPLELLTKEKSYFSTVKIIYTTGHSISIVALC
FT                   VAIAILVALRRLHCPRNYIHTQLFATFILKASAVFLKDAAIFQGDSTDHCSMSTVLCKV
FT                   SVAISHLATMTNFSWLLAEAVYLSCLLASTSPRSKPAFWWLVLAGWGLPVLCTGTWVGC
FT                   KLAFEDTECWDLDNSSPCWWIIKGPIVLSVGVNFGLFLNIICILLRKLEPAQGGLHTRA
FT                   QYWRLSKSTLLLIPLFGIHYIIFNFLPDSAGLDIRVPLELGLGSFQGFIVAVLYCFLNQ
FT                   EVRTEISRKWYGHDPELLPARRTCTEWTTPPRSRLKVLTSEC"
FT   gap             7608732..7609178
FT                   /estimated_length=447
FT   gene            <7618481..7633757
FT                   /locus_tag="mCG_144490"
FT                   /note="gene_id=mCG144490.0"
FT   mRNA            join(<7618481..7618569,7627147..7627320,7628828..7628902,
FT                   7630943..7633757)
FT                   /locus_tag="mCG_144490"
FT                   /product="mCG144490"
FT                   /note="gene_id=mCG144490.0 transcript_id=mCT183914.0
FT                   created on 05-JUN-2003"
FT   CDS             <7630954..7631250
FT                   /codon_start=1
FT                   /locus_tag="mCG_144490"
FT                   /product="mCG144490"
FT                   /note="gene_id=mCG144490.0 transcript_id=mCT183914.0
FT                   protein_id=mCP105481.0"
FT                   /protein_id="EDK98730.1"
FT                   /translation="DMSLLKLLSPEYLGILEGPFLSGPVAWHTQTTAQHVSGKTCLSTS
FT                   PPVADPGPSEQREKKDSQGSSSHGTLSTTVLKTPGCFPRLSPEFVSTDAYLRL"
FT   gap             7643466..7643485
FT                   /estimated_length=20
FT   gap             7667612..7667631
FT                   /estimated_length=20
FT   gene            7671549..7716991
FT                   /gene="Adcyap1r1"
FT                   /locus_tag="mCG_121587"
FT                   /note="gene_id=mCG121587.1"
FT   mRNA            join(7671549..7671937,7679731..7679860,7681083..7681188,
FT                   7691837..7691944,7694177..7694197,7695084..7695125,
FT                   7697698..7697807,7698295..7698392,7698781..7698913,
FT                   7699571..7699724,7700040..7700100,7700716..7700785,
FT                   7704544..7704635,7710822..7710905,7713672..7713801,
FT                   7715169..7715210,7716578..7716991)
FT                   /gene="Adcyap1r1"
FT                   /locus_tag="mCG_121587"
FT                   /product="adenylate cyclase activating polypeptide 1
FT                   receptor 1"
FT                   /note="gene_id=mCG121587.1 transcript_id=mCT122792.1
FT                   created on 05-AUG-2002"
FT   CDS             join(7679810..7679860,7681083..7681188,7691837..7691944,
FT                   7694177..7694197,7695084..7695125,7697698..7697807,
FT                   7698295..7698392,7698781..7698913,7699571..7699724,
FT                   7700040..7700100,7700716..7700785,7704544..7704635,
FT                   7710822..7710905,7713672..7713801,7715169..7715210,
FT                   7716578..7716766)
FT                   /codon_start=1
FT                   /gene="Adcyap1r1"
FT                   /locus_tag="mCG_121587"
FT                   /product="adenylate cyclase activating polypeptide 1
FT                   receptor 1"
FT                   /note="gene_id=mCG121587.1 transcript_id=mCT122792.1
FT                   protein_id=mCP61718.1"
FT                   /protein_id="EDK98731.1"
FT                   /translation="MARTLQLSLTALLLLPMAIAMHSDCIFKKEQAMCLERIQRANDLM
FT                   GLNESSPGCPGMWDNITCWKPAQIGEMVLVSCPEVFRIFNPDQVWMTETIGDSGFADSN
FT                   SLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYEPESGDQDYYYLSVKALYTVGYST
FT                   SLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSSHCFVS
FT                   TVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCV
FT                   TVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDM
FT                   GGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAF
FT                   SPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKH
FT                   RHPSLASSGVNGGTQLSILSKSSSQLRMSSLPADNLAT"
FT   gap             7691610..7691629
FT                   /estimated_length=20
FT   gap             7727638..7727657
FT                   /estimated_length=20
FT   gap             7738739..7738758
FT                   /estimated_length=20
FT   gap             7741849..7741868
FT                   /estimated_length=20
FT   gap             7761848..7761927
FT                   /estimated_length=80
FT   gap             7777347..7777366
FT                   /estimated_length=20
FT   gap             7778511..7778530
FT                   /estimated_length=20
FT   gap             7799178..7799197
FT                   /estimated_length=20
FT   gap             7821138..7821601
FT                   /estimated_length=464
FT   gap             7839462..7839481
FT                   /estimated_length=20
FT   gap             7847645..7847664
FT                   /estimated_length=20
FT   gap             7855525..7855544
FT                   /estimated_length=20
FT   gap             7877136..7877464
FT                   /estimated_length=329
FT   gap             7886334..7887210
FT                   /estimated_length=877
FT   gene            complement(7896293..7899568)
FT                   /gene="Neurod6"
FT                   /locus_tag="mCG_121589"
FT                   /note="gene_id=mCG121589.1"
FT   mRNA            complement(join(7896293..7898141,7899434..7899568))
FT                   /gene="Neurod6"
FT                   /locus_tag="mCG_121589"
FT                   /product="neurogenic differentiation 6"
FT                   /note="gene_id=mCG121589.1 transcript_id=mCT122794.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(7897107..7898120)
FT                   /codon_start=1
FT                   /gene="Neurod6"
FT                   /locus_tag="mCG_121589"
FT                   /product="neurogenic differentiation 6"
FT                   /note="gene_id=mCG121589.1 transcript_id=mCT122794.1
FT                   protein_id=mCP60820.1"
FT                   /db_xref="GOA:Q5M8T7"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR016637"
FT                   /db_xref="InterPro:IPR022575"
FT                   /db_xref="MGI:MGI:106593"
FT                   /db_xref="UniProtKB/TrEMBL:Q5M8T7"
FT                   /protein_id="EDK98732.1"
FT                   /translation="MLTLPFDESVVMPESQMCRKFARQCEDQKQIKKPESFPKQVVLRG
FT                   KSIKRAPGEETEKEEEEEDREEEDENGLSRRRGLRKKKTTKLRLERVKFRRQEANARER
FT                   NRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQ
FT                   NLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELATPPGH
FT                   GTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDY
FT                   GKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN"
FT   gene            <7903045..7913048
FT                   /locus_tag="mCG_144489"
FT                   /note="gene_id=mCG144489.0"
FT   mRNA            join(<7903045..7903090,7906650..7906728,7912082..7913048)
FT                   /locus_tag="mCG_144489"
FT                   /product="mCG144489"
FT                   /note="gene_id=mCG144489.0 transcript_id=mCT183913.0
FT                   created on 05-JUN-2003"
FT   CDS             <7912314..7912598
FT                   /codon_start=1
FT                   /locus_tag="mCG_144489"
FT                   /product="mCG144489"
FT                   /note="gene_id=mCG144489.0 transcript_id=mCT183913.0
FT                   protein_id=mCP105480.0"
FT                   /protein_id="EDK98733.1"
FT                   /translation="SPIRLLRRPCHHLMDSQSLPRAPIGKVMAASAQALEGTQPSIQEP
FT                   LTFYKCWVMLCLLPSVTSFTGITESKQCILKETCFLCVHNSHRDIYVHT"
FT   gap             7914339..7914358
FT                   /estimated_length=20
FT   gap             7919867..7919886
FT                   /estimated_length=20
FT   gap             7925335..7925354
FT                   /estimated_length=20
FT   gap             8034889..8034908
FT                   /estimated_length=20
FT   gap             8069690..8069838
FT                   /estimated_length=149
FT   gene            <8092136..>8117898
FT                   /locus_tag="mCG_124610"
FT                   /note="gene_id=mCG124610.1"
FT   mRNA            join(<8092136..8092214,8093852..8093900,8094244..8094287,
FT                   8104246..8104297,8106549..8106635,8108564..8108766,
FT                   8117603..>8117898)
FT                   /locus_tag="mCG_124610"
FT                   /product="mCG124610"
FT                   /note="gene_id=mCG124610.1 transcript_id=mCT125858.1
FT                   created on 05-AUG-2002"
FT   CDS             join(<8092136..8092214,8093852..8093900,8094244..8094287,
FT                   8104246..8104297,8106549..8106635,8108564..8108766,
FT                   8117603..>8117898)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124610"
FT                   /product="mCG124610"
FT                   /note="gene_id=mCG124610.1 transcript_id=mCT125858.1
FT                   protein_id=mCP61522.1"
FT                   /protein_id="EDK98734.1"
FT                   /translation="RAWAPLDGHLLPDSEEENPMVTMYVQENSKQESIQQWLDSGFFVS
FT                   VNENFQQTINHTASLHEQGIIQMTVKDYMRSLHQFSETPTLSRGTSFNSCYSTTGVPQS
FT                   IPEWLEFWEKDPVEILLDLGFGADEPDICTQIPARFLGYSSAARGINIHVFLEAQKQRM
FT                   DFENPDLYGRFQQLEILDHVTNAFSSLLDGVKTQQNQHEEKAERQAMQNPSSSGAKEHK
FT                   RKMSQLLKRASRQTSRMDGNPALSKSCKTEHEIPTLPTKPWDPRVELQ"
FT   gap             8112031..8112050
FT                   /estimated_length=20
FT   gap             8174673..8175349
FT                   /estimated_length=677
FT   gap             8177988..8179165
FT                   /estimated_length=1178
FT   gap             8179938..8182663
FT                   /estimated_length=2726
FT   gap             8183533..8183603
FT                   /estimated_length=71
FT   gene            <8195401..8198553
FT                   /locus_tag="mCG_124608"
FT                   /note="gene_id=mCG124608.1"
FT   mRNA            join(<8195401..8195528,8196156..8196267,8197976..8198553)
FT                   /locus_tag="mCG_124608"
FT                   /product="mCG124608"
FT                   /note="gene_id=mCG124608.1 transcript_id=mCT125856.1
FT                   created on 05-AUG-2002"
FT   CDS             join(<8195401..8195528,8196156..8196267,8197976..8198326)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124608"
FT                   /product="mCG124608"
FT                   /note="gene_id=mCG124608.1 transcript_id=mCT125856.1
FT                   protein_id=mCP61515.0"
FT                   /protein_id="EDK98735.1"
FT                   /translation="CTVYEMETMKMVCQSFREHLEEIEQHFMGQQALYPRDMSEEEREE
FT                   AEYLRTLREALRQQVAELAFQLGDRARQIKEGILLQLDLLCEELPEHCDNLPQCNWTEG
FT                   KHGQRSCVQTHAVAPDPTLPASSGQWTPCSGMTQPVALSPSHLETRGGISLQSPARAES
FT                   GPGPSLSHVGEKSLLDQSGFDDLCTKCNVQEQL"
FT   gap             8207359..8208331
FT                   /estimated_length=973
FT   gene            8237390..8252823
FT                   /gene="Gsbs"
FT                   /locus_tag="mCG_124606"
FT                   /note="gene_id=mCG124606.1"
FT   mRNA            join(8237390..8237450,8242458..8242616,8246160..8246312,
FT                   8246590..8246742,8251613..8252823)
FT                   /gene="Gsbs"
FT                   /locus_tag="mCG_124606"
FT                   /product="G substrate"
FT                   /note="gene_id=mCG124606.1 transcript_id=mCT125854.1
FT                   created on 05-AUG-2002"
FT   gap             8241540..8241559
FT                   /estimated_length=20
FT   CDS             join(8242523..8242616,8246160..8246312,8246590..8246742,
FT                   8251613..8251692)
FT                   /codon_start=1
FT                   /gene="Gsbs"
FT                   /locus_tag="mCG_124606"
FT                   /product="G substrate"
FT                   /note="gene_id=mCG124606.1 transcript_id=mCT125854.1
FT                   protein_id=mCP62265.1"
FT                   /db_xref="GOA:Q9Z2E4"
FT                   /db_xref="MGI:MGI:1333876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2E4"
FT                   /protein_id="EDK98736.1"
FT                   /translation="MSTEMMTTEPVPPLELSDDILGKLDPQCSPSDDLSDQFIKDCDLK
FT                   KKPRKGKNVQATLNVESDQKKPRRKDTPAVHIPPFIPGVISEHLIKRYDVQERIPKAKS
FT                   GPALHNSDMEQKRPRRKDTPALHMPPFVAGLTLLRDESAGVILEDEEMDGDKLAI"
XX
CO   join(AAHY01053146.1:1..52436,gap(20),AAHY01053147.1:1..2105,gap(623),
CO   AAHY01053148.1:1..49336,gap(153),complement(AAHY01053149.1:1..1348),
CO   gap(20),AAHY01053150.1:1..11871,gap(61),AAHY01053151.1:1..12219,gap(104),
CO   AAHY01053152.1:1..4807,gap(221),AAHY01053153.1:1..15720,gap(20),
CO   AAHY01053154.1:1..69655,gap(2292),AAHY01053155.1:1..43118,gap(732),
CO   complement(AAHY01053156.1:1..1429),gap(120),AAHY01053157.1:1..3035,
CO   gap(189),AAHY01053158.1:1..32457,gap(136),AAHY01053159.1:1..14585,gap(20),
CO   AAHY01053160.1:1..13744,gap(715),AAHY01053161.1:1..1447,gap(20),
CO   AAHY01053162.1:1..2613,gap(37),complement(AAHY01053163.1:1..7295),gap(20),
CO   AAHY01053164.1:1..19986,gap(20),AAHY01053165.1:1..1700,gap(265),
CO   AAHY01053166.1:1..22616,gap(913),AAHY01053167.1:1..6382,gap(49),
CO   AAHY01053168.1:1..6010,gap(20),AAHY01053169.1:1..6831,gap(20),
CO   AAHY01053170.1:1..7626,gap(44),AAHY01053171.1:1..850,gap(209),
CO   complement(AAHY01053172.1:1..23113),gap(93),AAHY01053173.1:1..11500,
CO   gap(62),AAHY01053174.1:1..20526,gap(20),AAHY01053175.1:1..28082,gap(20),
CO   AAHY01053176.1:1..14241,gap(20),complement(AAHY01053177.1:1..2099),gap(20),
CO   AAHY01053178.1:1..1085,gap(20),AAHY01053179.1:1..7200,gap(20),
CO   complement(AAHY01053180.1:1..162),gap(20),
CO   complement(AAHY01053181.1:1..10562),gap(20),
CO   complement(AAHY01053182.1:1..201),gap(20),AAHY01053183.1:1..27428,gap(20),
CO   AAHY01053184.1:1..48505,gap(20),complement(AAHY01053185.1:1..37792),
CO   gap(20),AAHY01053186.1:1..42213,gap(2406),AAHY01053187.1:1..3053,gap(20),
CO   AAHY01053188.1:1..13244,gap(3190),AAHY01053189.1:1..2001,gap(20),
CO   AAHY01053190.1:1..6223,gap(20),AAHY01053191.1:1..44278,gap(20),
CO   AAHY01053192.1:1..113881,gap(516),AAHY01053193.1:1..28324,gap(20),
CO   AAHY01053194.1:1..13381,gap(574),complement(AAHY01053195.1:1..22829),
CO   gap(299),AAHY01053196.1:1..5178,gap(544),AAHY01053197.1:1..8403,gap(20),
CO   complement(AAHY01053198.1:1..1405),gap(20),AAHY01053199.1:1..2410,
CO   gap(3343),complement(AAHY01053200.1:1..1678),gap(20),
CO   complement(AAHY01053201.1:1..8627),gap(256),
CO   complement(AAHY01053202.1:1..17457),gap(20),AAHY01053203.1:1..147079,
CO   gap(36),complement(AAHY01053204.1:1..12230),gap(313),
CO   complement(AAHY01053205.1:1..818),gap(106),AAHY01053206.1:1..36510,gap(20),
CO   AAHY01053207.1:1..12231,gap(20),AAHY01053208.1:1..51667,gap(35),
CO   AAHY01053209.1:1..4254,gap(433),AAHY01053210.1:1..3382,gap(267),
CO   AAHY01053211.1:1..26140,gap(46),AAHY01053212.1:1..78205,gap(61),
CO   AAHY01053213.1:1..27324,gap(20),AAHY01053214.1:1..12054,gap(20),
CO   AAHY01053215.1:1..1590,gap(52),AAHY01053216.1:1..18613,gap(279),
CO   AAHY01053217.1:1..8625,gap(74),AAHY01053218.1:1..16126,gap(20),
CO   AAHY01053219.1:1..23541,gap(26),AAHY01053220.1:1..43277,gap(391),
CO   complement(AAHY01053221.1:1..9324),gap(204),AAHY01053222.1:1..14073,
CO   gap(1489),AAHY01053223.1:1..8647,gap(20),AAHY01053224.1:1..12237,gap(20),
CO   complement(AAHY01053225.1:1..1097),gap(20),AAHY01053226.1:1..9179,gap(20),
CO   AAHY01053227.1:1..4430,gap(407),AAHY01053228.1:1..9084,gap(192),
CO   AAHY01053229.1:1..12918,gap(754),AAHY01053230.1:1..6301,gap(36),
CO   AAHY01053231.1:1..7646,gap(20),AAHY01053232.1:1..30091,gap(692),
CO   AAHY01053233.1:1..115645,gap(761),complement(AAHY01053234.1:1..13472),
CO   gap(438),complement(AAHY01053235.1:1..2200),gap(20),
CO   AAHY01053236.1:1..47369,gap(20),AAHY01053237.1:1..107183,gap(3435),
CO   AAHY01053238.1:1..17900,gap(103),complement(AAHY01053239.1:1..48203),
CO   gap(20),AAHY01053240.1:1..4084,gap(28),complement(AAHY01053241.1:1..7792),
CO   gap(846),complement(AAHY01053242.1:1..36216),gap(20),
CO   AAHY01053243.1:1..26911,gap(5020),AAHY01053244.1:1..771,gap(28),
CO   AAHY01053245.1:1..12567,gap(20),complement(AAHY01053246.1:1..14037),
CO   gap(20),complement(AAHY01053247.1:1..1824),gap(795),AAHY01053248.1:1..6230,
CO   gap(20),complement(AAHY01053249.1:1..2505),gap(20),AAHY01053250.1:1..4985,
CO   gap(62),complement(AAHY01053251.1:1..37920),gap(486),
CO   complement(AAHY01053252.1:1..941),gap(211),
CO   complement(AAHY01053253.1:1..25982),gap(292),
CO   complement(AAHY01053254.1:1..15071),gap(146),
CO   complement(AAHY01053255.1:1..6987),gap(20),
CO   complement(AAHY01053256.1:1..23858),gap(381),
CO   complement(AAHY01053257.1:1..3114),gap(20),
CO   complement(AAHY01053258.1:1..2422),gap(509),AAHY01053259.1:1..55196,
CO   gap(102),complement(AAHY01053260.1:1..16702),gap(20),
CO   AAHY01053261.1:1..13437,gap(20),AAHY01053262.1:1..67970,gap(4163),
CO   AAHY01053263.1:1..249239,gap(325),complement(AAHY01053264.1:1..17449),
CO   gap(20),complement(AAHY01053265.1:1..22605),gap(60),
CO   AAHY01053266.1:1..39289,gap(20),AAHY01053267.1:1..2592,gap(72),
CO   AAHY01053268.1:1..70827,gap(20),AAHY01053269.1:1..1166,gap(577),
CO   AAHY01053270.1:1..638,gap(887),complement(AAHY01053271.1:1..813),gap(4861),
CO   AAHY01053272.1:1..1960,gap(20),AAHY01053273.1:1..1157,gap(9414),
CO   complement(AAHY01053274.1:1..2785),gap(567),
CO   complement(AAHY01053275.1:1..3195),gap(145),
CO   complement(AAHY01053276.1:1..4002),gap(165),
CO   complement(AAHY01053277.1:1..11301),gap(491),AAHY01053278.1:1..22506,
CO   gap(20),AAHY01053279.1:1..1425,gap(36),complement(AAHY01053280.1:1..16985),
CO   gap(132),AAHY01053281.1:1..16481,gap(20),
CO   complement(AAHY01053282.1:1..24584),gap(530),AAHY01053283.1:1..42561,
CO   gap(23),AAHY01053284.1:1..64110,gap(20),AAHY01053285.1:1..86337,gap(20),
CO   complement(AAHY01053286.1:1..5628),gap(20),
CO   complement(AAHY01053287.1:1..2481),gap(20),
CO   complement(AAHY01053288.1:1..1465),gap(279),AAHY01053289.1:1..22755,
CO   gap(241),AAHY01053290.1:1..9247,gap(20),complement(AAHY01053291.1:1..2370),
CO   gap(20),AAHY01053292.1:1..30293,gap(20),AAHY01053293.1:1..1320,gap(20),
CO   AAHY01053294.1:1..7485,gap(293),AAHY01053295.1:1..18412,gap(44),
CO   AAHY01053296.1:1..32081,gap(20),AAHY01053297.1:1..29396,gap(55),
CO   AAHY01053298.1:1..1615,gap(498),AAHY01053299.1:1..18164,gap(20),
CO   AAHY01053300.1:1..7327,gap(310),AAHY01053301.1:1..8717,gap(20),
CO   AAHY01053302.1:1..61903,gap(20),AAHY01053303.1:1..22412,gap(2421),
CO   AAHY01053304.1:1..8099,gap(678),AAHY01053305.1:1..15518,gap(20),
CO   complement(AAHY01053306.1:1..12656),gap(20),AAHY01053307.1:1..1008,gap(20),
CO   complement(AAHY01053308.1:1..6866),gap(2278),AAHY01053309.1:1..10032,
CO   gap(20),AAHY01053310.1:1..16002,gap(800),
CO   complement(AAHY01053311.1:1..36916),gap(543),
CO   complement(AAHY01053312.1:1..25727),gap(20),
CO   complement(AAHY01053313.1:1..12598),gap(46),
CO   complement(AAHY01053314.1:1..3826),gap(254),AAHY01053315.1:1..1530,gap(20),
CO   complement(AAHY01053316.1:1..27760),gap(20),
CO   complement(AAHY01053317.1:1..31705),gap(20),
CO   complement(AAHY01053318.1:1..12341),gap(20),
CO   complement(AAHY01053319.1:1..11216),gap(20),
CO   complement(AAHY01053320.1:1..36553),gap(20),
CO   complement(AAHY01053321.1:1..26014),gap(142),AAHY01053322.1:1..9060,
CO   gap(20),AAHY01053323.1:1..13775,gap(160),
CO   complement(AAHY01053324.1:1..10652),gap(95),
CO   complement(AAHY01053325.1:1..10877),gap(20),AAHY01053326.1:1..69340,
CO   gap(20),complement(AAHY01053327.1:1..54904),gap(754),
CO   complement(AAHY01053328.1:1..29044),gap(1357),AAHY01053329.1:1..40760,
CO   gap(983),complement(AAHY01053330.1:1..29654),gap(30),
CO   AAHY01053331.1:1..22218,gap(91),complement(AAHY01053332.1:1..14381),
CO   gap(100),complement(AAHY01053333.1:1..54629),gap(20),
CO   complement(AAHY01053334.1:1..138076),gap(81),AAHY01053335.1:1..8364,
CO   gap(20),AAHY01053336.1:1..25483,gap(136),
CO   complement(AAHY01053337.1:1..42199),gap(2201),
CO   complement(AAHY01053338.1:1..55060),gap(381),
CO   complement(AAHY01053339.1:1..114466),gap(316),
CO   complement(AAHY01053340.1:1..40694),gap(20),AAHY01053341.1:1..25573,
CO   gap(159),AAHY01053342.1:1..18648,gap(65),AAHY01053343.1:1..47533,gap(20),
CO   AAHY01053344.1:1..36743,gap(45),complement(AAHY01053345.1:1..23239),
CO   gap(120),AAHY01053346.1:1..5863,gap(20),
CO   complement(AAHY01053347.1:1..51061),gap(1797),AAHY01053348.1:1..2304,
CO   gap(507),complement(AAHY01053349.1:1..21745),gap(20),
CO   complement(AAHY01053350.1:1..9005),gap(20),AAHY01053351.1:1..7812,gap(76),
CO   AAHY01053352.1:1..90996,gap(49),complement(AAHY01053353.1:1..1323),
CO   gap(1258),complement(AAHY01053354.1:1..1055),gap(57),
CO   complement(AAHY01053355.1:1..6706),gap(604),
CO   complement(AAHY01053356.1:1..30522),gap(20),
CO   complement(AAHY01053357.1:1..7929),gap(53),
CO   complement(AAHY01053358.1:1..71396),gap(249),
CO   complement(AAHY01053359.1:1..57202),gap(20),
CO   complement(AAHY01053360.1:1..49983),gap(20),
CO   complement(AAHY01053361.1:1..53893),gap(533),
CO   complement(AAHY01053362.1:1..67869),gap(3958),AAHY01053363.1:1..90511,
CO   gap(710),AAHY01053364.1:1..14555,gap(388),AAHY01053365.1:1..1462,gap(4640),
CO   AAHY01053366.1:1..27181,gap(350),AAHY01053367.1:1..584,gap(200),
CO   AAHY01053368.1:1..18381,gap(647),complement(AAHY01053369.1:1..1513),
CO   gap(885),AAHY01053370.1:1..5337,gap(281),AAHY01053371.1:1..10966,gap(2794),
CO   AAHY01053372.1:1..9600,gap(441),AAHY01053373.1:1..26649,gap(20),
CO   AAHY01053374.1:1..1184,gap(20),AAHY01053375.1:1..22545,gap(20),
CO   complement(AAHY01053376.1:1..1102),gap(91),
CO   complement(AAHY01053377.1:1..1160),gap(20),AAHY01053378.1:1..26751,
CO   gap(202),AAHY01053379.1:1..46059,gap(150),AAHY01053380.1:1..6231,gap(20),
CO   AAHY01053381.1:1..17203,gap(20),AAHY01053382.1:1..22262,gap(20),
CO   AAHY01053383.1:1..64749,gap(20),complement(AAHY01053384.1:1..1406),gap(20),
CO   AAHY01053385.1:1..1034,gap(20),complement(AAHY01053386.1:1..1406),gap(20),
CO   complement(AAHY01053387.1:1..1889),gap(20),AAHY01053388.1:1..38691,
CO   gap(1801),AAHY01053389.1:1..16496,gap(1138),AAHY01053390.1:1..6146,gap(20),
CO   complement(AAHY01053391.1:1..12753),gap(276),AAHY01053392.1:1..60591,
CO   gap(284),AAHY01053393.1:1..113675,gap(69),AAHY01053394.1:1..93079,gap(186),
CO   complement(AAHY01053395.1:1..13626),gap(5149),AAHY01053396.1:1..99236,
CO   gap(89),AAHY01053397.1:1..49293,gap(20),AAHY01053398.1:1..76549,gap(20),
CO   complement(AAHY01053399.1:1..11595),gap(20),AAHY01053400.1:1..28467,
CO   gap(20),complement(AAHY01053401.1:1..57399),gap(189),
CO   complement(AAHY01053402.1:1..56993),gap(595),AAHY01053403.1:1..20352,
CO   gap(20),complement(AAHY01053404.1:1..17895),gap(20),
CO   AAHY01053405.1:1..102677,gap(20),complement(AAHY01053406.1:1..26022),
CO   gap(20),AAHY01053407.1:1..35820,gap(2298),AAHY01053408.1:1..16751,gap(562),
CO   complement(AAHY01053409.1:1..2922),gap(356),
CO   complement(AAHY01053410.1:1..60197),gap(20),
CO   complement(AAHY01053411.1:1..28901),gap(20),AAHY01053412.1:1..47769,
CO   gap(20),AAHY01053413.1:1..60360,gap(20),AAHY01053414.1:1..65690,gap(20),
CO   complement(AAHY01053415.1:1..3276),gap(106),
CO   complement(AAHY01053416.1:1..4464),gap(279),AAHY01053417.1:1..3972,gap(20),
CO   complement(AAHY01053418.1:1..4021),gap(20),AAHY01053419.1:1..43685,
CO   gap(1141),AAHY01053420.1:1..40090,gap(20),AAHY01053421.1:1..1394,gap(657),
CO   AAHY01053422.1:1..1816,gap(181),complement(AAHY01053423.1:1..4466),gap(20),
CO   AAHY01053424.1:1..32928,gap(20),AAHY01053425.1:1..19349,gap(20),
CO   AAHY01053426.1:1..139021,gap(20),AAHY01053427.1:1..2342,gap(5001),
CO   AAHY01053428.1:1..1789,gap(108),complement(AAHY01053429.1:1..1468),
CO   gap(524),AAHY01053430.1:1..5751,gap(30),complement(AAHY01053431.1:1..8384),
CO   gap(1839),AAHY01053432.1:1..1424,gap(20),AAHY01053433.1:1..31608,gap(1046),
CO   complement(AAHY01053434.1:1..11948),gap(424),AAHY01053435.1:1..2437,
CO   gap(20),AAHY01053436.1:1..19949,gap(110),
CO   complement(AAHY01053437.1:1..86664),gap(39),
CO   complement(AAHY01053438.1:1..25785),gap(20),AAHY01053439.1:1..12059,
CO   gap(330),AAHY01053440.1:1..35107,gap(1107),
CO   complement(AAHY01053441.1:1..4930),gap(174),AAHY01053442.1:1..1278,
CO   gap(442),complement(AAHY01053443.1:1..8930),gap(20),
CO   complement(AAHY01053444.1:1..36439),gap(20),AAHY01053445.1:1..2611,
CO   gap(2334),AAHY01053446.1:1..117201,gap(447),
CO   complement(AAHY01053447.1:1..34287),gap(20),
CO   complement(AAHY01053448.1:1..24126),gap(20),
CO   complement(AAHY01053449.1:1..23978),gap(20),AAHY01053450.1:1..36008,
CO   gap(20),AAHY01053451.1:1..11081,gap(20),AAHY01053452.1:1..3090,gap(20),
CO   AAHY01053453.1:1..19979,gap(80),complement(AAHY01053454.1:1..15419),
CO   gap(20),complement(AAHY01053455.1:1..1144),gap(20),AAHY01053456.1:1..20647,
CO   gap(20),AAHY01053457.1:1..21940,gap(464),AAHY01053458.1:1..17860,gap(20),
CO   AAHY01053459.1:1..8163,gap(20),AAHY01053460.1:1..7860,gap(20),
CO   AAHY01053461.1:1..21591,gap(329),AAHY01053462.1:1..8869,gap(877),
CO   complement(AAHY01053463.1:1..27128),gap(20),AAHY01053464.1:1..5508,gap(20),
CO   AAHY01053465.1:1..5448,gap(20),AAHY01053466.1:1..109534,gap(20),
CO   AAHY01053467.1:1..34781,gap(149),AAHY01053468.1:1..42192,gap(20),
CO   AAHY01053469.1:1..62622,gap(677),AAHY01053470.1:1..2638,gap(1178),
CO   AAHY01053471.1:1..772,gap(2726),AAHY01053472.1:1..869,gap(71),
CO   AAHY01053473.1:1..23755,gap(973),AAHY01053474.1:1..33208,gap(20),
CO   AAHY01053475.1:1..25643)
//


spacer
spacer