spacer

EBI Dbfetch

ID   CH466595; SV 1; linear; genomic DNA; CON; MUS; 8358419 BP.
XX
AC   CH466595;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009752558 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8358419
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-8358419
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 50df88be43123e4c7e7632c99d369e63.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000219.
DR   Ensembl-Gn; ENSMUSG00000005917; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007739; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020142; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020149; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020152; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020275; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044068; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049800; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093292; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102864; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109586; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159081; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163483; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173867; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8358419
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            3108..4082
FT                   /pseudo
FT                   /locus_tag="mCG_1030856"
FT                   /note="gene_id=mCG1030856.1"
FT   mRNA            3108..4082
FT                   /pseudo
FT                   /locus_tag="mCG_1030856"
FT                   /note="gene_id=mCG1030856.1 transcript_id=mCT148560.1
FT                   created on 14-MAY-2002"
FT   gene            complement(22305..>22864)
FT                   /locus_tag="mCG_1030858"
FT                   /note="gene_id=mCG1030858.1"
FT   mRNA            complement(22305..>22864)
FT                   /locus_tag="mCG_1030858"
FT                   /product="mCG1030858"
FT                   /note="gene_id=mCG1030858.1 transcript_id=mCT148562.1
FT                   created on 14-MAY-2002"
FT   CDS             complement(22585..>22764)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030858"
FT                   /product="mCG1030858"
FT                   /note="gene_id=mCG1030858.1 transcript_id=mCT148562.1
FT                   protein_id=mCP71452.1"
FT                   /protein_id="EDL07810.1"
FT                   /translation="DNLNCCMTCFSLFVLKITGRHRNTLKYIKGCLLAVLTYILYLKEV
FT                   FFPLSSPPPSPFGF"
FT   gene            complement(23115..37042)
FT                   /locus_tag="mCG_5690"
FT                   /note="gene_id=mCG5690.1"
FT   mRNA            complement(join(23115..23813,29060..31020,31228..31340,
FT                   35419..35495,35745..35870,36730..37042))
FT                   /locus_tag="mCG_5690"
FT                   /product="mCG5690"
FT                   /note="gene_id=mCG5690.1 transcript_id=mCT5242.1 created on
FT                   14-MAY-2002"
FT   CDS             complement(join(23689..23813,29060..31020,31228..31340,
FT                   35419..35495,35745..35870,36730..36961))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5690"
FT                   /product="mCG5690"
FT                   /note="gene_id=mCG5690.1 transcript_id=mCT5242.1
FT                   protein_id=mCP6435.1"
FT                   /protein_id="EDL07811.1"
FT                   /translation="MQLKDGGTGMSRRRKHADSPARRSTPHRAAAKNCRPAAEPWLRES
FT                   RAACSSQLRRAGTRSARRAQRQAAADGGRSPRGKETPVQIVKMDLLSCTFSSPNDPDGQ
FT                   TDIFWDQNSPMTKQLGKGRKKQISSAYSDEISHIVNRIAPQDEKPVTNSMLGVWIGETA
FT                   IPCTPGVAKEKSRVKASCTKLKTKNREKELMKLAQQFDKNMEELDVIQEQDGKNHDFIQ
FT                   MTSKMGHLDNHKDSVQKPSGDVVPEITCTPVKKQMKGDSRISLAKAQDSSQKPFDQNVE
FT                   AAFNAIFDGSTQMCSGQLSQDLLDAFLNNSKTSLRKKNALLQEEIITTETLLTENLLNK
FT                   TPISLSPQIDTTVILNSCVTPCPKTPAAPDTQLDELTANDFEDDWESLLGSEPFLMENA
FT                   EMLEFVPSTTAQDTCQKAICTSVGENDTITSRTNMNLGGRLRDSKVTLDLPSKTRNGEL
FT                   RNAGEHRFSSHPGDESRKVPFTGNKVSFEKSVTSIVSKDEDYVAVSNLEKVKEDSRNKC
FT                   ILNKHSSNKSSSYTRYPSKQSSELGVNLPLQVPTTDPFDSVFLGKENIVCSTNQSHGSK
FT                   LNSSFDDWNDPLLASEMVEACHRLEATWDAGEVDDDLFCQACDDIERLTQQENKGSEES
FT                   ESVSYTSTRGSRSSSTASKQASQSAPSKHWNVVSSAVPLSLANKSQMSKPVTVQKRGRC
FT                   GDGPNILDATNLSVCSKNSSDNKRGPVQVNSSKFVLGGSSNLNVNLGLMSTKIATNMKL
FT                   STQQLSHNSLADTAQNDNKILKLPKFTFKKKNPQLNQNHLVGSVPVGKISEDLGKRETV
FT                   NSLLEANQQQSSINYSESLKPSSPDEEERNRKYSPEEIQRKRQEALVRRKAKALHTVQS
FT                   APISLP"
FT   gene            complement(39696..45997)
FT                   /pseudo
FT                   /locus_tag="mCG_1030859"
FT                   /note="gene_id=mCG1030859.1"
FT   mRNA            complement(39696..45997)
FT                   /pseudo
FT                   /locus_tag="mCG_1030859"
FT                   /note="gene_id=mCG1030859.1 transcript_id=mCT148563.1
FT                   created on 23-AUG-2002"
FT   gene            complement(64020..65115)
FT                   /pseudo
FT                   /locus_tag="mCG_113828"
FT                   /note="gene_id=mCG113828.1"
FT   mRNA            complement(64020..65115)
FT                   /pseudo
FT                   /locus_tag="mCG_113828"
FT                   /note="gene_id=mCG113828.1 transcript_id=mCT114916.1
FT                   created on 15-MAY-2002"
FT   gene            <179292..191082
FT                   /locus_tag="mCG_144580"
FT                   /note="gene_id=mCG144580.0"
FT   mRNA            join(<179292..180320,183174..184900,189067..189180,
FT                   190562..191082)
FT                   /locus_tag="mCG_144580"
FT                   /product="mCG144580"
FT                   /note="gene_id=mCG144580.0 transcript_id=mCT184004.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<180003..180320,183174..183248)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144580"
FT                   /product="mCG144580"
FT                   /note="gene_id=mCG144580.0 transcript_id=mCT184004.0
FT                   protein_id=mCP105188.0"
FT                   /protein_id="EDL07812.1"
FT                   /translation="LDNLFIYISNVFPFPGLPFRFPSGLLPYPSPDSMRVLPPPLRFSC
FT                   PGIPLHWGIEHPQAQGPLLPLMSNKALLFHISDQHHGLLHVYSLVGGSVPRNSGVSVML
FT                   ILLLPPWGFKPPLLLQPFSKSSIGAH"
FT   gene            complement(288131..288814)
FT                   /pseudo
FT                   /locus_tag="mCG_51570"
FT                   /note="gene_id=mCG51570.2"
FT   mRNA            complement(288131..288814)
FT                   /pseudo
FT                   /locus_tag="mCG_51570"
FT                   /note="gene_id=mCG51570.2 transcript_id=mCT51753.2 created
FT                   on 15-MAY-2002"
FT   gene            complement(406994..409087)
FT                   /pseudo
FT                   /locus_tag="mCG_49304"
FT                   /note="gene_id=mCG49304.2"
FT   mRNA            complement(406994..409087)
FT                   /pseudo
FT                   /locus_tag="mCG_49304"
FT                   /note="gene_id=mCG49304.2 transcript_id=mCT49487.2 created
FT                   on 15-MAY-2002"
FT   gene            complement(561835..>563856)
FT                   /locus_tag="mCG_1030862"
FT                   /note="gene_id=mCG1030862.1"
FT   mRNA            complement(561835..>563856)
FT                   /locus_tag="mCG_1030862"
FT                   /product="mCG1030862"
FT                   /note="gene_id=mCG1030862.1 transcript_id=mCT148566.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(562808..>563260)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030862"
FT                   /product="mCG1030862"
FT                   /note="gene_id=mCG1030862.1 transcript_id=mCT148566.1
FT                   protein_id=mCP71466.1"
FT                   /protein_id="EDL07813.1"
FT                   /translation="SRDPRCVVMLFSPIGPLWVGLIVLVLFVLIYGLCYCLNREAVKTG
FT                   QKILTEQQESMSEKEKGLKRKRKKKGDTVLSGGQKGQNKRAEVEEEGELASVPPPYASS
FT                   AATYRWTFCPEIWRIDSPDGHKVIEVMVSSPRGIVSIPLGIDRIRC"
FT   gene            complement(586662..588597)
FT                   /pseudo
FT                   /locus_tag="mCG_51947"
FT                   /note="gene_id=mCG51947.2"
FT   mRNA            complement(586662..588597)
FT                   /pseudo
FT                   /locus_tag="mCG_51947"
FT                   /note="gene_id=mCG51947.2 transcript_id=mCT52130.2 created
FT                   on 15-MAY-2002"
FT   gene            complement(662288..663653)
FT                   /pseudo
FT                   /locus_tag="mCG_51946"
FT                   /note="gene_id=mCG51946.2"
FT   mRNA            complement(662288..663653)
FT                   /pseudo
FT                   /locus_tag="mCG_51946"
FT                   /note="gene_id=mCG51946.2 transcript_id=mCT52129.2 created
FT                   on 15-MAY-2002"
FT   gene            824343..824765
FT                   /pseudo
FT                   /locus_tag="mCG_65750"
FT                   /note="gene_id=mCG65750.1"
FT   mRNA            824343..824765
FT                   /pseudo
FT                   /locus_tag="mCG_65750"
FT                   /note="gene_id=mCG65750.1 transcript_id=mCT65933.1 created
FT                   on 15-MAY-2002"
FT   gene            complement(904382..926167)
FT                   /locus_tag="mCG_1050960"
FT                   /note="gene_id=mCG1050960.0"
FT   mRNA            complement(join(904382..904482,904520..904648,
FT                   917458..917669,926065..926167))
FT                   /locus_tag="mCG_1050960"
FT                   /product="mCG1050960"
FT                   /note="gene_id=mCG1050960.0 transcript_id=mCT194749.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(904547..904630)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050960"
FT                   /product="mCG1050960"
FT                   /note="gene_id=mCG1050960.0 transcript_id=mCT194749.0
FT                   protein_id=mCP115778.0"
FT                   /protein_id="EDL07814.1"
FT                   /translation="MISDYEERLPQQEPADRTSKQFLKWLR"
FT   gene            complement(937804..>1075711)
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /note="gene_id=mCG140314.1"
FT   mRNA            complement(join(937804..939307,941771..941856,
FT                   942972..943034,962383..962459,998332..998477,
FT                   1045006..1045126,1067969..1068115,1071001..1071142,
FT                   1072884..1073110,1074972..1075706))
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /product="myeloid ecotropic viral integration site 1,
FT                   transcript variant mCT168949"
FT                   /note="gene_id=mCG140314.1 transcript_id=mCT168949.0
FT                   created on 15-MAY-2002"
FT   mRNA            complement(join(937804..939307,941771..941856,
FT                   942972..943034,962383..962459,998332..998477,
FT                   1045015..1045126,1067969..1068115,1069561..1069611,
FT                   1070383..1070433,1071001..1071142,1072884..1073110,
FT                   1074972..>1075423))
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /product="myeloid ecotropic viral integration site 1,
FT                   transcript variant mCT190011"
FT                   /note="gene_id=mCG140314.1 transcript_id=mCT190011.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(937804..939307,941372..941466,
FT                   941771..941856,942972..943034,962383..962459,
FT                   998332..998477,1045015..1045126,1067969..1068115,
FT                   1069561..1069611,1070383..1070433,1071001..1071142,
FT                   1072884..1073110,1074972..>1075423))
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /product="myeloid ecotropic viral integration site 1,
FT                   transcript variant mCT190013"
FT                   /note="gene_id=mCG140314.1 transcript_id=mCT190013.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(939024..939307,941771..941856,
FT                   942972..943034,962383..962459,998332..998477,
FT                   1045015..1045126,1067969..1068115,1069561..1069611,
FT                   1070383..1070433,1071001..1071142,1072884..1073110,
FT                   1074972..>1075133))
FT                   /codon_start=1
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /product="myeloid ecotropic viral integration site 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG140314.1 transcript_id=mCT190011.0
FT                   protein_id=mCP110998.0 isoform=CRA_a"
FT                   /protein_id="EDL07815.1"
FT                   /translation="FTLLETQRDFFLLLLCFIFFSGGVCIFVSFHTGLKEDILEVEVGR
FT                   EPERPMAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTA
FT                   HTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCS
FT                   SESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHR
FT                   YISCLKGKMPIDLVIDDREGGSKSDSEDVTRSANLTDQPSWNRDHDDTASTRSGGTPGP
FT                   SSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAW
FT                   LFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGNQGTPYN
FT                   PDGQPMGGFVMDGQQHMGIRAPGLQSMPGEYVARGGPMGVSMGQPSYTQAQMPPHPAQL
FT                   RHGPPMHTYIPGHPHHPAVMMHGGQPHPGMPMSASSPSVLNTGDPTMSAQVMDIHAQ"
FT   CDS             complement(join(939024..939307,941771..941856,
FT                   942972..943034,962383..962459,998332..998477,
FT                   1045006..1045126,1067969..1068115,1071001..1071142,
FT                   1072884..1073110,1074972..1074983))
FT                   /codon_start=1
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /product="myeloid ecotropic viral integration site 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG140314.1 transcript_id=mCT168949.0
FT                   protein_id=mCP91723.0 isoform=CRA_d"
FT                   /protein_id="EDL07818.1"
FT                   /translation="MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPL
FT                   HSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREP
FT                   GVAGGDVCSSESFNEDIAVFAKQVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSD
FT                   SEDVTRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGRRGDGLDN
FT                   SVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDT
FT                   GLTILQVNNWFINARRRIVQPMIDQSNRAGNQGTPYNPDGQPMGGFVMDGQQHMGIRAP
FT                   GLQSMPGEYVARGGPMGVSMGQPSYTQAQMPPHPAQLRHGPPMHTYIPGHPHHPAVMMH
FT                   GGQPHPGMPMSASSPSVLNTGDPTMSAQVMDIHAQ"
FT   CDS             complement(join(941408..941466,941771..941856,
FT                   942972..943034,962383..962459,998332..998477,
FT                   1045015..1045126,1067969..1068115,1069561..1069611,
FT                   1070383..1070433,1071001..1071142,1072884..1073110,
FT                   1074972..>1075133))
FT                   /codon_start=1
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /product="myeloid ecotropic viral integration site 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG140314.1 transcript_id=mCT190013.0
FT                   protein_id=mCP111000.0 isoform=CRA_c"
FT                   /protein_id="EDL07817.1"
FT                   /translation="FTLLETQRDFFLLLLCFIFFSGGVCIFVSFHTGLKEDILEVEVGR
FT                   EPERPMAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTA
FT                   HTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCS
FT                   SESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHR
FT                   YISCLKGKMPIDLVIDDREGGSKSDSEDVTRSANLTDQPSWNRDHDDTASTRSGGTPGP
FT                   SSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAW
FT                   LFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGNQGTPYN
FT                   PDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM"
FT   mRNA            complement(join(942005..943034,962383..962459,
FT                   998332..998477,1045015..1045126,1067969..1068115,
FT                   1069561..1069611,1070383..1070433,1071001..1071142,
FT                   1072884..1073110,1074972..>1075711))
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /product="myeloid ecotropic viral integration site 1,
FT                   transcript variant mCT190012"
FT                   /note="gene_id=mCG140314.1 transcript_id=mCT190012.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(942887..943034,962383..962459,
FT                   998332..998477,1045015..1045126,1067969..1068115,
FT                   1069561..1069611,1070383..1070433,1071001..1071142,
FT                   1072884..1073110,1074972..>1075133))
FT                   /codon_start=1
FT                   /gene="Meis1"
FT                   /locus_tag="mCG_140314"
FT                   /product="myeloid ecotropic viral integration site 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG140314.1 transcript_id=mCT190012.0
FT                   protein_id=mCP110999.0 isoform=CRA_b"
FT                   /protein_id="EDL07816.1"
FT                   /translation="FTLLETQRDFFLLLLCFIFFSGGVCIFVSFHTGLKEDILEVEVGR
FT                   EPERPMAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTA
FT                   HTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCS
FT                   SESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHR
FT                   YISCLKGKMPIDLVIDDREGGSKSDSEDVTRSANLTDQPSWNRDHDDTASTRSGGTPGP
FT                   SSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAW
FT                   LFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGKSPLVTV
FT                   FKSGKRKASSSHSPGGLLPGK"
FT   gene            complement(954219..956750)
FT                   /locus_tag="mCG_147222"
FT                   /note="gene_id=mCG147222.0"
FT   mRNA            complement(join(954219..955083,955101..956750))
FT                   /locus_tag="mCG_147222"
FT                   /product="mCG147222"
FT                   /note="gene_id=mCG147222.0 transcript_id=mCT187485.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(954999..955083,955101..955207))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147222"
FT                   /product="mCG147222"
FT                   /note="gene_id=mCG147222.0 transcript_id=mCT187485.0
FT                   protein_id=mCP108857.0"
FT                   /protein_id="EDL07819.1"
FT                   /translation="MYSNLSMLFLIFSKELCKGKETQLRGAVKLCKASQLLRSLLVKSA
FT                   LSVFTYSLPSWYFLLAPT"
FT   gene            <1122088..1132649
FT                   /locus_tag="mCG_1030867"
FT                   /note="gene_id=mCG1030867.0"
FT   mRNA            join(<1122088..1122908,1123722..1123853,1125314..1125462,
FT                   1130319..1130440,1132457..1132649)
FT                   /locus_tag="mCG_1030867"
FT                   /product="mCG1030867, transcript variant mCT180184"
FT                   /note="gene_id=mCG1030867.0 transcript_id=mCT180184.0
FT                   created on 14-FEB-2003"
FT   mRNA            join(<1122088..1122908,1123722..1123844,1125314..1125462,
FT                   1130319..1130440,1132457..1132649)
FT                   /locus_tag="mCG_1030867"
FT                   /product="mCG1030867, transcript variant mCT148571"
FT                   /note="gene_id=mCG1030867.0 transcript_id=mCT148571.0
FT                   created on 14-FEB-2003"
FT   CDS             <1122483..1122785
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030867"
FT                   /product="mCG1030867, isoform CRA_a"
FT                   /note="gene_id=mCG1030867.0 transcript_id=mCT148571.0
FT                   protein_id=mCP71479.0 isoform=CRA_a"
FT                   /protein_id="EDL07820.1"
FT                   /translation="RSCLLQQMATHRDLLPNNLQRVKNLGTLSPQSDASIKSLSLWLKE
FT                   LCGRGGRKSVRAEEMEDTKQSRPSGHNRAEAHRISQYQSSMNRTCLSLQPDGVYS"
FT   CDS             <1122483..1122785
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030867"
FT                   /product="mCG1030867, isoform CRA_a"
FT                   /note="gene_id=mCG1030867.0 transcript_id=mCT180184.0
FT                   protein_id=mCP103106.0 isoform=CRA_a"
FT                   /protein_id="EDL07821.1"
FT                   /translation="RSCLLQQMATHRDLLPNNLQRVKNLGTLSPQSDASIKSLSLWLKE
FT                   LCGRGGRKSVRAEEMEDTKQSRPSGHNRAEAHRISQYQSSMNRTCLSLQPDGVYS"
FT   gene            1440236..1441492
FT                   /pseudo
FT                   /locus_tag="mCG_53602"
FT                   /note="gene_id=mCG53602.2"
FT   mRNA            1440236..1441492
FT                   /pseudo
FT                   /locus_tag="mCG_53602"
FT                   /note="gene_id=mCG53602.2 transcript_id=mCT53785.2 created
FT                   on 15-MAY-2002"
FT   gene            1766143..1767369
FT                   /pseudo
FT                   /locus_tag="mCG_21767"
FT                   /note="gene_id=mCG21767.2"
FT   mRNA            1766143..1767369
FT                   /pseudo
FT                   /locus_tag="mCG_21767"
FT                   /note="gene_id=mCG21767.2 transcript_id=mCT20791.2 created
FT                   on 15-MAY-2002"
FT   gene            complement(1795246..1795596)
FT                   /pseudo
FT                   /locus_tag="mCG_1030878"
FT                   /note="gene_id=mCG1030878.1"
FT   mRNA            complement(1795246..1795596)
FT                   /pseudo
FT                   /locus_tag="mCG_1030878"
FT                   /note="gene_id=mCG1030878.1 transcript_id=mCT148582.1
FT                   created on 15-MAY-2002"
FT   gene            1829868..1830607
FT                   /pseudo
FT                   /locus_tag="mCG_1030823"
FT                   /note="gene_id=mCG1030823.1"
FT   mRNA            1829868..1830607
FT                   /pseudo
FT                   /locus_tag="mCG_1030823"
FT                   /note="gene_id=mCG1030823.1 transcript_id=mCT148527.1
FT                   created on 15-MAY-2002"
FT   gene            complement(1902963..>1904211)
FT                   /locus_tag="mCG_66665"
FT                   /note="gene_id=mCG66665.1"
FT   mRNA            complement(join(1902963..1903111,1903938..>1904211))
FT                   /locus_tag="mCG_66665"
FT                   /product="mCG66665"
FT                   /note="gene_id=mCG66665.1 transcript_id=mCT66848.1 created
FT                   on 15-MAY-2002"
FT   CDS             complement(1904000..>1904209)
FT                   /codon_start=1
FT                   /locus_tag="mCG_66665"
FT                   /product="mCG66665"
FT                   /note="gene_id=mCG66665.1 transcript_id=mCT66848.1
FT                   protein_id=mCP36005.1"
FT                   /protein_id="EDL07822.1"
FT                   /translation="LLIAVYSANFRLHLSRHLTRHAASANQGGRGMSPPNMDLFKPPAS
FT                   WCTCAALTMVVAYFQVYEEVRCKS"
FT   gene            <1909983..1910477
FT                   /locus_tag="mCG_1030838"
FT                   /note="gene_id=mCG1030838.1"
FT   mRNA            <1909983..1910477
FT                   /locus_tag="mCG_1030838"
FT                   /product="mCG1030838"
FT                   /note="gene_id=mCG1030838.1 transcript_id=mCT148542.1
FT                   created on 15-MAY-2002"
FT   CDS             <1910219..1910377
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030838"
FT                   /product="mCG1030838"
FT                   /note="gene_id=mCG1030838.1 transcript_id=mCT148542.1
FT                   protein_id=mCP71444.1"
FT                   /protein_id="EDL07823.1"
FT                   /translation="GQSHPAQRMASGTQASSLELQGEAHKEGRPSQSGTVGAGPTGTSL
FT                   TEEVPCA"
FT   gene            <1950595..1951765
FT                   /locus_tag="mCG_1030839"
FT                   /note="gene_id=mCG1030839.0"
FT   mRNA            join(<1950595..1950634,1951504..1951598,1951658..1951765)
FT                   /locus_tag="mCG_1030839"
FT                   /product="mCG1030839"
FT                   /note="gene_id=mCG1030839.0 transcript_id=mCT148543.0
FT                   created on 15-MAY-2002"
FT   CDS             join(<1950596..1950634,1951504..1951598,1951658..1951751)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030839"
FT                   /product="mCG1030839"
FT                   /note="gene_id=mCG1030839.0 transcript_id=mCT148543.0
FT                   protein_id=mCP71445.0"
FT                   /protein_id="EDL07824.1"
FT                   /translation="FLLCFFFCFKCLSVSVAGRSSSQWLQCKFPLSLGKCTTLFRGVWG
FT                   EWEEVGTVWWGWLLFIFLNSFPGDGIFFLK"
FT   gene            2043502..2067595
FT                   /gene="Spred2"
FT                   /locus_tag="mCG_11065"
FT                   /note="gene_id=mCG11065.2"
FT   mRNA            join(2043502..2043679,2050792..2050982,2063300..2063492,
FT                   2066094..2067595)
FT                   /gene="Spred2"
FT                   /locus_tag="mCG_11065"
FT                   /product="sprouty-related, EVH1 domain containing 2"
FT                   /note="gene_id=mCG11065.2 transcript_id=mCT11238.2 created
FT                   on 15-MAY-2002"
FT   CDS             join(2043536..2043679,2050792..2050982,2063300)
FT                   /codon_start=1
FT                   /gene="Spred2"
FT                   /locus_tag="mCG_11065"
FT                   /product="sprouty-related, EVH1 domain containing 2"
FT                   /note="gene_id=mCG11065.2 transcript_id=mCT11238.2
FT                   protein_id=mCP15016.2"
FT                   /protein_id="EDL07825.1"
FT                   /translation="MTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQK
FT                   DKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIEDLIE
FT                   GTEFAVT"
FT   gene            complement(2108146..2163124)
FT                   /gene="Actr2"
FT                   /locus_tag="mCG_122263"
FT                   /note="gene_id=mCG122263.0"
FT   mRNA            complement(join(2108146..2110703,2118083..2118215,
FT                   2123071..2123216,2125906..2126055,2126545..2126681,
FT                   2141306..2141378,2144215..2144430,2150808..2150918,
FT                   2163014..2163124))
FT                   /gene="Actr2"
FT                   /locus_tag="mCG_122263"
FT                   /product="ARP2 actin-related protein 2 homolog (yeast)"
FT                   /note="gene_id=mCG122263.0 transcript_id=mCT123480.0
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(2110533..2110703,2118083..2118215,
FT                   2123071..2123216,2125906..2126055,2126545..2126681,
FT                   2141306..2141378,2144215..2144430,2150808..2150918,
FT                   2163014..2163061))
FT                   /codon_start=1
FT                   /gene="Actr2"
FT                   /locus_tag="mCG_122263"
FT                   /product="ARP2 actin-related protein 2 homolog (yeast)"
FT                   /note="gene_id=mCG122263.0 transcript_id=mCT123480.0
FT                   protein_id=mCP71411.1"
FT                   /db_xref="GOA:Q5SW83"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="MGI:MGI:1913963"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SW83"
FT                   /protein_id="EDL07826.1"
FT                   /translation="MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTT
FT                   KVGNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRN
FT                   CKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGV
FT                   THICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCY
FT                   VGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAEL
FT                   LFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKF
FT                   KIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR"
FT   gene            complement(2164585..>2165671)
FT                   /locus_tag="mCG_1030824"
FT                   /note="gene_id=mCG1030824.1"
FT   mRNA            complement(2164585..>2165671)
FT                   /locus_tag="mCG_1030824"
FT                   /product="mCG1030824"
FT                   /note="gene_id=mCG1030824.1 transcript_id=mCT148528.1
FT                   created on 16-MAY-2002"
FT   CDS             complement(2165120..>2165317)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030824"
FT                   /product="mCG1030824"
FT                   /note="gene_id=mCG1030824.1 transcript_id=mCT148528.1
FT                   protein_id=mCP71513.1"
FT                   /protein_id="EDL07827.1"
FT                   /translation="LIWERRTWVHLWGCVVKGSLAPATEEKDGARVLSPPSLYRCTWYC
FT                   LCALEKARGGFHSLRMSVCE"
FT   gene            complement(2188152..>2190169)
FT                   /locus_tag="mCG_1030881"
FT                   /note="gene_id=mCG1030881.0"
FT   mRNA            complement(join(2188152..2188338,2189430..2189506,
FT                   2190084..>2190169))
FT                   /locus_tag="mCG_1030881"
FT                   /product="mCG1030881"
FT                   /note="gene_id=mCG1030881.0 transcript_id=mCT148585.0
FT                   created on 16-MAY-2002"
FT   CDS             complement(join(2188180..2188338,2189430..2189506,
FT                   2190084..>2190120))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030881"
FT                   /product="mCG1030881"
FT                   /note="gene_id=mCG1030881.0 transcript_id=mCT148585.0
FT                   protein_id=mCP71471.0"
FT                   /protein_id="EDL07828.1"
FT                   /translation="VGVSPLGSFSLQSIYSLKTTPIQRLLLLRSAKPAFFIQDPKLMKQ
FT                   CHLHSEKVFLPQLILEPSSQTFPGLCLWVILDPVTLIVNINHYSV"
FT   gene            2254291..2279887
FT                   /gene="Rab1"
FT                   /locus_tag="mCG_11056"
FT                   /note="gene_id=mCG11056.2"
FT   mRNA            join(2254291..2254687,2268667..2268739,2271846..2271941,
FT                   2276116..2276211,2277399..2277530,2277680..2279887)
FT                   /gene="Rab1"
FT                   /locus_tag="mCG_11056"
FT                   /product="RAB1, member RAS oncogene family, transcript
FT                   variant mCT11229"
FT                   /note="gene_id=mCG11056.2 transcript_id=mCT11229.1 created
FT                   on 12-FEB-2003"
FT   mRNA            join(2254490..2254687,2268667..2268739,2276116..2276211,
FT                   2277399..2277530,2277680..2277921)
FT                   /gene="Rab1"
FT                   /locus_tag="mCG_11056"
FT                   /product="RAB1, member RAS oncogene family, transcript
FT                   variant mCT180086"
FT                   /note="gene_id=mCG11056.2 transcript_id=mCT180086.0 created
FT                   on 12-FEB-2003"
FT   mRNA            join(2254644..2254687,2268667..2268739,2271846..2271941,
FT                   2276116..2276604)
FT                   /gene="Rab1"
FT                   /locus_tag="mCG_11056"
FT                   /product="RAB1, member RAS oncogene family, transcript
FT                   variant mCT180087"
FT                   /note="gene_id=mCG11056.2 transcript_id=mCT180087.0 created
FT                   on 12-FEB-2003"
FT   CDS             join(2254665..2254687,2268667..2268739,2271846..2271941,
FT                   2276116..2276211,2277399..2277530,2277680..2277877)
FT                   /codon_start=1
FT                   /gene="Rab1"
FT                   /locus_tag="mCG_11056"
FT                   /product="RAB1, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG11056.2 transcript_id=mCT11229.1
FT                   protein_id=mCP15020.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q0PD67"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:97842"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD67"
FT                   /protein_id="EDL07829.1"
FT                   /translation="MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIG
FT                   VDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQ
FT                   WLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQ
FT                   SFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC"
FT   CDS             join(2254665..2254687,2268667..2268739,2276116..2276211,
FT                   2277399..2277530,2277680..2277877)
FT                   /codon_start=1
FT                   /gene="Rab1"
FT                   /locus_tag="mCG_11056"
FT                   /product="RAB1, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG11056.2 transcript_id=mCT180086.0
FT                   protein_id=mCP103009.0 isoform=CRA_b"
FT                   /protein_id="EDL07830.1"
FT                   /translation="MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFAWDTAGQERFRTIT
FT                   SSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDY
FT                   TTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQST
FT                   PVKQSGGGCC"
FT   CDS             join(2254665..2254687,2268667..2268739,2271846..2271941,
FT                   2276116..2276223)
FT                   /codon_start=1
FT                   /gene="Rab1"
FT                   /locus_tag="mCG_11056"
FT                   /product="RAB1, member RAS oncogene family, isoform CRA_c"
FT                   /note="gene_id=mCG11056.2 transcript_id=mCT180087.0
FT                   protein_id=mCP103008.0 isoform=CRA_c"
FT                   /protein_id="EDL07831.1"
FT                   /translation="MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIG
FT                   VDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQVSF"
FT   gene            complement(2281538..>2302446)
FT                   /gene="Cep68"
FT                   /locus_tag="mCG_11058"
FT                   /note="gene_id=mCG11058.3"
FT   mRNA            complement(join(2281538..2282513,2283456..2283626,
FT                   2289039..2289135,2291490..2291612,2292220..2293722,
FT                   2294909..2295261,2302334..>2302446))
FT                   /gene="Cep68"
FT                   /locus_tag="mCG_11058"
FT                   /product="centrosomal protein 68, transcript variant
FT                   mCT190004"
FT                   /note="gene_id=mCG11058.3 transcript_id=mCT190004.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(2281544..2282513,2283467..2283626,
FT                   2289039..2289135,2291445..2291612,2292220..2293722,
FT                   2294909..2295261,2302334..2302434))
FT                   /gene="Cep68"
FT                   /locus_tag="mCG_11058"
FT                   /product="centrosomal protein 68, transcript variant
FT                   mCT11235"
FT                   /note="gene_id=mCG11058.3 transcript_id=mCT11235.2 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(2283460..2283626,2289039..2289135,
FT                   2291490..2291612,2292220..2293722,2294909..>2295253))
FT                   /codon_start=1
FT                   /gene="Cep68"
FT                   /locus_tag="mCG_11058"
FT                   /product="centrosomal protein 68, isoform CRA_b"
FT                   /note="gene_id=mCG11058.3 transcript_id=mCT190004.0
FT                   protein_id=mCP110993.0 isoform=CRA_b"
FT                   /protein_id="EDL07833.1"
FT                   /translation="RLQRKPDRGGSMALSEDEAEAEVSVNTKVPSCGRWNSGKLLPSGL
FT                   EPDQPLHLGVEGGPLWRAEADPGCISGVFLSRVHTASKEPVADRSKPPLRGPLPSASVG
FT                   TGEVLHSMGSQMEEDRLPASQDLLPALQVFGTITVCSGQEADSEDFQATLDPSQVLGLS
FT                   QQPHTSGLPLPPQWKSTVSPGAPQLSSRSISASSVGSSLQDHQEKAGPQRASFANVSSP
FT                   ELTVPQAAHSVVGAGPPLQGSAQPLTSGSDATGLGKRHLSFQAEYWACALPNSLPPSPN
FT                   RHSALWDPNKEYEDLLDYTYPLRPGPQLPKQPESHVLTEPVLQDSGVDLDSLSVSPAST
FT                   LKSPTNVSHNCSSAEVPTLPFSGARESCLKRWPLGIFQKQGGTSLSSWNQLASTPRAPG
FT                   TEDASWENREAALRGTAEDCLPIGEDLRMGSPQLKTKEKEPPFPRQKRGRQHVSCPACV
FT                   TPGWPSEEEVGSDEEYLALPTRLTQVSSLVSYSGARPSFVNLHTGAAEEHSSLQVSDSD
FT                   KPASPTLDSSHRKHPSGTSFQGPVGQNPCFRHSIQPQDSRGKSSLMSNQTLGVSSKPLK
FT                   TQPASKAMTDRRLFSELVAGETLPRTTDEQEKASLVQCVQTFCCRLEELICWLYNVTDV
FT                   ADLSAPPRTSLTGLKSSLQLYRQFKKDVDEHQSLTESVLEKGEILLQCLLDNTPVLKDV
FT                   LERIAKQSGELESRADHLYDSILASLDMLAGCTLIPDNRPTAAEHPHEGL"
FT   CDS             complement(join(2291445..2291612,2292220..2293722,
FT                   2294909..2295220))
FT                   /codon_start=1
FT                   /gene="Cep68"
FT                   /locus_tag="mCG_11058"
FT                   /product="centrosomal protein 68, isoform CRA_a"
FT                   /note="gene_id=mCG11058.3 transcript_id=mCT11235.2
FT                   protein_id=mCP15025.2 isoform=CRA_a"
FT                   /protein_id="EDL07832.1"
FT                   /translation="MALSEDEAEAEVSVNTKVPSCGRWNSGKLLPSGLEPDQPLHLGVE
FT                   GGPLWRAEADPGCISGVFLSRVHTASKEPVADRSKPPLRGPLPSASVGTGEVLHSMGSQ
FT                   MEEDRLPASQDLLPALQVFGTITVCSGQEADSEDFQATLDPSQVLGLSQQPHTSGLPLP
FT                   PQWKSTVSPGAPQLSSRSISASSVGSSLQDHQEKAGPQRASFANVSSPELTVPQAAHSV
FT                   VGAGPPLQGSAQPLTSGSDATGLGKRHLSFQAEYWACALPNSLPPSPNRHSALWDPNKE
FT                   YEDLLDYTYPLRPGPQLPKQPESHVLTEPVLQDSGVDLDSLSVSPASTLKSPTNVSHNC
FT                   SSAEVPTLPFSGARESCLKRWPLGIFQKQGGTSLSSWNQLASTPRAPGTEDASWENREA
FT                   ALRGTAEDCLPIGEDLRMGSPQLKTKEKEPPFPRQKRGRQHVSCPACVTPGWPSEEEVG
FT                   SDEEYLALPTRLTQVSSLVSYSGARPSFVNLHTGAAEEHSSLQVSDSDKPASPTLDSSH
FT                   RKHPSGTSFQGPVGQNPCFRHSIQPQDSRGKSSLMSNQTLGVSSKPLKTQPASKAMTDR
FT                   RLFSELVAGETLPRTTDEQEKASLVQCVQTFCCRLEELICWLYNVTDVADLSAPPRTSL
FT                   TGLKSSLQLYRVICSPGLFIHGDGS"
FT   gene            complement(2343063..2343384)
FT                   /pseudo
FT                   /locus_tag="mCG_48976"
FT                   /note="gene_id=mCG48976.3"
FT   mRNA            complement(2343063..2343384)
FT                   /pseudo
FT                   /locus_tag="mCG_48976"
FT                   /note="gene_id=mCG48976.3 transcript_id=mCT49159.3 created
FT                   on 03-JUN-2003"
FT   gene            complement(2355208..2386090)
FT                   /gene="Slc1a4"
FT                   /locus_tag="mCG_11066"
FT                   /note="gene_id=mCG11066.1"
FT   mRNA            complement(join(2355208..2357501,2360642..2360776,
FT                   2362068..2362262,2362580..2362813,2367168..2367334,
FT                   2371912..2371974,2373444..2373486,2385452..2386090))
FT                   /gene="Slc1a4"
FT                   /locus_tag="mCG_11066"
FT                   /product="solute carrier family 1 (glutamate/neutral amino
FT                   acid transporter), member 4"
FT                   /note="gene_id=mCG11066.1 transcript_id=mCT11239.1 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(2357267..2357501,2360642..2360776,
FT                   2362068..2362262,2362580..2362813,2367168..2367334,
FT                   2371912..2371974,2373444..2373486,2385452..2385978))
FT                   /codon_start=1
FT                   /gene="Slc1a4"
FT                   /locus_tag="mCG_11066"
FT                   /product="solute carrier family 1 (glutamate/neutral amino
FT                   acid transporter), member 4"
FT                   /note="gene_id=mCG11066.1 transcript_id=mCT11239.1
FT                   protein_id=mCP15019.1"
FT                   /db_xref="GOA:Q3UTP8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="MGI:MGI:2135601"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UTP8"
FT                   /protein_id="EDL07834.1"
FT                   /translation="MEKSGETNGYLDGTQAEPAAGPRTPETAMGKSQRCASFFRRHALV
FT                   LLTVSGVLVGAGMGAALRGLQLTRTQITYLAFPGEMLLRMLRMIILPLVVCSLVSGAAS
FT                   LDASSLGRLGGIAVAYFGLTTLSASALAVALAFIIKPGAGAQTLQSSSLGLENSGPPPV
FT                   SKETVDSFLDLLRNLFPSNLVVAAFTTSATDYTVVTHNTSSGNVTKEKIPVVTDVEGMN
FT                   ILGLVLFALVLGVALKKLGPEGEDLIRFFNSFNEATMVLVSWIMWYVPIGIMFLIGSKI
FT                   VEMKDIVMLVTSLGKYIFASMLGHVIHGGIVLPLVYFAFTRKNPFTFLLGLLTPFATAF
FT                   ATCSSSATLPSMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNV
FT                   DLNAGQIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLSLILAVDWIVDRT
FT                   TTVVNVEGDALGAGILNHLNQKVVKKGEQELQEVKVEAIPNSKSEEETSPLVTHQNPAG
FT                   PVAIAPELESKESVL"
FT   gene            <2386404..2387744
FT                   /locus_tag="mCG_1030883"
FT                   /note="gene_id=mCG1030883.0"
FT   mRNA            join(<2386404..2386575,2387459..2387744)
FT                   /locus_tag="mCG_1030883"
FT                   /product="mCG1030883"
FT                   /note="gene_id=mCG1030883.0 transcript_id=mCT148587.0
FT                   created on 16-MAY-2002"
FT   CDS             join(<2386444..2386575,2387459..2387572)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030883"
FT                   /product="mCG1030883"
FT                   /note="gene_id=mCG1030883.0 transcript_id=mCT148587.0
FT                   protein_id=mCP71477.0"
FT                   /protein_id="EDL07835.1"
FT                   /translation="GHRPILSPGSFQSYCPGLGERGRGASGTPRQFFSSAGGGGEPSEN
FT                   MVYLSVQGWMIPTDPCSSFPGSSASFFLSCCFYAKD"
FT   gene            complement(2388340..2389392)
FT                   /pseudo
FT                   /locus_tag="mCG_1030816"
FT                   /note="gene_id=mCG1030816.2"
FT   mRNA            complement(join(2388340..2388563,2388601..2389392))
FT                   /pseudo
FT                   /locus_tag="mCG_1030816"
FT                   /note="gene_id=mCG1030816.2 transcript_id=mCT148520.2
FT                   created on 26-JUN-2003"
FT   gene            2502510..2502957
FT                   /pseudo
FT                   /locus_tag="mCG_11064"
FT                   /note="gene_id=mCG11064.1"
FT   mRNA            2502510..2502957
FT                   /pseudo
FT                   /locus_tag="mCG_11064"
FT                   /note="gene_id=mCG11064.1 transcript_id=mCT11233.2 created
FT                   on 16-MAY-2002"
FT   gene            <2585605..2594791
FT                   /locus_tag="mCG_1030842"
FT                   /note="gene_id=mCG1030842.0"
FT   mRNA            join(<2585605..2585857,2594028..2594791)
FT                   /locus_tag="mCG_1030842"
FT                   /product="mCG1030842"
FT                   /note="gene_id=mCG1030842.0 transcript_id=mCT148546.1
FT                   created on 30-MAY-2002"
FT   CDS             <2594195..2594629
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030842"
FT                   /product="mCG1030842"
FT                   /note="gene_id=mCG1030842.0 transcript_id=mCT148546.1
FT                   protein_id=mCP71458.0"
FT                   /protein_id="EDL07836.1"
FT                   /translation="SRPSRRYALPLGSLAALPPRPPPPSRLSPAPYPARLAAPSRSSWA
FT                   GTALGLFKVCESLHNLSIQLNVLSEPSGRCSPPPAAPALGAPLSMAGWLYSSRCALFPH
FT                   LASLGNFPSASLCPQAATAWARPRAASCRLPSSPCAVSPL"
FT   gene            complement(2626999..2627636)
FT                   /pseudo
FT                   /locus_tag="mCG_49686"
FT                   /note="gene_id=mCG49686.1"
FT   mRNA            complement(2626999..2627636)
FT                   /pseudo
FT                   /locus_tag="mCG_49686"
FT                   /note="gene_id=mCG49686.1 transcript_id=mCT49869.1 created
FT                   on 16-MAY-2002"
FT   gene            2697618..2698927
FT                   /locus_tag="mCG_122245"
FT                   /note="gene_id=mCG122245.0"
FT   mRNA            2697618..2698927
FT                   /locus_tag="mCG_122245"
FT                   /product="mCG122245"
FT                   /note="gene_id=mCG122245.0 transcript_id=mCT123465.0
FT                   created on 16-MAY-2002"
FT   CDS             2697622..2698551
FT                   /codon_start=1
FT                   /locus_tag="mCG_122245"
FT                   /product="mCG122245"
FT                   /note="gene_id=mCG122245.0 transcript_id=mCT123465.0
FT                   protein_id=mCP71400.1"
FT                   /db_xref="GOA:Q3UGZ1"
FT                   /db_xref="InterPro:IPR009263"
FT                   /db_xref="MGI:MGI:1931026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UGZ1"
FT                   /protein_id="EDL07837.1"
FT                   /translation="MLGKGGKRKFDEHEDGLEGKIVSPSDGPSRVSYTLQRQTIFNISL
FT                   MKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPAFTPSSQPSNSLSDSYQEAP
FT                   PPAPHPCDLGSTTPLEACLTPASLLEDDNDDTFCTLQAVHPAAPTRLSSAALPAEKDSF
FT                   SSALDEIEELCPTSTSTEAAHTAAPEGPKGTSSESSVQKPEGPEEGRTDDSRFMDSLPG
FT                   NFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSASGTASKMAPVSADDLLKTLAPY
FT                   SNQPVAPSQPFKMDLTELDHIMEVLVGS"
FT   gene            complement(2734888..2791372)
FT                   /gene="Aftph"
FT                   /locus_tag="mCG_11057"
FT                   /note="gene_id=mCG11057.2"
FT   mRNA            complement(join(2734888..2735994,2742261..2742384,
FT                   2748102..2748162,2753398..2753520,2758372..2758428,
FT                   2759311..2759437,2761855..2762006,2775371..2777325,
FT                   2791097..>2791292))
FT                   /gene="Aftph"
FT                   /locus_tag="mCG_11057"
FT                   /product="aftiphilin, transcript variant mCT190003"
FT                   /note="gene_id=mCG11057.2 transcript_id=mCT190003.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(2734889..2735994,2742261..2742384,
FT                   2746540..2746710,2748102..2748162,2753398..2753520,
FT                   2758372..2758428,2759311..2759437,2761855..2762006,
FT                   2775371..2777244,2791097..2791372))
FT                   /gene="Aftph"
FT                   /locus_tag="mCG_11057"
FT                   /product="aftiphilin, transcript variant mCT11234"
FT                   /note="gene_id=mCG11057.2 transcript_id=mCT11234.1 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(2735847..2735994,2742261..2742384,
FT                   2746540..2746710,2748102..2748162,2753398..2753520,
FT                   2758372..2758428,2759311..2759437,2761855..2762006,
FT                   2775371..2777244,2791097..2791127))
FT                   /codon_start=1
FT                   /gene="Aftph"
FT                   /locus_tag="mCG_11057"
FT                   /product="aftiphilin, isoform CRA_b"
FT                   /note="gene_id=mCG11057.2 transcript_id=mCT11234.1
FT                   protein_id=mCP15023.2 isoform=CRA_b"
FT                   /protein_id="EDL07839.1"
FT                   /translation="MPIAAARDEPDNGAEDDEEDEFGEFGGFSEVSPSGVGFVDFDTPD
FT                   YTRPKEDFVPSNHFMPIHEYSEDVDSLTSFKSVQNGNDKDITAELSTPVKSQSDVVLST
FT                   TSKEMIPSKTLDPSIDGMESLEDLDKVVVQGPSTGQLRSFSPGDFRTDKNIVHQTKQLE
FT                   SCNGEKPPCLEILTNGFAGLETVNPQGTDDLDNVADSKGSKPLNTCGTECILESAASHA
FT                   TEFADFSTFSQTERTQLEEIECPVLNDGDTLTIQGNSKGPRVKELNCVKEVTLDGSFED
FT                   TGNTEREHQVCVSEIHAVADRGLSVEKQDLQTLQQDEFLNSRIQSEAWSLVDSSENSEA
FT                   ITKERCKMEKNDLFASKCADLSMDSVKTSDVNEIGSSKEENRKLTNPKSPDPDPTGQNA
FT                   LDDSAASMKNGDSGNGFVTCHDTNEDDFGDFGTANGTTPPFVTSTQDSMSDVTFEDSSE
FT                   HFLHLSEPGDDFGEFEDTNAVSCQEEMRFTESDLRQTSDGLSEECPLAGESGGKDSKPD
FT                   SKLKNGQDSEFGDFDSVPNTQGSAFQDSDDFADFSSAGPSQAVDWNAFEDEQKDGCSWA
FT                   AFGDQQETESHHLKEVWQSQRTDETMGTLGTPKMHSVSSAASKGAVASGHLQEPGTSVQ
FT                   TALLNRLERIFEACFPSVFVPDVEEEVSSLKHLLETHSSPAKTREALADRGELRGVWTE
FT                   LQDIHDAHGLRYQWGGSHSNKKLLCSLGIDTRNILFTGNKKQPVIVPMYAAGLGMLEPT
FT                   KEPLKPLSAAEKIASIGQTTVMTPEINTCTSDPFQESLPPVQFDWSSSGLTNPLDVCVL
FT                   PLFTRNPSSLGLPSVWLPTNTVTEFQASGGSTLLNLDFFGPVDDSSSSSSTIPGVDPEL
FT                   YELTTAKLETSTSSLRVTDAFAKLMSTVEKTSTSTRKPKREEHLSEEAMKVIASLPDLT
FT                   FMHAKVLMFPATLTPSMSSQEQADA"
FT   CDS             complement(join(2735847..2735994,2742261..2742384,
FT                   2748102..2748162,2753398..2753520,2758372..2758428,
FT                   2759311..2759437,2761855..2762006,2775371..>2777314))
FT                   /codon_start=1
FT                   /gene="Aftph"
FT                   /locus_tag="mCG_11057"
FT                   /product="aftiphilin, isoform CRA_a"
FT                   /note="gene_id=mCG11057.2 transcript_id=mCT190003.0
FT                   protein_id=mCP110992.0 isoform=CRA_a"
FT                   /protein_id="EDL07838.1"
FT                   /translation="LLESCGIMEPDIIRMYSSSPPPLDNGAEDDEEDEFGEFGGFSEVS
FT                   PSGVGFVDFDTPDYTRPKEDFVPSNHFMPIHEYSEDVDSLTSFKSVQNGNDKDITAELS
FT                   TPVKSQSDVVLSTTSKEMIPSKTLDPSIDGMESLEDLDKVVVQGPSTGQLRSFSPGDFR
FT                   TDKNIVHQTKQLESCNGEKPPCLEILTNGFAGLETVNPQGTDDLDNVADSKGSKPLNTC
FT                   GTECILESAASHATEFADFSTFSQTERTQLEEIECPVLNDGDTLTIQGNSKGPRVKELN
FT                   CVKEVTLDGSFEDTGNTEREHQVCVSEIHAVADRGLSVEKQDLQTLQQDEFLNSRIQSE
FT                   AWSLVDSSENSEAITKERCKMEKNDLFASKCADLSMDSVKTSDVNEIGSSKEENRKLTN
FT                   PKSPDPDPTGQNALDDSAASMKNGDSGNGFVTCHDTNEDDFGDFGTANGTTPPFVTSTQ
FT                   DSMSDVTFEDSSEHFLHLSEPGDDFGEFEDTNAVSCQEEMRFTESDLRQTSDGLSEECP
FT                   LAGESGGKDSKPDSKLKNGQDSEFGDFDSVPNTQGSAFQDSDDFADFSSAGPSQAVDWN
FT                   AFEDEQKDGCSWAAFGDQQETESHHLKEVWQSQRTDETMGTLGTPKMHSVSSAASKGAV
FT                   ASGHLQEPGTSVQTALLNRLERIFEACFPSVFVPDVEEEVSSLKHLLETHSSPAKTREA
FT                   LADRGELRGVWTELQDIHDAHGLRYQWGGSHSNKKLLCSLGIDTRNILFTGNKKQPVIV
FT                   PMYAAGLGMLEPTKEPLKPLSAAEKIASIGQTTVMTPEINTCTSDPFQESLPPVQFDWS
FT                   SSGLTNPLDGVDPELYELTTAKLETSTSSLRVTDAFAKLMSTVEKTSTSTRKPKREEHL
FT                   SEEAMKVIASLPDLTFMHAKVLMFPATLTPSMSSQEQADA"
FT   gene            complement(2874034..2881917)
FT                   /gene="1110067D22Rik"
FT                   /locus_tag="mCG_11063"
FT                   /note="gene_id=mCG11063.1"
FT   mRNA            complement(join(2874034..2876552,2876570..2877193,
FT                   2879949..2880126,2880718..2880806,2880956..2881027,
FT                   2881654..2881704,2881851..2881917))
FT                   /gene="1110067D22Rik"
FT                   /locus_tag="mCG_11063"
FT                   /product="RIKEN cDNA 1110067D22, transcript variant
FT                   mCT11237"
FT                   /note="gene_id=mCG11063.1 transcript_id=mCT11237.2 created
FT                   on 16-MAY-2002"
FT   mRNA            complement(join(2874257..2877193,2879949..2880126,
FT                   2880718..2880806,2880956..2881027,2881654..>2881704))
FT                   /gene="1110067D22Rik"
FT                   /locus_tag="mCG_11063"
FT                   /product="RIKEN cDNA 1110067D22, transcript variant
FT                   mCT190020"
FT                   /note="gene_id=mCG11063.1 transcript_id=mCT190020.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2877050..2877193,2879949..2880126,
FT                   2880718..2880806,2880956..2881027,2881654..>2881704))
FT                   /codon_start=1
FT                   /gene="1110067D22Rik"
FT                   /locus_tag="mCG_11063"
FT                   /product="RIKEN cDNA 1110067D22, isoform CRA_a"
FT                   /note="gene_id=mCG11063.1 transcript_id=mCT190020.0
FT                   protein_id=mCP110994.0 isoform=CRA_a"
FT                   /protein_id="EDL07840.1"
FT                   /translation="ARCRNMAGSVADSDAVVKLDDGHLNNSLGSPVQADVYFPRLIVPF
FT                   CGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRN
FT                   SCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAID
FT                   TIKINGDLQITKLG"
FT   CDS             complement(join(2877050..2877193,2879949..2880126,
FT                   2880718..2880806,2880956..2881027,2881654..2881689))
FT                   /codon_start=1
FT                   /gene="1110067D22Rik"
FT                   /locus_tag="mCG_11063"
FT                   /product="RIKEN cDNA 1110067D22, isoform CRA_b"
FT                   /note="gene_id=mCG11063.1 transcript_id=mCT11237.2
FT                   protein_id=mCP15015.2 isoform=CRA_b"
FT                   /protein_id="EDL07841.1"
FT                   /translation="MAGSVADSDAVVKLDDGHLNNSLGSPVQADVYFPRLIVPFCGHIK
FT                   GGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISG
FT                   ERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKIN
FT                   GDLQITKLG"
FT   gene            3187376..3202230
FT                   /gene="Peli1"
FT                   /locus_tag="mCG_3241"
FT                   /note="gene_id=mCG3241.1"
FT   mRNA            join(3187376..3188092,3192471..3192600,3194463..3194564,
FT                   3198822..3199019,3199165..3199353,3199864..3202230)
FT                   /gene="Peli1"
FT                   /locus_tag="mCG_3241"
FT                   /product="pellino 1"
FT                   /note="gene_id=mCG3241.1 transcript_id=mCT2361.0 created on
FT                   16-MAY-2002"
FT   CDS             join(3188022..3188092,3192471..3192600,3194463..3194564,
FT                   3198822..3199019,3199165..3199353,3199864..3200430)
FT                   /codon_start=1
FT                   /gene="Peli1"
FT                   /locus_tag="mCG_3241"
FT                   /product="pellino 1"
FT                   /note="gene_id=mCG3241.1 transcript_id=mCT2361.0
FT                   protein_id=mCP3623.1"
FT                   /db_xref="GOA:Q5SRW7"
FT                   /db_xref="InterPro:IPR006800"
FT                   /db_xref="MGI:MGI:1914495"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SRW7"
FT                   /protein_id="EDL07842.1"
FT                   /translation="MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFK
FT                   RPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGR
FT                   STESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERSPPFTARIYAAGFDSSKN
FT                   IFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETR
FT                   SAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQ
FT                   CPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVG
FT                   PYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCA
FT                   HQLAGEQGYIRLIFQGPLD"
FT   gene            3279739..3280291
FT                   /pseudo
FT                   /locus_tag="mCG_1030845"
FT                   /note="gene_id=mCG1030845.1"
FT   mRNA            3279739..3280291
FT                   /pseudo
FT                   /locus_tag="mCG_1030845"
FT                   /note="gene_id=mCG1030845.1 transcript_id=mCT148549.1
FT                   created on 16-MAY-2002"
FT   gene            complement(3309975..>3310688)
FT                   /locus_tag="mCG_1030846"
FT                   /note="gene_id=mCG1030846.1"
FT   mRNA            complement(3309975..>3310688)
FT                   /locus_tag="mCG_1030846"
FT                   /product="mCG1030846"
FT                   /note="gene_id=mCG1030846.1 transcript_id=mCT148550.1
FT                   created on 16-MAY-2002"
FT   CDS             complement(3310379..>3310540)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030846"
FT                   /product="mCG1030846"
FT                   /note="gene_id=mCG1030846.1 transcript_id=mCT148550.1
FT                   protein_id=mCP71524.0"
FT                   /protein_id="EDL07843.1"
FT                   /translation="REPPRIEYIDNSWDQQGLHLKFTNLRSQGQGLRVLATVPILVSCI
FT                   VHLPLRPL"
FT   gene            3312309..3373149
FT                   /gene="Vps54"
FT                   /locus_tag="mCG_120824"
FT                   /note="gene_id=mCG120824.0"
FT   mRNA            join(3312309..3312352,3315226..3315381,3316657..3316898,
FT                   3320812..3320890,3323731..3323765,3327025..3327156,
FT                   3329702..3330087,3343060..3343186,3344051..3344158,
FT                   3347368..3347423,3350781..3350877,3352005..3352345,
FT                   3357678..3357807,3358393..3358574,3358936..3359048,
FT                   3360766..3360829,3363104..3363209,3364267..3364354,
FT                   3364878..3364999,3365111..3365191,3366946..3367053,
FT                   3368819..3368913,3371780..3373149)
FT                   /gene="Vps54"
FT                   /locus_tag="mCG_120824"
FT                   /product="vacuolar protein sorting 54 (yeast), transcript
FT                   variant mCT122011"
FT                   /note="gene_id=mCG120824.0 transcript_id=mCT122011.1
FT                   created on 16-MAY-2002"
FT   mRNA            join(<3315223..3315381,3316693..3316898,3320812..3320890,
FT                   3323731..3323765,3327025..3327156,3329702..3330087,
FT                   3343060..3343186,3344051..3344158,3347368..3347423,
FT                   3350781..3350877,3352005..3352345,3357678..3357807,
FT                   3358393..3358574,3358936..3359048,3360766..3360829,
FT                   3363104..3363209,3364267..3364354,3364878..3364999,
FT                   3365111..3365191,3366946..3367053,3368819..3368913,
FT                   3371780..3372321)
FT                   /gene="Vps54"
FT                   /locus_tag="mCG_120824"
FT                   /product="vacuolar protein sorting 54 (yeast), transcript
FT                   variant mCT190021"
FT                   /note="gene_id=mCG120824.0 transcript_id=mCT190021.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3315237..3315381,3316693..3316898,3320812..3320890,
FT                   3323731..3323765,3327025..3327156,3329702..3330087,
FT                   3343060..3343186,3344051..3344158,3347368..3347423,
FT                   3350781..3350877,3352005..3352345,3357678..3357807,
FT                   3358393..3358574,3358936..3359048,3360766..3360829,
FT                   3363104..3363209,3364267..3364354,3364878..3364999,
FT                   3365111..3365191,3366946..3367053,3368819..3368913,
FT                   3371780..3371885)
FT                   /codon_start=1
FT                   /gene="Vps54"
FT                   /locus_tag="mCG_120824"
FT                   /product="vacuolar protein sorting 54 (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG120824.0 transcript_id=mCT190021.0
FT                   protein_id=mCP110995.0 isoform=CRA_a"
FT                   /protein_id="EDL07844.1"
FT                   /translation="FYAMASSHSSSPVPQGSSSDVFFKKEVDPTKHIRPVQSLPDVCPK
FT                   EPTVTDQHRWTVYHSKVNLPAALNDPTLAKRESDFFTKTWGLDFVDTEVIPSLYLPQIS
FT                   KENFIAYQQEISQREKIHERCKNICPPKDTFDRTLLHIHDKSRTDLEQVPKIFMKPDFA
FT                   LDDSLTFNSVLPWSHFNTAGGKGSRDAASSKLLQEKLSHYLDIVEVNIAHQISLRSEAF
FT                   FHAMTSQHELQDYLKKTTQAVKMLRDKIAQIDKVMCEGSLQILRLALTRNNCVKVYNKL
FT                   KLMATVHQTQPTVQVLLSTSEFVGALDLIATTQEVLQQELQGIHSFRHLGSQLCELEKL
FT                   IDKMMIAEFSTYSHSDLNRPLEGECQVLEEERLVSLVFGLLKQRKLNFLEIYGEEMIIT
FT                   AKNIIKERVINKVSQIEEIDTDVVVKLADQMRMLNFPQWIDLLKDIFSKFTVFLQRVKA
FT                   TLNIIHSVVLSVLEKSQRTRELEEIPQQRSAGKDSSLDTDVAYLTHEGWFISDAFSEGE
FT                   PASAAVDTTSQRNTSPHSEPCSSDSVSEPECTTDSSSSKEQTSACAPPGGIEIIVSEDM
FT                   RLTDLELGKLASNIQELLCNASDVCHDRAVKFLMSRAKDGFLEKLNSTEFIALSRLMET
FT                   FIVDTEQICGRKSTSLLGALQSQANKFVNRFHEERRTKLSLLLDNERWKQADVPAEFQD
FT                   LVDSIADGKIALPEKKPVVTEERKPADVLVVEGHQYAVVGTVLLLIRIILEYCQCVDNI
FT                   PSVTTDMLTRLTDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYI
FT                   PVIRAHFEARLPPKQWSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKA
FT                   PVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGG
FT                   PQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR"
FT   CDS             join(3315246..3315381,3316657..3316898,3320812..3320890,
FT                   3323731..3323765,3327025..3327156,3329702..3330087,
FT                   3343060..3343186,3344051..3344158,3347368..3347423,
FT                   3350781..3350877,3352005..3352345,3357678..3357807,
FT                   3358393..3358574,3358936..3359048,3360766..3360829,
FT                   3363104..3363209,3364267..3364354,3364878..3364999,
FT                   3365111..3365191,3366946..3367053,3368819..3368913,
FT                   3371780..3371885)
FT                   /codon_start=1
FT                   /gene="Vps54"
FT                   /locus_tag="mCG_120824"
FT                   /product="vacuolar protein sorting 54 (yeast), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG120824.0 transcript_id=mCT122011.1
FT                   protein_id=mCP71447.1 isoform=CRA_b"
FT                   /protein_id="EDL07845.1"
FT                   /translation="MASSHSSSPVPQGSSSDVFFKKEVDPTKHIRPVQSLPDVCPKEPT
FT                   GDSHTLCVAPSLVTDQHRWTVYHSKVNLPAALNDPTLAKRESDFFTKTWGLDFVDTEVI
FT                   PSLYLPQISKENFIAYQQEISQREKIHERCKNICPPKDTFDRTLLHIHDKSRTDLEQVP
FT                   KIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGSRDAASSKLLQEKLSHYLDIVEVNIAH
FT                   QISLRSEAFFHAMTSQHELQDYLKKTTQAVKMLRDKIAQIDKVMCEGSLQILRLALTRN
FT                   NCVKVYNKLKLMATVHQTQPTVQVLLSTSEFVGALDLIATTQEVLQQELQGIHSFRHLG
FT                   SQLCELEKLIDKMMIAEFSTYSHSDLNRPLEGECQVLEEERLVSLVFGLLKQRKLNFLE
FT                   IYGEEMIITAKNIIKERVINKVSQIEEIDTDVVVKLADQMRMLNFPQWIDLLKDIFSKF
FT                   TVFLQRVKATLNIIHSVVLSVLEKSQRTRELEEIPQQRSAGKDSSLDTDVAYLTHEGWF
FT                   ISDAFSEGEPASAAVDTTSQRNTSPHSEPCSSDSVSEPECTTDSSSSKEQTSACAPPGG
FT                   IEIIVSEDMRLTDLELGKLASNIQELLCNASDVCHDRAVKFLMSRAKDGFLEKLNSTEF
FT                   IALSRLMETFIVDTEQICGRKSTSLLGALQSQANKFVNRFHEERRTKLSLLLDNERWKQ
FT                   ADVPAEFQDLVDSIADGKIALPEKKPVVTEERKPADVLVVEGHQYAVVGTVLLLIRIIL
FT                   EYCQCVDNIPSVTTDMLTRLTDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSR
FT                   CLQLIVHYIPVIRAHFEARLPPKQWSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDK
FT                   LLSKYEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLS
FT                   HLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR"
FT   gene            complement(3372577..>3423216)
FT                   /gene="Ugp2"
FT                   /locus_tag="mCG_3240"
FT                   /note="gene_id=mCG3240.3"
FT   mRNA            complement(join(3372577..3374156,3375226..3375330,
FT                   3380898..3381140,3381752..3381949,3382861..3383158,
FT                   3384443..3384576,3385652..3385837,3405355..3405462,
FT                   3406285..3406412,3422196..3422826))
FT                   /gene="Ugp2"
FT                   /locus_tag="mCG_3240"
FT                   /product="UDP-glucose pyrophosphorylase 2, transcript
FT                   variant mCT2360"
FT                   /note="gene_id=mCG3240.3 transcript_id=mCT2360.2 created on
FT                   24-DEC-2002"
FT   mRNA            complement(join(3373701..3374156,3375226..3375330,
FT                   3380898..3381140,3381752..3381949,3382861..3383158,
FT                   3384443..3384576,3385652..3385837,3405355..3405462,
FT                   3406285..3406412,3423024..>3423216))
FT                   /gene="Ugp2"
FT                   /locus_tag="mCG_3240"
FT                   /product="UDP-glucose pyrophosphorylase 2, transcript
FT                   variant mCT190010"
FT                   /note="gene_id=mCG3240.3 transcript_id=mCT190010.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3374049..3374156,3375226..3375330,
FT                   3380898..3381140,3381752..3381949,3382861..3383158,
FT                   3384443..3384576,3385652..3385837,3405355..3405462,
FT                   3406285..3406412,3423024..>3423027))
FT                   /codon_start=1
FT                   /gene="Ugp2"
FT                   /locus_tag="mCG_3240"
FT                   /product="UDP-glucose pyrophosphorylase 2, isoform CRA_a"
FT                   /note="gene_id=mCG3240.3 transcript_id=mCT190010.0
FT                   protein_id=mCP111006.0 isoform=CRA_a"
FT                   /protein_id="EDL07846.1"
FT                   /translation="EDLSKAMSQDGASQFQEVILQELELSVKKELEKILTTAASHEFEH
FT                   TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLV
FT                   VVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTD
FT                   EDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIY
FT                   ASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKT
FT                   RADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQ
FT                   NAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLV
FT                   MSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGD
FT                   VTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH"
FT   CDS             complement(join(3374049..3374156,3375226..3375330,
FT                   3380898..3381140,3381752..3381949,3382861..3383158,
FT                   3384443..3384576,3385652..3385837,3405355..3405462,
FT                   3406285..3406412,3422196..3422214))
FT                   /codon_start=1
FT                   /gene="Ugp2"
FT                   /locus_tag="mCG_3240"
FT                   /product="UDP-glucose pyrophosphorylase 2, isoform CRA_b"
FT                   /note="gene_id=mCG3240.3 transcript_id=mCT2360.2
FT                   protein_id=mCP3622.2 isoform=CRA_b"
FT                   /protein_id="EDL07847.1"
FT                   /translation="MSRFVQDLSKAMSQDGASQFQEVILQELELSVKKELEKILTTAAS
FT                   HEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSV
FT                   LNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMN
FT                   SFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPG
FT                   HGDIYASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVME
FT                   VTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVK
FT                   RLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTS
FT                   DLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHL
FT                   TVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH"
FT   gene            complement(3489900..3490941)
FT                   /pseudo
FT                   /locus_tag="mCG_61428"
FT                   /note="gene_id=mCG61428.2"
FT   mRNA            complement(3489900..3490941)
FT                   /pseudo
FT                   /locus_tag="mCG_61428"
FT                   /note="gene_id=mCG61428.2 transcript_id=mCT61611.2 created
FT                   on 17-MAY-2002"
FT   gene            complement(3546653..>3563105)
FT                   /locus_tag="mCG_58431"
FT                   /note="gene_id=mCG58431.3"
FT   mRNA            complement(join(3546653..3547047,3548964..3549094,
FT                   3550772..3550879,3551639..3551722,3551874..3552119,
FT                   3556094..3556194,3557421..3557829,3558264..3559761,
FT                   3563016..>3563105))
FT                   /locus_tag="mCG_58431"
FT                   /product="mCG58431"
FT                   /note="gene_id=mCG58431.3 transcript_id=mCT58614.3 created
FT                   on 20-FEB-2003"
FT   CDS             complement(3558800..>3559489)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58431"
FT                   /product="mCG58431"
FT                   /note="gene_id=mCG58431.3 transcript_id=mCT58614.3
FT                   protein_id=mCP26670.3"
FT                   /protein_id="EDL07848.1"
FT                   /translation="FFHMIDTLTTTYVIMENVAGEDLEKYLRALGCLKEEEARPVFQQV
FT                   VSAVHFLHQRHIAHRNIKLESILVDAAGNAKLCDFGMAIKTTEGQMLEETCGSLLYRAP
FT                   EILARKPYDGLAVDMWSLGIVLYVLVTGHFPYVEATIEDMHRVITTTVCPIPYHLSFPC
FT                   HIIIAWLLGVPTWHRMTIHQLVERPWLGHIQDHGLVATKEILPRIVNTMCTIGYTCEEI
FT                   VSSLTNR"
FT   gene            complement(3608617..3624878)
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /note="gene_id=mCG3236.2"
FT   mRNA            complement(join(3608617..3609495,3610389..3610478,
FT                   3611119..3611232,3611626..3611802,3614792..3614914,
FT                   3615968..3616143,3617751..3617847,3618547..3618645,
FT                   3623657..3623740,3624243..3624878))
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), transcript
FT                   variant mCT2366"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT2366.2 created on
FT                   14-FEB-2003"
FT   mRNA            complement(join(3608714..3609495,3610389..3610478,
FT                   3611119..3611232,3611626..3611802,3614792..3614914,
FT                   3615968..3616143,3617751..3617847,3618547..3618645,
FT                   3623657..>3623757))
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), transcript
FT                   variant mCT190017"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT190017.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3609169..3609495,3610389..3610472,
FT                   3611636..>3611741))
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), transcript
FT                   variant mCT180317"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT180317.0 created
FT                   on 14-FEB-2003"
FT   mRNA            complement(join(3609176..3609495,3610389..3610478,
FT                   3617808..3617847,3618547..3618645,3623657..3623743))
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), transcript
FT                   variant mCT180318"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT180318.0 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(3609370..3609495,3610389..3610478,
FT                   3611119..3611232,3611626..3611802,3614792..3614914,
FT                   3615968..3616143,3617751..3617847,3618547..3618645,
FT                   3623657..>3623755))
FT                   /codon_start=1
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT190017.0
FT                   protein_id=mCP111004.0 isoform=CRA_c"
FT                   /protein_id="EDL07851.1"
FT                   /translation="RVLSQSLFRCRGDLTAGDCLLQVQRSALQFAIMSEPIRVLVTGAA
FT                   GQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATD
FT                   KEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGN
FT                   PANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSST
FT                   QYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKA
FT                   IADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDF
FT                   SREKMDLTAKELTEEKETAFEFLSSA"
FT   CDS             complement(join(3609370..3609495,3610389..3610478,
FT                   3611119..3611232,3611626..3611802,3614792..3614914,
FT                   3615968..3616143,3617751..3617847,3618547..3618645,
FT                   3623657..3623659))
FT                   /codon_start=1
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT2366.2
FT                   protein_id=mCP3626.2 isoform=CRA_d"
FT                   /protein_id="EDL07852.1"
FT                   /translation="MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITP
FT                   MMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKA
FT                   NVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRA
FT                   KSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGE
FT                   FITTVQQRGAAVIKARKLSSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVP
FT                   DDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA"
FT   CDS             complement(join(3609370..3609495,3610389..3610472,
FT                   3611636..>3611668))
FT                   /codon_start=1
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT180317.0
FT                   protein_id=mCP103238.0 isoform=CRA_b"
FT                   /protein_id="EDL07850.1"
FT                   /translation="SPERRQLAEGRFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKF
FT                   VEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA"
FT   mRNA            complement(join(<3610408..3610478,3615986..3616143,
FT                   3617751..3617847,3618547..3618645,3623657..3623741))
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), transcript
FT                   variant mCT180316"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT180316.0 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(<3610408..3610478,3615986..3616143,
FT                   3617751..3617847,3618547..3618645,3623657..3623659))
FT                   /codon_start=1
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT180316.0
FT                   protein_id=mCP103237.0 isoform=CRA_a"
FT                   /protein_id="EDL07849.1"
FT                   /translation="MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITP
FT                   MMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKA
FT                   NVKIFKSQGTALEKYGEFVSMGVISDGNSYGVPDDLLYS"
FT   CDS             complement(join(3610447..3610478,3617808..3617847,
FT                   3618547..3618645,3623657..3623659))
FT                   /codon_start=1
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT180318.0
FT                   protein_id=mCP103240.0 isoform=CRA_f"
FT                   /protein_id="EDL07854.1"
FT                   /translation="MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITP
FT                   MMGRVRVDGCYL"
FT   mRNA            complement(join(<3611699..3611802,3614792..3614914,
FT                   3618547..3618645,3623657..3623730))
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), transcript
FT                   variant mCT180315"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT180315.0 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(<3611699..3611802,3614792..3614914,
FT                   3618547..3618645,3623657..3623659))
FT                   /codon_start=1
FT                   /gene="Mdh1"
FT                   /locus_tag="mCG_3236"
FT                   /product="malate dehydrogenase 1, NAD (soluble), isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG3236.2 transcript_id=mCT180315.0
FT                   protein_id=mCP103239.0 isoform=CRA_e"
FT                   /protein_id="EDL07853.1"
FT                   /translation="MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQVIVVGNPANTN
FT                   CLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDV
FT                   NHAKV"
FT   gene            3623961..3949682
FT                   /gene="AV249152"
FT                   /locus_tag="mCG_3238"
FT                   /note="gene_id=mCG3238.1"
FT   mRNA            join(3623961..3624297,3704131..3704215,3711398..3711445,
FT                   3712292..3712342,3715400..3715470,3715729..3715788,
FT                   3740847..3740961,3743061..3743182,3746395..3746586,
FT                   3762615..3763224,3772268..3772456,3775678..3775801,
FT                   3800016..3800079,3864088..3864190,3908149..3908311,
FT                   3935684..3935787,3936960..3936988,3949170..3949682)
FT                   /gene="AV249152"
FT                   /locus_tag="mCG_3238"
FT                   /product="expressed sequence AV249152, transcript variant
FT                   mCT2365"
FT                   /note="gene_id=mCG3238.1 transcript_id=mCT2365.2 created on
FT                   06-FEB-2003"
FT   mRNA            join(<3624236..3624297,3711398..3711445,3712292..3712342,
FT                   3715400..3715470,3715729..3715788,3740847..3740961,
FT                   3743049..3743182,3746395..3746586,3762615..3763224,
FT                   3772268..3772456,3775678..3775801,3800016..3800079,
FT                   3864088..3864190,3908149..3908311,3935684..3935787,
FT                   3936960..3936988,3949170..3949366)
FT                   /gene="AV249152"
FT                   /locus_tag="mCG_3238"
FT                   /product="expressed sequence AV249152, transcript variant
FT                   mCT190019"
FT                   /note="gene_id=mCG3238.1 transcript_id=mCT190019.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3624237..3624297,3711398..3711445,3712292..3712342,
FT                   3715400..3715470,3715729..3715788,3740847..3740961,
FT                   3743049..3743182,3746395..3746586,3762615..3763224,
FT                   3772268..3772456,3775678..3775801,3800016..3800079,
FT                   3864088..3864190,3908149..3908311,3935684..3935787,
FT                   3936960..3936988,3949170..3949220)
FT                   /codon_start=1
FT                   /gene="AV249152"
FT                   /locus_tag="mCG_3238"
FT                   /product="expressed sequence AV249152, isoform CRA_b"
FT                   /note="gene_id=mCG3238.1 transcript_id=mCT190019.0
FT                   protein_id=mCP111005.0 isoform=CRA_b"
FT                   /protein_id="EDL07856.1"
FT                   /translation="PHLSALQTKSLWSCVLTSQADRDIGVYQYYDKKDPSVSATEHGNL
FT                   EEKQRLAESRDYPWTLKNRRPEKLRDSLKELEELMQSSPCVLSKWKSKYICQLLFGSGV
FT                   LVSLSLSGPQLEKVVIDRSLVGKLISDTISDALLTDSFIILSFLAQNKLCFIQFTKKMD
FT                   SLDGNKRLEKLSALDLKISYYDIPGPANRTIDRHLAVNSTQDLVVCWWPLVSDDVWPWT
FT                   PVSSEKDRANMLLLGFTQGGLEVLSFVRTEWSPLDVHFGTKQPYQVFTVECSVSVDKEP
FT                   MADSCIYESVRNKLHCVSVTRIPLRSKAISCCRNSTEDKLIVGCEDSSVILYEAHRGVT
FT                   LLAQAELRPSLISCHPSGAILLVGSNQGELQIFDIALSPINIQLLAEDYSPKETLQFKK
FT                   FFDVSSSLVQMQWMAPPVVFQKPKRGEICDLLFLRFNKGPLGVLLFKLGILTRGQLGLV
FT                   DLILQYIHYSEVYEAISILRSMDWDTLGQQCLIGMGTIVNHLLRQRLTPEREAQLEASL
FT                   GTFYAPTRPLLDTTILEYREPVSKYARRLFHHLLRYKRFEKAFLLAVDIGARDLFMDIH
FT                   YLALDMGELALAEVARRRAHDIDVESVSSGVELLGPLDRRDMLNEGFASSALMPEGENK
FT                   FPGLLPSIGSTHMQTLQQKIPNGPSSRWAIERRTEEEEEEEEEEEEELCTDSSGATTWN
FT                   AEGELKEDQRKQDIGDVGSLRMVHFGLV"
FT   mRNA            join(3624245..3624297,3704131..3704215,3711398..3711445,
FT                   3712292..3712342,3715400..3715470,3715729..3715788,
FT                   3740847..3740961,3743049..3743182,3746395..3746586,
FT                   3762615..3763224,3772268..3772456,3775678..3775801,
FT                   3800016..3800079,3864088..3864190,3908149..3908311,
FT                   3935684..3935787,3936960..3936988,3949170..3949331)
FT                   /gene="AV249152"
FT                   /locus_tag="mCG_3238"
FT                   /product="expressed sequence AV249152, transcript variant
FT                   mCT179731"
FT                   /note="gene_id=mCG3238.1 transcript_id=mCT179731.0 created
FT                   on 06-FEB-2003"
FT   CDS             join(3715735..3715788,3740847..3740961,3743049..3743182,
FT                   3746395..3746586,3762615..3763224,3772268..3772456,
FT                   3775678..3775801,3800016..3800079,3864088..3864190,
FT                   3908149..3908311,3935684..3935787,3936960..3936988,
FT                   3949170..3949220)
FT                   /codon_start=1
FT                   /gene="AV249152"
FT                   /locus_tag="mCG_3238"
FT                   /product="expressed sequence AV249152, isoform CRA_a"
FT                   /note="gene_id=mCG3238.1 transcript_id=mCT179731.0
FT                   protein_id=mCP102653.0 isoform=CRA_a"
FT                   /protein_id="EDL07855.1"
FT                   /translation="MQSSPCVLSKWKSKYICQLLFGSGVLVSLSLSGPQLEKVVIDRSL
FT                   VGKLISDTISDALLTDSFIILSFLAQNKLCFIQFTKKMDSLDGNKRLEKLSALDLKISY
FT                   YDIPGPANRTIDRHLAVNSTQDLVVCWWPLVSDDVWPWTPVSSEKDRANMLLLGFTQGG
FT                   LEVLSFVRTEWSPLDVHFGTKQPYQVFTVECSVSVDKEPMADSCIYESVRNKLHCVSVT
FT                   RIPLRSKAISCCRNSTEDKLIVGCEDSSVILYEAHRGVTLLAQAELRPSLISCHPSGAI
FT                   LLVGSNQGELQIFDIALSPINIQLLAEDYSPKETLQFKKFFDVSSSLVQMQWMAPPVVF
FT                   QKPKRGEICDLLFLRFNKGPLGVLLFKLGILTRGQLGLVDLILQYIHYSEVYEAISILR
FT                   SMDWDTLGQQCLIGMGTIVNHLLRQRLTPEREAQLEASLGTFYAPTRPLLDTTILEYRE
FT                   PVSKYARRLFHHLLRYKRFEKAFLLAVDIGARDLFMDIHYLALDMGELALAEVARRRAH
FT                   DIDVESVSSGVELLGPLDRRDMLNEGFASSALMPEGENKFPGLLPSIGSTHMQTLQQKI
FT                   PNGPSSRWAIERRTEEEEEEEEEEEEELCTDSSGATTWNAEGELKEDQRKQDIGDVGSL
FT                   RMVHFGLV"
FT   CDS             join(3715735..3715788,3740847..3740961,3743061..3743182,
FT                   3746395..3746586,3762615..3763224,3772268..3772456,
FT                   3775678..3775801,3800016..3800079,3864088..3864190,
FT                   3908149..3908311,3935684..3935787,3936960..3936988,
FT                   3949170..3949220)
FT                   /codon_start=1
FT                   /gene="AV249152"
FT                   /locus_tag="mCG_3238"
FT                   /product="expressed sequence AV249152, isoform CRA_c"
FT                   /note="gene_id=mCG3238.1 transcript_id=mCT2365.2
FT                   protein_id=mCP3610.2 isoform=CRA_c"
FT                   /protein_id="EDL07857.1"
FT                   /translation="MQSSPCVLSKWKSKYICQLLFGSGVLVSLSLSGPQLEKVVIDRSL
FT                   VGKLISDTISDDSFIILSFLAQNKLCFIQFTKKMDSLDGNKRLEKLSALDLKISYYDIP
FT                   GPANRTIDRHLAVNSTQDLVVCWWPLVSDDVWPWTPVSSEKDRANMLLLGFTQGGLEVL
FT                   SFVRTEWSPLDVHFGTKQPYQVFTVECSVSVDKEPMADSCIYESVRNKLHCVSVTRIPL
FT                   RSKAISCCRNSTEDKLIVGCEDSSVILYEAHRGVTLLAQAELRPSLISCHPSGAILLVG
FT                   SNQGELQIFDIALSPINIQLLAEDYSPKETLQFKKFFDVSSSLVQMQWMAPPVVFQKPK
FT                   RGEICDLLFLRFNKGPLGVLLFKLGILTRGQLGLVDLILQYIHYSEVYEAISILRSMDW
FT                   DTLGQQCLIGMGTIVNHLLRQRLTPEREAQLEASLGTFYAPTRPLLDTTILEYREPVSK
FT                   YARRLFHHLLRYKRFEKAFLLAVDIGARDLFMDIHYLALDMGELALAEVARRRAHDIDV
FT                   ESVSSGVELLGPLDRRDMLNEGFASSALMPEGENKFPGLLPSIGSTHMQTLQQKIPNGP
FT                   SSRWAIERRTEEEEEEEEEEEEELCTDSSGATTWNAEGELKEDQRKQDIGDVGSLRMVH
FT                   FGLV"
FT   gene            complement(3733676..3735381)
FT                   /pseudo
FT                   /locus_tag="mCG_3235"
FT                   /note="gene_id=mCG3235.2"
FT   mRNA            complement(3733676..3735381)
FT                   /pseudo
FT                   /locus_tag="mCG_3235"
FT                   /note="gene_id=mCG3235.2 transcript_id=mCT2370.1 created on
FT                   17-MAY-2002"
FT   gene            complement(3927324..3928704)
FT                   /pseudo
FT                   /locus_tag="mCG_54090"
FT                   /note="gene_id=mCG54090.2"
FT   mRNA            complement(3927324..3928704)
FT                   /pseudo
FT                   /locus_tag="mCG_54090"
FT                   /note="gene_id=mCG54090.2 transcript_id=mCT54273.2 created
FT                   on 17-MAY-2002"
FT   gene            3997735..3998387
FT                   /pseudo
FT                   /locus_tag="mCG_54029"
FT                   /note="gene_id=mCG54029.1"
FT   mRNA            3997735..3998387
FT                   /pseudo
FT                   /locus_tag="mCG_54029"
FT                   /note="gene_id=mCG54029.1 transcript_id=mCT54212.1 created
FT                   on 17-MAY-2002"
FT   gene            complement(4021417..4021909)
FT                   /pseudo
FT                   /locus_tag="mCG_52267"
FT                   /note="gene_id=mCG52267.2"
FT   mRNA            complement(4021417..4021909)
FT                   /pseudo
FT                   /locus_tag="mCG_52267"
FT                   /note="gene_id=mCG52267.2 transcript_id=mCT52450.2 created
FT                   on 17-MAY-2002"
FT   gene            complement(4040581..4046190)
FT                   /gene="Otx1"
FT                   /locus_tag="mCG_1043"
FT                   /note="gene_id=mCG1043.3"
FT   mRNA            complement(join(4040581..4041670,4042982..4043133,
FT                   4043993..4044130,4045634..4045801))
FT                   /gene="Otx1"
FT                   /locus_tag="mCG_1043"
FT                   /product="orthodenticle homolog 1 (Drosophila), transcript
FT                   variant mCT8679"
FT                   /note="gene_id=mCG1043.3 transcript_id=mCT8679.2 created on
FT                   14-FEB-2003"
FT   mRNA            complement(join(4040664..4041670,4042982..4043133,
FT                   4043993..4044198,4045735..4045802,4046161..4046190))
FT                   /gene="Otx1"
FT                   /locus_tag="mCG_1043"
FT                   /product="orthodenticle homolog 1 (Drosophila), transcript
FT                   variant mCT180362"
FT                   /note="gene_id=mCG1043.3 transcript_id=mCT180362.0 created
FT                   on 14-FEB-2003"
FT   CDS             complement(join(4040852..4041670,4042982..4043133,
FT                   4043993..4044089))
FT                   /codon_start=1
FT                   /gene="Otx1"
FT                   /locus_tag="mCG_1043"
FT                   /product="orthodenticle homolog 1 (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1043.3 transcript_id=mCT180362.0
FT                   protein_id=mCP103284.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SS54"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003025"
FT                   /db_xref="InterPro:IPR003026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013851"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:97450"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SS54"
FT                   /protein_id="EDL07858.1"
FT                   /translation="MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTF
FT                   TRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGNGTK
FT                   TRPVKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSASANPAAAAAAGLGGNPVA
FT                   AASSLSTPTASSIWSPASISPGSAPTSVSVPEPLAAPSNASCMQRSVAAGAATAAASYP
FT                   MSYGQGGSYGQGYPAPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPH
FT                   AHHPLSQSSGHHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPAAAAASSAWKLNFNSPD
FT                   CLDYKDQASWRFQVL"
FT   CDS             complement(join(4040852..4041670,4042982..4043133,
FT                   4043993..4044089))
FT                   /codon_start=1
FT                   /gene="Otx1"
FT                   /locus_tag="mCG_1043"
FT                   /product="orthodenticle homolog 1 (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1043.3 transcript_id=mCT8679.2
FT                   protein_id=mCP3624.3 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SS54"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003025"
FT                   /db_xref="InterPro:IPR003026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013851"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:97450"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SS54"
FT                   /protein_id="EDL07859.1"
FT                   /translation="MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTF
FT                   TRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGNGTK
FT                   TRPVKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSASANPAAAAAAGLGGNPVA
FT                   AASSLSTPTASSIWSPASISPGSAPTSVSVPEPLAAPSNASCMQRSVAAGAATAAASYP
FT                   MSYGQGGSYGQGYPAPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPH
FT                   AHHPLSQSSGHHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPAAAAASSAWKLNFNSPD
FT                   CLDYKDQASWRFQVL"
FT   gene            complement(4050631..4330479)
FT                   /gene="Ehbp1"
FT                   /locus_tag="mCG_1051"
FT                   /note="gene_id=mCG1051.2"
FT   mRNA            complement(join(4050631..4051672,4051884..4051998,
FT                   4058286..4058359,4059657..4059756,4098202..4098325,
FT                   4101299..4101396,4101552..4101690,4103909..4104033,
FT                   4107552..4107659,4113131..4113275,4134294..4134437,
FT                   4140095..4140976,4145195..4145243,4145825..4146003,
FT                   4182673..4182892,4191299..4191461,4195903..4196025,
FT                   4196624..4196728,4213870..4214009,4217660..4217841,
FT                   4276804..4276857,4283945..4284040,4292745..4292802,
FT                   4330109..4330479))
FT                   /gene="Ehbp1"
FT                   /locus_tag="mCG_1051"
FT                   /product="EH domain binding protein 1, transcript variant
FT                   mCT8687"
FT                   /note="gene_id=mCG1051.2 transcript_id=mCT8687.2 created on
FT                   06-FEB-2003"
FT   mRNA            complement(join(4050632..4051672,4051884..4051998,
FT                   4058286..4058359,4059657..4059756,4098202..4098325,
FT                   4101299..4101396,4101552..4101690,4103909..4104033,
FT                   4107552..4107659,4113131..4113278,4134294..4134437,
FT                   4140095..4140976,4145195..4145243,4145825..4146003,
FT                   4182673..4182892,4191299..4191461,4195903..4196025,
FT                   4196624..4196728,4213870..4214009,4217660..4217841,
FT                   4276804..4276857,4283945..4284040,4292745..4292802,
FT                   4330109..4330459))
FT                   /gene="Ehbp1"
FT                   /locus_tag="mCG_1051"
FT                   /product="EH domain binding protein 1, transcript variant
FT                   mCT179743"
FT                   /note="gene_id=mCG1051.2 transcript_id=mCT179743.0 created
FT                   on 06-FEB-2003"
FT   CDS             complement(join(4051582..4051672,4051884..4051998,
FT                   4058286..4058359,4059657..4059756,4098202..4098325,
FT                   4101299..4101396,4101552..4101690,4103909..4104033,
FT                   4107552..4107659,4113131..4113275,4134294..4134437,
FT                   4140095..4140976,4145195..4145243,4145825..4146003,
FT                   4182673..4182892,4191299..4191461,4195903..4196025,
FT                   4196624..4196728,4213870..4214009,4217660..4217841,
FT                   4276804..4276857,4283945..4284040,4292745..4292802,
FT                   4330109..4330212))
FT                   /codon_start=1
FT                   /gene="Ehbp1"
FT                   /locus_tag="mCG_1051"
FT                   /product="EH domain binding protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG1051.2 transcript_id=mCT8687.2
FT                   protein_id=mCP3618.2 isoform=CRA_b"
FT                   /protein_id="EDL07861.1"
FT                   /translation="MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWT
FT                   RRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIEN
FT                   ESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGK
FT                   ATDEDMQSLASLMSMKQADIGNLDDFEEDNEDDDENRVNQEEKAAKITEIVNQLNALSS
FT                   LDEDQDDCIKQANVPSAKSASSSEELINTLNFLDEAQKDLATVNTNPFDEPDVTELNPF
FT                   GDPDSEGVQTPQYLNPFDEPETFVMIKDSPPQSTRRKNLRPVDMSKYLYADSSKSEEEL
FT                   DESNPFYEPKPTSPNNLVNTVQEGETERRVKRRAPAPPAPLAPPAPPAPPALTPKTGVN
FT                   ENTVVSAGKDLSTSPKPSPIPSPVLGQKPNASQSLLAWCREVTKNYRGVKITNFTTSWR
FT                   NGLSFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPD
FT                   KLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELSDL
FT                   KREPEPHQPARGAVDLLSQDDSVFVTDSGVGESESEHQTPDDHLSPSTASPYYRRTKSD
FT                   TEPQKSQQSSARTSGSDDPGLSSSTDSAQALASLGKKRLKAENLELSDLCVSDKKKDVS
FT                   PLSAYEQKLQTVHASSDMEQGKMEKSRSLECRLDGELAITKPNVSSPSKLGYNRDTDFT
FT                   KKPCASLRQIESDPDADKSTLNHADHPNKAVQHRMLSRQEELKERARVLLEQARRDAAF
FT                   KVGSKHGGSAAPALCSRQLNDQDEERRRQLRERARQLIAEARCGVKMSELPSYGEMAAE
FT                   KLKERSKASGDENDNIEIDTNEEIPEGFVVGGGDELTNIESDLDNPEQNSKVVDLRLKK
FT                   LLEAQPQVANLLPSAAQKAVTEASEQGEKSGVEELRTERLQKATERFRNPVVFNKDSTV
FT                   RKTQLQSFSQYVENRPEMKRQRSIQEDTKRGTEEKAEITETQRKPSEDEKGFKDTSQYV
FT                   VGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWFMLVNKKNALIRRM
FT                   NQLSLLEKEHDLERRYELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVALVDKRDAL
FT                   VRDLDAQEKQAEEEDEHLERTLEQNKGKMAKKEEKCALQ"
FT   CDS             complement(join(4051582..4051672,4051884..4051998,
FT                   4058286..4058359,4059657..4059756,4098202..4098325,
FT                   4101299..4101396,4101552..4101690,4103909..4104033,
FT                   4107552..4107659,4113131..4113278,4134294..4134437,
FT                   4140095..4140976,4145195..4145243,4145825..4146003,
FT                   4182673..4182892,4191299..4191461,4195903..4196025,
FT                   4196624..4196728,4213870..4214009,4217660..4217841,
FT                   4276804..4276857,4283945..4284040,4292745..4292802,
FT                   4330109..4330212))
FT                   /codon_start=1
FT                   /gene="Ehbp1"
FT                   /locus_tag="mCG_1051"
FT                   /product="EH domain binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG1051.2 transcript_id=mCT179743.0
FT                   protein_id=mCP102665.0 isoform=CRA_a"
FT                   /protein_id="EDL07860.1"
FT                   /translation="MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWT
FT                   RRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIEN
FT                   ESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGK
FT                   ATDEDMQSLASLMSMKQADIGNLDDFEEDNEDDDENRVNQEEKAAKITEIVNQLNALSS
FT                   LDEDQDDCIKQANVPSAKSASSSEELINTLNFLDEAQKDLATVNTNPFDEPDVTELNPF
FT                   GDPDSEGVQTPQYLNPFDEPETFVMIKDSPPQSTRRKNLRPVDMSKYLYADSSKSEEEL
FT                   DESNPFYEPKPTSPNNLVNTVQEGETERRVKRRAPAPPAPLAPPAPPAPPALTPKTGVN
FT                   ENTVVSAGKDLSTSPKPSPIPSPVLGQKPNASQSLLAWCREVTKNYRGVKITNFTTSWR
FT                   NGLSFCAILHHFRPDLIDYKSLNPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPD
FT                   KLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELSDL
FT                   KREPEPHQPARGAVDLLSQDDSVFVTDSGVGESESEHQTPDDHLSPSTASPYYRRTKSD
FT                   TEPQKSQQSSARTSGSDDPGLSSSTDSAQALASLGKKRLKAENLELSDLCVSDKKKDVS
FT                   PLSAYEQKLQTVHASSDMEQGKMEKSRSLECRLDGELAITKPNVSSPSKLGYNRDTDFT
FT                   KKPCASLRQIESDPDADKSTLNHADHPNKAVQHRMLSRQEELKERARVLLEQARRDAAF
FT                   KVGSKHGGSAAPALCSRQLNDQQDEERRRQLRERARQLIAEARCGVKMSELPSYGEMAA
FT                   EKLKERSKASGDENDNIEIDTNEEIPEGFVVGGGDELTNIESDLDNPEQNSKVVDLRLK
FT                   KLLEAQPQVANLLPSAAQKAVTEASEQGEKSGVEELRTERLQKATERFRNPVVFNKDST
FT                   VRKTQLQSFSQYVENRPEMKRQRSIQEDTKRGTEEKAEITETQRKPSEDEKGFKDTSQY
FT                   VVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWFMLVNKKNALIRR
FT                   MNQLSLLEKEHDLERRYELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVALVDKRDA
FT                   LVRDLDAQEKQAEEEDEHLERTLEQNKGKMAKKEEKCALQ"
FT   gene            4430561..4431214
FT                   /locus_tag="mCG_1049"
FT                   /note="gene_id=mCG1049.2"
FT   mRNA            4430561..4431214
FT                   /locus_tag="mCG_1049"
FT                   /product="mCG1049"
FT                   /note="gene_id=mCG1049.2 transcript_id=mCT8685.2 created on
FT                   17-MAY-2002"
FT   CDS             4430726..4430890
FT                   /codon_start=1
FT                   /locus_tag="mCG_1049"
FT                   /product="mCG1049"
FT                   /note="gene_id=mCG1049.2 transcript_id=mCT8685.2
FT                   protein_id=mCP3612.1"
FT                   /protein_id="EDL07862.1"
FT                   /translation="MVAIENPDDVSVKSSRNTGQPAVLKFTDELPLVAASCLRPSLSRP
FT                   KQPSGNHSF"
FT   gene            4552530..4559721
FT                   /gene="Tmem17"
FT                   /locus_tag="mCG_1045"
FT                   /note="gene_id=mCG1045.1"
FT   mRNA            join(4552530..4553033,4557676..4557779,4557896..4558009,
FT                   4558869..4559721)
FT                   /gene="Tmem17"
FT                   /locus_tag="mCG_1045"
FT                   /product="transmembrane protein 17"
FT                   /note="gene_id=mCG1045.1 transcript_id=mCT8681.1 created on
FT                   17-MAY-2002"
FT   CDS             join(4552934..4553033,4557676..4557779,4557896..4558009,
FT                   4558869..4559147)
FT                   /codon_start=1
FT                   /gene="Tmem17"
FT                   /locus_tag="mCG_1045"
FT                   /product="transmembrane protein 17"
FT                   /note="gene_id=mCG1045.1 transcript_id=mCT8681.1
FT                   protein_id=mCP3630.2"
FT                   /protein_id="EDL07863.1"
FT                   /translation="MELPDPVRQRLSNLSLTVFGDSSRTGPESSDAADNEMVSSLALQM
FT                   SLYFNSYFFPLWWVSCIVMLHLKYSILPDYYKFIVVTVVILITLIEAIRLYLGCMGNLQ
FT                   EKVPELAGFWLLSLLLQLPLILFLLLNDGLRNLPLEKAIHIIFTIFLTFQVISAFLTLK
FT                   KMVNQLAARFHLQDFDQLSSSSAAVRRVRQCTEEL"
FT   gene            complement(4560781..>4561847)
FT                   /locus_tag="mCG_1030897"
FT                   /note="gene_id=mCG1030897.0"
FT   mRNA            complement(join(4560781..4560914,4561380..>4561847))
FT                   /locus_tag="mCG_1030897"
FT                   /product="mCG1030897"
FT                   /note="gene_id=mCG1030897.0 transcript_id=mCT148601.0
FT                   created on 17-MAY-2002"
FT   CDS             complement(4561390..>4561752)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030897"
FT                   /product="mCG1030897"
FT                   /note="gene_id=mCG1030897.0 transcript_id=mCT148601.0
FT                   protein_id=mCP71495.0"
FT                   /protein_id="EDL07864.1"
FT                   /translation="SWVSWNSLFRPGWPRTQKSACLCLPSAGIKGMHHHRPASPWLTTS
FT                   ISILLGPLIIILLLLTFEHCILNRLGLPSHRITFSKLSYSPWQLFIAMKKHIMSAYSYV
FT                   LRCFGLNGKECAFEGR"
FT   gene            complement(4666701..4667057)
FT                   /pseudo
FT                   /locus_tag="mCG_1030827"
FT                   /note="gene_id=mCG1030827.1"
FT   mRNA            complement(4666701..4667057)
FT                   /pseudo
FT                   /locus_tag="mCG_1030827"
FT                   /note="gene_id=mCG1030827.1 transcript_id=mCT148531.1
FT                   created on 17-MAY-2002"
FT   gene            complement(4766220..>4769184)
FT                   /locus_tag="mCG_1030900"
FT                   /note="gene_id=mCG1030900.0"
FT   mRNA            complement(join(4766220..4766722,4769021..>4769184))
FT                   /locus_tag="mCG_1030900"
FT                   /product="mCG1030900"
FT                   /note="gene_id=mCG1030900.0 transcript_id=mCT148604.0
FT                   created on 17-MAY-2002"
FT   CDS             complement(join(4766588..4766722,4769021..>4769182))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030900"
FT                   /product="mCG1030900"
FT                   /note="gene_id=mCG1030900.0 transcript_id=mCT148604.0
FT                   protein_id=mCP71503.0"
FT                   /protein_id="EDL07865.1"
FT                   /translation="ESFKARQAFSIAVYGAGNCEVQVIFTALPGTEEEGPQDGNSPSYP
FT                   RKGWQGDLQGTGLLTMKTGIAPNKYFYTGPQPPCLISHLPPLPWEVTALQNPY"
FT   gene            <4770193..4774260
FT                   /locus_tag="mCG_145093"
FT                   /note="gene_id=mCG145093.0"
FT   mRNA            join(<4770193..4770206,4770365..4770524,4771923..4772007,
FT                   4773253..4774260)
FT                   /locus_tag="mCG_145093"
FT                   /product="mCG145093"
FT                   /note="gene_id=mCG145093.0 transcript_id=mCT184517.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4770456..4770524,4771923..4772007,4773253..4773278)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145093"
FT                   /product="mCG145093"
FT                   /note="gene_id=mCG145093.0 transcript_id=mCT184517.0
FT                   protein_id=mCP105189.0"
FT                   /protein_id="EDL07866.1"
FT                   /translation="ALQQLILELNREQTESGPALKKKAGTRDSLSPLRAAREVVSTPEL
FT                   AEGKCRENKPGQDP"
FT   gene            complement(4874571..4899813)
FT                   /gene="B3gnt2"
FT                   /locus_tag="mCG_1046"
FT                   /note="gene_id=mCG1046.3"
FT   mRNA            complement(join(4874571..4877016,4898861..4899055,
FT                   4899585..4899703))
FT                   /gene="B3gnt2"
FT                   /locus_tag="mCG_1046"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 2, transcript
FT                   variant mCT8682"
FT                   /note="gene_id=mCG1046.3 transcript_id=mCT8682.2 created on
FT                   14-FEB-2003"
FT   CDS             complement(4875814..4877007)
FT                   /codon_start=1
FT                   /gene="B3gnt2"
FT                   /locus_tag="mCG_1046"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 2, isoform CRA_a"
FT                   /note="gene_id=mCG1046.3 transcript_id=mCT8682.2
FT                   protein_id=mCP3606.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TVJ9"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1889505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TVJ9"
FT                   /protein_id="EDL07867.1"
FT                   /translation="MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPK
FT                   EKFWKPPSTPRAYWNREQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMT
FT                   AVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRE
FT                   SWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSL
FT                   KEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGP
FT                   HRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCL
FT                   QKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC"
FT   mRNA            complement(join(4876780..4877016,4899585..4899813))
FT                   /gene="B3gnt2"
FT                   /locus_tag="mCG_1046"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 2, transcript
FT                   variant mCT180363"
FT                   /note="gene_id=mCG1046.3 transcript_id=mCT180363.0 created
FT                   on 14-FEB-2003"
FT   mRNA            complement(join(4876783..4877016,4898861..4898881,
FT                   4898920..4898984))
FT                   /gene="B3gnt2"
FT                   /locus_tag="mCG_1046"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 2, transcript
FT                   variant mCT180364"
FT                   /note="gene_id=mCG1046.3 transcript_id=mCT180364.0 created
FT                   on 14-FEB-2003"
FT   CDS             complement(4876913..4877014)
FT                   /codon_start=1
FT                   /gene="B3gnt2"
FT                   /locus_tag="mCG_1046"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 2, isoform CRA_b"
FT                   /note="gene_id=mCG1046.3 transcript_id=mCT180363.0
FT                   protein_id=mCP103285.0 isoform=CRA_b"
FT                   /protein_id="EDL07868.1"
FT                   /translation="MRDECGASKSQVAGHPDDGKCLHLFDCGSLQKQ"
FT   CDS             complement(4876913..4877014)
FT                   /codon_start=1
FT                   /gene="B3gnt2"
FT                   /locus_tag="mCG_1046"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 2, isoform CRA_b"
FT                   /note="gene_id=mCG1046.3 transcript_id=mCT180364.0
FT                   protein_id=mCP103286.0 isoform=CRA_b"
FT                   /protein_id="EDL07869.1"
FT                   /translation="MRDECGASKSQVAGHPDDGKCLHLFDCGSLQKQ"
FT   gene            4891771..4894849
FT                   /locus_tag="mCG_147220"
FT                   /note="gene_id=mCG147220.0"
FT   mRNA            join(4891771..4894524,4894556..4894849)
FT                   /locus_tag="mCG_147220"
FT                   /product="mCG147220"
FT                   /note="gene_id=mCG147220.0 transcript_id=mCT187483.0
FT                   created on 13-JAN-2004"
FT   CDS             4893220..4893498
FT                   /codon_start=1
FT                   /locus_tag="mCG_147220"
FT                   /product="mCG147220"
FT                   /note="gene_id=mCG147220.0 transcript_id=mCT187483.0
FT                   protein_id=mCP108855.0"
FT                   /protein_id="EDL07870.1"
FT                   /translation="MLEPLAVSSALQLLSPFEAFFIHHCEVKSQCHFLRKPFLSAPNIC
FT                   CNRVWKHSRPNRTKGTQTIAICLQTQLPQAAITSQTMCQLLCGQSQA"
FT   gene            <4899744..4900639
FT                   /locus_tag="mCG_1030901"
FT                   /note="gene_id=mCG1030901.1"
FT   mRNA            <4899744..4900639
FT                   /locus_tag="mCG_1030901"
FT                   /product="mCG1030901"
FT                   /note="gene_id=mCG1030901.1 transcript_id=mCT148605.1
FT                   created on 17-MAY-2002"
FT   CDS             <4899848..4900324
FT                   /codon_start=1
FT                   /locus_tag="mCG_1030901"
FT                   /product="mCG1030901"
FT                   /note="gene_id=mCG1030901.1 transcript_id=mCT148605.1
FT                   protein_id=mCP71507.1"
FT                   /protein_id="EDL07871.1"
FT                   /translation="APTTPKHGSRGTRNGPPPPTQRLPRLPRALRAKVRPRKKPGRPDG
FT                   EVALVCRAGWAGRVGTPSTPNLEPGPHNLGRAWKLLPLPSILIAKAFGRPSGDNHTEKL
FT                   TLYTCLLFFFFFFFFRRLSDGVSQRDAIDFRALEIEFQPARPRPRSLTYSRRKK"
FT   gene            complement(4939114..5021551)
FT                   /gene="Commd1"
FT                   /locus_tag="mCG_52266"
FT                   /note="gene_id=mCG52266.3"
FT   mRNA            complement(join(4939114..4939430,4995762..4996043,
FT                   5021370..5021551))
FT                   /gene="Commd1"
FT                   /locus_tag="mCG_52266"
FT                   /product="COMM domain containing 1, transcript variant
FT                   mCT8882"
FT                   /note="gene_id=mCG52266.3 transcript_id=mCT8882.2 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(4939114..4939430,4995762..4996043,
FT                   5013192..5013394,5017608..5018287))
FT                   /gene="Commd1"
FT                   /locus_tag="mCG_52266"
FT                   /product="COMM domain containing 1, transcript variant
FT                   mCT52449"
FT                   /note="gene_id=mCG52266.3 transcript_id=mCT52449.3 created
FT                   on 04-JUN-2003"
FT   mRNA            complement(join(4939114..4939430,4995762..4996043,
FT                   5011948..5012156))
FT                   /gene="Commd1"
FT                   /locus_tag="mCG_52266"
FT                   /product="COMM domain containing 1, transcript variant
FT                   mCT180339"
FT                   /note="gene_id=mCG52266.3 transcript_id=mCT180339.1 created
FT                   on 04-JUN-2003"
FT   CDS             complement(join(4939323..4939430,4995762..4996043,
FT                   5021370..5021546))
FT                   /codon_start=1
FT                   /gene="Commd1"
FT                   /locus_tag="mCG_52266"
FT                   /product="COMM domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG52266.3 transcript_id=mCT8882.2
FT                   protein_id=mCP3613.2 isoform=CRA_c"
FT                   /db_xref="GOA:A2RSF1"
FT                   /db_xref="InterPro:IPR009886"
FT                   /db_xref="InterPro:IPR017920"
FT                   /db_xref="MGI:MGI:109474"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSF1"
FT                   /protein_id="EDL07874.1"
FT                   /translation="MAGDLEGGKSLSGLLSGLAQNAFHGHSGVTEELLHSQLYPEVPPE
FT                   EFRPFLAKMRGLLKSIASADMDFNQLEAFLTAQTKKQGGITSEQAAVISKFWKSHKIKI
FT                   RESLMKQSRWDNGLRGLSWRVDGKSQSRHSTQIHSPVAIIELEFGKNGQESEFLCLEFD
FT                   EVKVKQILKKLSEVEESINRLMQAA"
FT   CDS             complement(join(4939323..4939430,4995762..4996043,
FT                   5013192..5013394,5017608..5017746))
FT                   /codon_start=1
FT                   /gene="Commd1"
FT                   /locus_tag="mCG_52266"
FT                   /product="COMM domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG52266.3 transcript_id=mCT52449.3
FT                   protein_id=mCP26677.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8VI86"
FT                   /db_xref="InterPro:IPR009886"
FT                   /db_xref="InterPro:IPR017920"
FT                   /db_xref="MGI:MGI:109474"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VI86"
FT                   /protein_id="EDL07873.1"
FT                   /translation="MGGLIGGTGPTGITPGGGAATGIMEVSPMLGACIIPECGGPRGLE
FT                   PEFTLELSSCVPSSIKEREGCLAFFFRLVLNIHIAPQMRFQVAAYFELNHLSHVLELRQ
FT                   HVMVEIQELLSIASADMDFNQLEAFLTAQTKKQGGITSEQAAVISKFWKSHKIKIRESL
FT                   MKQSRWDNGLRGLSWRVDGKSQSRHSTQIHSPVAIIELEFGKNGQESEFLCLEFDEVKV
FT                   KQILKKLSEVEESINRLMQAA"
FT   CDS             complement(join(4939323..4939430,4995762..4996025))
FT                   /codon_start=1
FT                   /gene="Commd1"
FT                   /locus_tag="mCG_52266"
FT                   /product="COMM domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG52266.3 transcript_id=mCT180339.1
FT                   protein_id=mCP103261.1 isoform=CRA_a"
FT                   /protein_id="EDL07872.1"
FT                   /translation="MDFNQLEAFLTAQTKKQGGITSEQAAVISKFWKSHKIKIRESLMK
FT                   QSRWDNGLRGLSWRVDGKSQSRHSTQIHSPVAIIELEFGKNGQESEFLCLEFDEVKVKQ
FT                   ILKKLSEVEESINRLMQAA"
FT   gene            5011334..5014200
FT                   /gene="U2af1-rs1"
FT                   /locus_tag="mCG_50653"
FT                   /note="gene_id=mCG50653.1"
FT   mRNA            5011334..5014200
FT                   /gene="U2af1-rs1"
FT                   /locus_tag="mCG_50653"
FT                   /product="U2 small nuclear ribonucleoprotein auxiliary
FT                   factor (U2AF) 1, related sequence 1"
FT                   /note="gene_id=mCG50653.1 transcript_id=mCT50836.1 created
FT                   on 08-NOV-2002"
FT   CDS             5012520..5013806
FT                   /codon_start=1
FT                   /gene="U2af1-rs1"
FT                   /locus_tag="mCG_50653"
FT                   /product="U2 small nuclear ribonucleoprotein auxiliary
FT                   factor (U2AF) 1, related sequence 1"
FT                   /note="gene_id=mCG50653.1 transcript_id=mCT50836.1
FT                   protein_id=mCP26665.2"
FT                   /db_xref="GOA:Q793C9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:98885"
FT                   /db_xref="UniProtKB/TrEMBL:Q793C9"
FT                   /protein_id="EDL07875.1"
FT                   /translation="MASRQTAIPEKLSRKQYKAAMKKEKRKKRRQKMARLRALEAPPEE
FT                   DDDVSANEELAERLLEIERQRLHEEWLLREEKAQEEFRIKKKKEEAARKQKEEQERQIK
FT                   AEWEEQQKKQREEEEQKLQEKREREEAVQKMLDQAENERIWQNPEPPKDLRLEKYRPSC
FT                   PFYNKTGACRFGNRCSRKHDFPTSSPTLLVKSMFTTFGMEQCRRDDYDSDANLEYSEEE
FT                   TYQQFLDFYHDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGR
FT                   WYAGRQLQCEFCPVTRWKVAICGLFEMQKCPKGKHCNFLHVFRNPNNEFREANRDIYMS
FT                   PPAWTGSSGKNSDRRERKDHHEEYYSKSRSYHSGSYHSSKRNRESERKSPHRWKKSHKQ
FT                   TTKSHERHSSRRGREEDSSPGPQSQSHRT"
FT   gene            complement(5027874..5028121)
FT                   /pseudo
FT                   /locus_tag="mCG_1030852"
FT                   /note="gene_id=mCG1030852.1"
FT   mRNA            complement(5027874..5028121)
FT                   /pseudo
FT                   /locus_tag="mCG_1030852"
FT                   /note="gene_id=mCG1030852.1 transcript_id=mCT148556.1
FT                   created on 20-MAY-2002"
FT   gene            5029686..5042629
FT                   /gene="Cct4"
FT                   /locus_tag="mCG_8764"
FT                   /note="gene_id=mCG8764.2"
FT   mRNA            join(5029686..5030173,5032560..5032612,5033591..5033680,
FT                   5035223..5035331,5035608..5035750,5036326..5036447,
FT                   5036896..5037028,5038326..5038465,5040151..5040247,
FT                   5040655..5040765,5040853..5040983,5041460..5041694,
FT                   5042110..5042223,5042430..5042629)
FT                   /gene="Cct4"
FT                   /locus_tag="mCG_8764"
FT                   /product="chaperonin subunit 4 (delta)"
FT                   /note="gene_id=mCG8764.2 transcript_id=mCT8875.1 created on
FT                   20-MAY-2002"
FT   CDS             join(5030047..5030173,5032560..5032612,5033591..5033680,
FT                   5035223..5035331,5035608..5035750,5036326..5036447,
FT                   5036896..5037028,5038326..5038465,5040151..5040247,
FT                   5040655..5040765,5040853..5040983,5041460..5041694,
FT                   5042110..5042223,5042430..5042444)
FT                   /codon_start=1
FT                   /gene="Cct4"
FT                   /locus_tag="mCG_8764"
FT                   /product="chaperonin subunit 4 (delta)"
FT                   /note="gene_id=mCG8764.2 transcript_id=mCT8875.1
FT                   protein_id=mCP3628.1"
FT                   /db_xref="GOA:Q564F4"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="MGI:MGI:104689"
FT                   /db_xref="UniProtKB/TrEMBL:Q564F4"
FT                   /protein_id="EDL07876.1"
FT                   /translation="MPENVASRSGAPTAGPGSRGKSAYQDRDKPAQIRFSNISAAKAVA
FT                   DAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGD
FT                   GTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGLEILTDMSRPVQLSDRETL
FT                   LNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCE
FT                   LVEGLVLTQKVANSGITRVEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERA
FT                   YILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDVEREDIEFICKTI
FT                   GTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITGCTSPGKTVTIVVRGSNKLVIE
FT                   EAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAM
FT                   EVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKGGISNILEEMVVQPLLVSVS
FT                   ALTLATETVRSILKIDDVVNTR"
FT   gene            <5047666..5063020
FT                   /gene="4930430E16Rik"
FT                   /locus_tag="mCG_8772"
FT                   /note="gene_id=mCG8772.2"
FT   mRNA            join(<5047666..5047919,5054945..5055174,5059290..5060423,
FT                   5062720..5063020)
FT                   /gene="4930430E16Rik"
FT                   /locus_tag="mCG_8772"
FT                   /product="RIKEN cDNA 4930430E16, transcript variant
FT                   mCT8881"
FT                   /note="gene_id=mCG8772.2 transcript_id=mCT8881.2 created on
FT                   20-MAY-2002"
FT   CDS             join(<5047674..5047919,5054945..5055174,5059290..5060423,
FT                   5062720..5062837)
FT                   /codon_start=1
FT                   /gene="4930430E16Rik"
FT                   /locus_tag="mCG_8772"
FT                   /product="RIKEN cDNA 4930430E16, isoform CRA_b"
FT                   /note="gene_id=mCG8772.2 transcript_id=mCT8881.2
FT                   protein_id=mCP3619.2 isoform=CRA_b"
FT                   /protein_id="EDL07878.1"
FT                   /translation="VAAPARRPGRARALGLGGGAMASPHQEARLAAASLLLSANPITGA
FT                   RVAQYESEDSLESLVAAGLAAAMEEEEQKKVWQMRASAGCHNFSGKDEEVAFESTMNFS
FT                   DIYHSDEEYFRKLKDLKAVHEETMSKLEKMYQDKLNIKDIQAGFIRDGISDSSSSSASE
FT                   KSCSHPALSVTSLSEPDLDGSSSLSTTTDEGLPDLEEKTPGESSAMVHAQELINNMWND
FT                   FSVEDYIQYDSDSRTAKKKRKKAKSLTPKITVPVPFEMTVREQNRREKALSARSDLETK
FT                   LLKRDEDDAECKKKFRANPVPSCVLLPLYEDLVKQSEERRKKARERNRAALLASLKPFK
FT                   FIAREEQKQAVREKKLRDLFRAKRKTNQFKAKPVPRFIYRPAASDKPKEEELYGDSRML
FT                   PKVRDLLQNSPWPSRSACRRFRDPRSPAKPRGKHRRRCLRRDGDLEKWKEPFSEYSFLK
FT                   CPMLCEECCLHESPCDSDKRQKLLADIRADEEILRETRRPGRSPRRKSPGRSSNPKPRP
FT                   HECSPPMPTASSRGREQAIRRSEKARMREYWQELEEQEEKLQKRPMLFERVTQVVFIG"
FT   mRNA            join(<5047835..5047919,5052829..5052937,5054945..5055174,
FT                   5059290..5060423,5062720..5063014)
FT                   /gene="4930430E16Rik"
FT                   /locus_tag="mCG_8772"
FT                   /product="RIKEN cDNA 4930430E16, transcript variant
FT                   mCT190005"
FT                   /note="gene_id=mCG8772.2 transcript_id=mCT190005.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5052902..5052937,5054945..5055174,5059290..5060423,
FT                   5062720..5062837)
FT                   /codon_start=1
FT                   /gene="4930430E16Rik"
FT                   /locus_tag="mCG_8772"
FT                   /product="RIKEN cDNA 4930430E16, isoform CRA_a"
FT                   /note="gene_id=mCG8772.2 transcript_id=mCT190005.0
FT                   protein_id=mCP111007.0 isoform=CRA_a"
FT                   /protein_id="EDL07877.1"
FT                   /translation="SASFCLPSVGIKAGCHNFSGKDEEVAFESTMNFSDIYHSDEEYFR
FT                   KLKDLKAVHEETMSKLEKMYQDKLNIKDIQAGFIRDGISDSSSSSASEKSCSHPALSVT
FT                   SLSEPDLDGSSSLSTTTDEGLPDLEEKTPGESSAMVHAQELINNMWNDFSVEDYIQYDS
FT                   DSRTAKKKRKKAKSLTPKITVPVPFEMTVREQNRREKALSARSDLETKLLKRDEDDAEC
FT                   KKKFRANPVPSCVLLPLYEDLVKQSEERRKKARERNRAALLASLKPFKFIAREEQKQAV
FT                   REKKLRDLFRAKRKTNQFKAKPVPRFIYRPAASDKPKEEELYGDSRMLPKVRDLLQNSP
FT                   WPSRSACRRFRDPRSPAKPRGKHRRRCLRRDGDLEKWKEPFSEYSFLKCPMLCEECCLH
FT                   ESPCDSDKRQKLLADIRADEEILRETRRPGRSPRRKSPGRSSNPKPRPHECSPPMPTAS
FT                   SRGREQAIRRSEKARMREYWQELEEQEEKLQKRPMLFERVTQVVFIG"
FT   gene            5107351..5115057
FT                   /locus_tag="mCG_147221"
FT                   /note="gene_id=mCG147221.0"
FT   mRNA            join(5107351..5107761,5112362..5115057)
FT                   /locus_tag="mCG_147221"
FT                   /product="mCG147221"
FT                   /note="gene_id=mCG147221.0 transcript_id=mCT187484.0
FT                   created on 13-JAN-2004"
FT   CDS             join(5107631..5107761,5112362..5112464)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147221"
FT                   /product="mCG147221"
FT                   /note="gene_id=mCG147221.0 transcript_id=mCT187484.0
FT                   protein_id=mCP108856.0"
FT                   /protein_id="EDL07879.1"
FT                   /translation="MTGVVEAGGLLRILLHLGLHTEIVSKTTEWGKLSEVIVYVGNQRF
FT                   QENAPMCAASRILEIQRLLHPSTNLLHHLRST"
FT   gene            <5191640..5205881
FT                   /locus_tag="mCG_145094"
FT                   /note="gene_id=mCG145094.0"
FT   mRNA            join(<5191640..5191737,5204677..5204817,5205584..5205881)
FT                   /locus_tag="mCG_145094"
FT                   /product="mCG145094"
FT                   /note="gene_id=mCG145094.0 transcript_id=mCT184518.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<5204748..5204817,5205584..5205726)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145094"
FT                   /product="mCG145094"
FT                   /note="gene_id=mCG145094.0 transcript_id=mCT184518.0
FT                   protein_id=mCP105190.0"
FT                   /protein_id="EDL07880.1"
FT                   /translation="CLNLPSASRTGVSYHTRLDQHWFACEVSSLQYNLQLLFSLWNKTS
FT                   FSGCSPGSQQRRMRESKSRSTDTRR"
FT   gene            5287260..5327887
FT                   /gene="Xpo1"
FT                   /locus_tag="mCG_8765"
FT                   /note="gene_id=mCG8765.1"
FT   mRNA            join(5287260..5287566,5292693..5292824,5298520..5298621,
FT                   5302001..5302073,5307295..5307356,5307904..5307948,
FT                   5309674..5309793,5311242..5311370,5312174..5312332,
FT                   5313397..5313594,5315110..5315248,5315416..5315597,
FT                   5315680..5315836,5315924..5316087,5316669..5316803,
FT                   5317613..5317796,5318213..5318319,5320626..5320820,
FT                   5322338..5322506,5324648..5324782,5324865..5325024,
FT                   5325472..5325568,5326837..5327887)
FT                   /gene="Xpo1"
FT                   /locus_tag="mCG_8765"
FT                   /product="exportin 1, CRM1 homolog (yeast), transcript
FT                   variant mCT8876"
FT                   /note="gene_id=mCG8765.1 transcript_id=mCT8876.2 created on
FT                   14-FEB-2003"
FT   mRNA            join(5292691..5292824,5298520..5298621,5302001..5302073,
FT                   5307295..5307356,5307904..5307948,5309011..5309192,
FT                   5309544..5309592,5309674..5309793,5311242..5311370,
FT                   5312174..5312332,5313397..5313594,5315110..5315248,
FT                   5315416..5315597,5315680..5315836,5315924..5316087,
FT                   5316669..5316803,5317613..5317796,5318213..5318319,
FT                   5320626..5320820,5322338..5322506,5324648..5324782,
FT                   5324865..5325024,5325472..5325568,5326837..5327148)
FT                   /gene="Xpo1"
FT                   /locus_tag="mCG_8765"
FT                   /product="exportin 1, CRM1 homolog (yeast), transcript
FT                   variant mCT180365"
FT                   /note="gene_id=mCG8765.1 transcript_id=mCT180365.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(5292699..5292824,5298520..5298621,5302001..5302073,
FT                   5307295..5307356,5307904..5307948,5309011..5309192,
FT                   5309544..5309592,5309674..5309793,5311242..5311370,
FT                   5312174..5312332,5313397..5313594,5315110..5315248,
FT                   5315416..5315597,5315680..5315836,5315924..5316087,
FT                   5316669..5316803,5317613..5317796,5318213..5318319,
FT                   5320626..5320820,5322338..5322506,5324648..5324782,
FT                   5324865..5325024,5325472..5325568,5326837..5326983)
FT                   /codon_start=1
FT                   /gene="Xpo1"
FT                   /locus_tag="mCG_8765"
FT                   /product="exportin 1, CRM1 homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG8765.1 transcript_id=mCT180365.0
FT                   protein_id=mCP103287.0 isoform=CRA_a"
FT                   /protein_id="EDL07881.1"
FT                   /translation="MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRM
FT                   AQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKK
FT                   YVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESL
FT                   CQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLV
FT                   HATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEE
FT                   QFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKR
FT                   LNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQH
FT                   FDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMR
FT                   ETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFL
FT                   VTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHET
FT                   HDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYE
FT                   AVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKT
FT                   NVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKR
FT                   ETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLG
FT                   GHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQF
FT                   KLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVV
FT                   TDTSHTAGLTMHASILAYMFNLVEEGKISTPLNPGNPVNNQMFIQDYVANLLKSAFPHL
FT                   QDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEE
FT                   KHKLQMSVPGILNPHEIPEEMCD"
FT   CDS             join(5292699..5292824,5298520..5298621,5302001..5302073,
FT                   5307295..5307356,5307904..5307948,5309674..5309793,
FT                   5311242..5311370,5312174..5312332,5313397..5313594,
FT                   5315110..5315248,5315416..5315597,5315680..5315836,
FT                   5315924..5316087,5316669..5316803,5317613..5317796,
FT                   5318213..5318319,5320626..5320820,5322338..5322506,
FT                   5324648..5324782,5324865..5325024,5325472..5325568,
FT                   5326837..5326983)
FT                   /codon_start=1
FT                   /gene="Xpo1"
FT                   /locus_tag="mCG_8765"
FT                   /product="exportin 1, CRM1 homolog (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG8765.1 transcript_id=mCT8876.2
FT                   protein_id=mCP3609.2 isoform=CRA_b"
FT                   /protein_id="EDL07882.1"
FT                   /translation="MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRM
FT                   AQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKK
FT                   YVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQENSQNAPLVHATLETLLRFLNWIPLGY
FT                   IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLP
FT                   LNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVS
FT                   EVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVR
FT                   LLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIM
FT                   TKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKD
FT                   NKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQK
FT                   CRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHL
FT                   IEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGR
FT                   IYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQM
FT                   VAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECT
FT                   LNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNV
FT                   ADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAY
FT                   MFNLVEEGKISTPLNPGNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQD
FT                   IPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIP
FT                   EEMCD"
FT   gene            <5337785..5522090
FT                   /locus_tag="mCG_140384"
FT                   /note="gene_id=mCG140384.0"
FT   mRNA            join(<5337785..5337827,5351817..5351904,5365197..5365345,
FT                   5374832..5374882,5375023..5375172,5376662..5376729,
FT                   5380663..5380855,5383175..5383236,5386428..5386509,
FT                   5386589..5386681,5392862..5392987,5393170..5393299,
FT                   5394160..5394195,5394641..5394771,5395374..5396095,
FT                   5398922..5399136,5401822..5401937,5402027..5402154,
FT                   5404904..5404993,5406584..5406679,5409138..5409220,
FT                   5412809..5412963,5414138..5414251,5415985..5416084,
FT                   5416597..5416756,5420018..5420144,5420248..5420395,
FT                   5424426..5424526,5425337..5425546,5433061..5433186,
FT                   5435168..5435290,5435420..5435503,5437475..5437561,
FT                   5443823..5444023,5446344..5446426,5449071..5449111,
FT                   5449257..5449381,5450587..5450739,5451648..5451752,
FT                   5452706..5452761,5452854..5452974,5457670..5457853,
FT                   5458243..5458403,5460908..5460973,5463854..5464000,
FT                   5464086..5464142,5464227..5464304,5464788..5464882,
FT                   5467515..5467687,5470475..5470628,5472708..5472786,
FT                   5475716..5475769,5475875..5475970,5478001..5478065,
FT                   5478148..5478223,5478313..5478360,5478487..5478552,
FT                   5480786..5480866,5483555..5483640,5484078..5484246,
FT                   5484350..5484424,5486084..5486235,5489357..5489405,
FT                   5489491..5489595,5489674..5489722,5490687..5490787,
FT                   5492121..5492268,5495776..5496410,5498701..5498858,
FT                   5500360..5500438,5501844..5501970,5503037..5503144,
FT                   5504505..5504609,5504725..5504849,5505821..5505944,
FT                   5515658..5515737,5518374..5518514,5518635..5518778,
FT                   5519765..5519924,5520140..5522090)
FT                   /locus_tag="mCG_140384"
FT                   /product="mCG140384"
FT                   /note="gene_id=mCG140384.0 transcript_id=mCT169346.0
FT                   created on 21-MAY-2002"
FT   CDS             join(<5365277..5365345,5374832..5374882,5375023..5375172,
FT                   5376662..5376729,5380663..5380855,5383175..5383236,
FT                   5386428..5386509,5386589..5386681,5392862..5392987,
FT                   5393170..5393299,5394160..5394195,5394641..5394771,
FT                   5395374..5396095,5398922..5399136,5401822..5401937,
FT                   5402027..5402154,5404904..5404993,5406584..5406679,
FT                   5409138..5409220,5412809..5412963,5414138..5414251,
FT                   5415985..5416084,5416597..5416756,5420018..5420144,
FT                   5420248..5420395,5424426..5424526,5425337..5425546,
FT                   5433061..5433186,5435168..5435290,5435420..5435503,
FT                   5437475..5437561,5443823..5444023,5446344..5446426,
FT                   5449071..5449111,5449257..5449381,5450587..5450739,
FT                   5451648..5451752,5452706..5452761,5452854..5452974,
FT                   5457670..5457853,5458243..5458403,5460908..5460973,
FT                   5463854..5464000,5464086..5464142,5464227..5464304,
FT                   5464788..5464882,5467515..5467687,5470475..5470628,
FT                   5472708..5472786,5475716..5475769,5475875..5475970,
FT                   5478001..5478065,5478148..5478223,5478313..5478360,
FT                   5478487..5478552,5480786..5480866,5483555..5483640,
FT                   5484078..5484246,5484350..5484424,5486084..5486235,
FT                   5489357..5489405,5489491..5489595,5489674..5489722,
FT                   5490687..5490787,5492121..5492268,5495776..5496410,
FT                   5498701..5498858,5500360..5500438,5501844..5501970,
FT                   5503037..5503144,5504505..5504609,5504725..5504849,
FT                   5505821..5505944,5515658..5515737,5518374..5518514,
FT                   5518635..5518778,5519765..5519924,5520140..5520744)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140384"
FT                   /product="mCG140384"
FT                   /note="gene_id=mCG140384.0 transcript_id=mCT169346.0
FT                   protein_id=mCP92029.0"
FT                   /protein_id="EDL07883.1"
FT                   /translation="AKIFQIQFPLYTAYKHNTHPTIEDISTQESNILGAFCDMNDVEVP
FT                   LHLLRYVCLFCGKNGLSLMKDCFEYGTPETLPFLIAHAFITVVSNIRIWLHIPAVMQHI
FT                   IPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTVKEPLDTTLCFDKESLDLAFKYFMS
FT                   PTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSIAKELADWLISNNVVEHIFGPNL
FT                   HIEIIKQCQVILNFLAAEGRLSTQHIDCIWAAAQLKHCSRYIHDLFPSLIKNLDPVPLR
FT                   HLLNLVSALEPGVHTEQTLYLASMLIKALWNNALAAKAQLSKQSSFASLLNTNMPIGNK
FT                   KEEEELRRAAPSPWSPAASPQSSDNSDTHQSGASDIEMDEQLINRNKHVQQRLSDTEES
FT                   MQGSSDETANSGEDGSSGPGSSSGHSDGSSNEVNSSHASQSAGSPGSEVQSEDIADIEA
FT                   LKEEEEEEEEEEEEEEEEDDEEEEDEEEDDDDDDDHGHNPAKNTCGTELRNRKLENPAG
FT                   ICLGESQGTSERNGTNSGTGKDLVFNTEPLPSVDNRIRMLDACAHSEDPEHGISGEVSS
FT                   AHLAQGSQEACITRSGDFLGETIGNELFNCRQFIGPQHHHHHHHHHHHHHHHHHHHHHH
FT                   HDGHMVDDMLSADDVSCSSSQVSAKSEKNMADFDGEESGCEEELVQINSHAELTSHLQQ
FT                   HLPNLASIYHEHLSQGPAVHKHQFSSNAVTDINLDNVCKKGNTLLWDIVQDDDAINLSE
FT                   GLINEAEKLLCSLVCWFTDRQIRMRFIEGCLENLGNNRSVVISLRLLPKLFGTFQQFGS
FT                   SYDTHWITMWAEKELNMMKLFFDNLVYYIQGIREGRQKHALYSHSAEVQVRLQFLTCVF
FT                   STLGSPDHFRLSLEQVDILWHCLVEDSECYDDALHWFLNQVRSKDQHAMGMETYKHLFL
FT                   EKMPQLKPETISMTGLNLFQHLCNLARLATSAYDGGSNSELCGMDQFWGIALRAQSGDV
FT                   SRAAIQYINSYYINGKTGLEKEQEFISKCMESLMIASSSLEQESHSSLTVIERGLLMLK
FT                   THLEAFRRRFAYHLRQWQIEGTGISSHLKALSDKQSLPLRVVCQPAGLPDKMTIEMYPS
FT                   DQVADLRAEVTHWYENLQKEQINQQAQLQEFGQSSRKGEFPGGLMGPVRMISSGHELTT
FT                   DYDEKALHELGFKDMQMVFVSLGAPRRERKGEGVQLPASCLPPPQKDNIPMLLLLQEPH
FT                   LTTLFDLLEMLASFKPPSGKVAVDDSESLKCEELHLHAENLSRRVWELLMLLPTCPNML
FT                   TAFQNVSDEQSNDGLNWKELLKIKSAHKLLYALEIIEALGKPNRRIRRESTGSYSDLYP
FT                   DSDDSSEDQVENSKNSWTCKFVAAGGLQQLLEIFNSAILEPKEQESWTVWQLDCLACLL
FT                   KLICQFAVDPSDLDLAYHDVFAWSGIAESHRKRTWPGKSRKAAGDHAKSLHIPRLTEVF
FT                   LVLVQGTSLIQRLMSVAYTYDNLAPRVLKAQSDHRSRHEVSHYSMWLLVSWAHCCSLVK
FT                   SSLADSDHLQDWLKQLTLLIPETAVRHESCNGLYKLSLSGLDGGDSIHRSFLLLAASTL
FT                   LKFLPDAQALKPPRIDDYEEEPLLKPGCKEYFWLLCKLVDNIHIKDASQTTLLDLDALA
FT                   RHLADCIRSREILDHLDGSIEDDGLSGLLRLATSVIKHKPPFKFSREGQEFLRDIFNLL
FT                   FLLPSLKDRRQPKCKSHSCRAAAYDLLVEMVKGSVENYRLIHNWVMAQHMQSHAPYKWD
FT                   YWPHEDVRAECRFVGLTNLGATCYLASTIQQLYMIPEARQAVFTAKYSEDMKHKTTLLE
FT                   LQKMFTYLMESECKAYNPRPFCKTYTMDKQPLNTGEQKDMTEFFTDLITKVEEMSPELK
FT                   NTVKSLFGGVITNNVVSLDCEHVSQTAEEFYTVRCQVADMKNIYESLDEVTIKDTLEGD
FT                   NMYTCSHCGKKVRAEKRACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMT
FT                   PYTEDFLMGKSDRKEGFKDVGDRSKDTESYEYDLIGVTVHTGTADGGHYYSFIRDIVNP
FT                   HAYKNNKWYLFNDAEVKPFDSAQLASECFGGEMTTKTYDSVTDKFMDFSFEKTHSAYML
FT                   FYKRMEPEEENGREYKFDVSSELLEWIWHDNMQFLQDKNIFEHTYFGFMWQLCSCIPST
FT                   LPDPKAVSLMTAKLSTSFVLETFIHSKEKPTMLQWIELLTKQFNNSQAACEWFLDRMAD
FT                   DDWWPMQILIKCPNQIVRQMFQRLCIHVIQRLRPVHAHLYLQPGMEDGSDDMDASVEDI
FT                   GGRSCVTRFVRTLLLIMEHGVKPHSKHLTEYFAFLYEFAKMGEEESQFLLSLQAISTMV
FT                   HFYMGTKGPENPQVEVLSEEEGEEEEEEEDILSLAEEKYRPAALEKMIALVALLVEQSR
FT                   SERHLTLSQTDMAALTGGKGFPFLFQHIRDGINIRQTCNLIFSLCRYNNRLAEHIVSML
FT                   FTSIAKLTPEVSNPFFKLLTMLMEFAGGPPGMPPFASYILQRIWEVIEYNPSQCLDWLA
FT                   VQTPRNKLAHSWVLQNMENWVERFLLAHNYPRVRTSAAYLLVSLIPSNSFRQMFRSTRS
FT                   LHIPTRDLPLSPDTTVVLHQVYNVLLGLLSRAKLYVDAAVHGTTKLVPYLSFMTYCLIS
FT                   KTEKLMFSTYFMDLWNLFQPKLSEPAIATNHNKQALLSFWYNVCADCPENIRLIVQNPV
FT                   VTKNIAFNYILADHDDQDVVLFNRGMLPAYYGILRLCCEQSPAFTRQLASHQNIQWAFK
FT                   NLTPHASQYPGAVEELFNLMQLFIAQRPDMREEELEDIKQFKKTTISCYLRCLDGRSCW
FT                   TTLISAFRILLESDEDRLLVVFNRGLILMTESFNTLHMMYHEATACHVTGDLVELLSIF
FT                   LSVLKSTRPYLQRKDVKQALIQWQERIEFAHKLLTLLNSYSPPELRNACIDVLKELVLL
FT                   SPHDFLHTLVPFLQHNHCTYHHSNIPMSLGPYFPCRENIKLIGGKSNIRPPRPELNMCL
FT                   LPTMVETSKGKDDVYDRMLLDYFFSYHQFIHLLCRVAINCEKFTETLVKLSVLVAYEGL
FT                   PLHLALFPKLWTELCQTQSAMSKNCIKLLCEDPVFAEYIKCILMDERTFLNNNIVYTFM
FT                   THFLLKVQSQVFSEANCASLISTLITNLINQYQNLQSDFTNRVEISKASAALNGDLRAL
FT                   ALLLSVHTPKQLNPALIPTLQELLNKCRTCLQQRNSLQEQEAKERKTKDDEGATPVKRR
FT                   RVSSDEEHTVDSCIGDIKTETREVLTPTSTSDNETRDSSIIDPGTEQDLPSPENSSVKE
FT                   YRMEGPSSFSEDGSHIRSQHAEEQSNNGRFDDCKEFKDHCSKDTTLAEDESEFPSTSIS
FT                   AVLSDLADLRSCDGQALSSQDPEAAVSLSCGHSRGLISHMQQHDILDTLCRTIESTIHV
FT                   VTRISGKGNQAAS"
FT   gene            complement(5519439..>5529504)
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /note="gene_id=mCG146075.1"
FT   mRNA            complement(join(5519439..5522126,5522225..5522276,
FT                   5522569..5522670,5523031..5523138,5523774..5523862,
FT                   5524835..5524949,5526535..5526620,5528247..5528432,
FT                   5529331..>5529486))
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /product="RIKEN cDNA 1110064P04, transcript variant
FT                   mCT186178"
FT                   /note="gene_id=mCG146075.1 transcript_id=mCT186178.0
FT                   created on 14-JUL-2003"
FT   mRNA            complement(join(5520105..5522126,5522225..5522276,
FT                   5522569..5522670,5523031..5523138,5523774..5523862,
FT                   5524835..5524949,5526535..5526620,5528247..5528437,
FT                   5529058..>5529096))
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /product="RIKEN cDNA 1110064P04, transcript variant
FT                   mCT190009"
FT                   /note="gene_id=mCG146075.1 transcript_id=mCT190009.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(5521293..5522145,5522225..5522276,
FT                   5522569..5522670,5523031..5523138,5523774..5523862,
FT                   5524835..5524949,5526535..5526620,5528247..5528437,
FT                   5529331..>5529501))
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /product="RIKEN cDNA 1110064P04, transcript variant
FT                   mCT190008"
FT                   /note="gene_id=mCG146075.1 transcript_id=mCT190008.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(5521301..5522126,5522225..5522276,
FT                   5522569..5522670,5523031..5523138,5523774..5523862,
FT                   5524835..5524949,5526535..5526620,5528247..5528437,
FT                   5529331..>5529504))
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /product="RIKEN cDNA 1110064P04, transcript variant
FT                   mCT190007"
FT                   /note="gene_id=mCG146075.1 transcript_id=mCT190007.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(5521954..5522126,5522225..5522276,
FT                   5522569..5522670,5523031..5523138,5523774..5523862,
FT                   5524835..5524949,5526535..5526620,5528247..5528437,
FT                   5529331..>5529503))
FT                   /codon_start=1
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /product="RIKEN cDNA 1110064P04, isoform CRA_b"
FT                   /note="gene_id=mCG146075.1 transcript_id=mCT190007.0
FT                   protein_id=mCP111001.0 isoform=CRA_b"
FT                   /protein_id="EDL07885.1"
FT                   /translation="HFLGAAGDRLTDLLAGNPRAPATRAVVVSAAMAKWGQGDPRWIVE
FT                   EREDGTNVNNWHWTERDATIWSKGKLRELLVGIAMENEAGRCEISELKQVEGEASCNSR
FT                   KGKLIFFYEWNIKLAWKGTVKESGAKHKGLIEIPSLSEENEINDTEVNVSKKKGDGEIL
FT                   KDLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAVATQELTLQRKLNENKLQASPV
FT                   ALGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNI
FT                   SGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKEENMK
FT                   FCWQKQHFEEIKGLLELTAQNA"
FT   CDS             complement(join(5521954..5522126,5522225..5522276,
FT                   5522569..5522670,5523031..5523138,5523774..5523862,
FT                   5524835..5524949,5526535..5526620,5528247..5528432,
FT                   5529331..>5529343))
FT                   /codon_start=1
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /product="RIKEN cDNA 1110064P04, isoform CRA_a"
FT                   /note="gene_id=mCG146075.1 transcript_id=mCT186178.0
FT                   protein_id=mCP107296.0 isoform=CRA_a"
FT                   /protein_id="EDL07884.1"
FT                   /translation="TTGTERDATIWSKGKLRELLVGIAMENEAGRCEISELKQVEGEAS
FT                   CNSRKGKLIFFYEWNIKLAWKGTVKESGAKHKGLIEIPSLSEENEINDTEVNVSKKKGD
FT                   GEILKDLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAVATQELTLQRKLNENKLQ
FT                   ASPVALGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMF
FT                   DGNISGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKE
FT                   ENMKFCWQKQHFEEIKGLLELTAQNA"
FT   CDS             complement(join(5521954..5522126,5522225..5522276,
FT                   5522569..5522670,5523031..5523138,5523774..5523862,
FT                   5524835..5524949,5526535..5526620,5528247..5528437,
FT                   5529058..>5529095))
FT                   /codon_start=1
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /product="RIKEN cDNA 1110064P04, isoform CRA_d"
FT                   /note="gene_id=mCG146075.1 transcript_id=mCT190009.0
FT                   protein_id=mCP111003.0 isoform=CRA_d"
FT                   /protein_id="EDL07887.1"
FT                   /translation="RAPTVLCPCAVGRTERDATIWSKGKLRELLVGIAMENEAGRCEIS
FT                   ELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGTVKESGAKHKGLIEIPSLSEENEINDT
FT                   EVNVSKKKGDGEILKDLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAVATQELTL
FT                   QRKLNENKLQASPVALGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLE
FT                   AERGGKFQMFDGNISGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTELQL
FT                   DCKGVPVCKEENMKFCWQKQHFEEIKGLLELTAQNA"
FT   CDS             complement(join(5522108..5522145,5522225..5522276,
FT                   5522569..5522670,5523031..5523138,5523774..5523862,
FT                   5524835..5524949,5526535..5526620,5528247..5528437,
FT                   5529331..>5529500))
FT                   /codon_start=1
FT                   /gene="1110064P04Rik"
FT                   /locus_tag="mCG_146075"
FT                   /product="RIKEN cDNA 1110064P04, isoform CRA_c"
FT                   /note="gene_id=mCG146075.1 transcript_id=mCT190008.0
FT                   protein_id=mCP111002.0 isoform=CRA_c"
FT                   /protein_id="EDL07886.1"
FT                   /translation="FLGAAGDRLTDLLAGNPRAPATRAVVVSAAMAKWGQGDPRWIVEE
FT                   REDGTNVNNWHWTERDATIWSKGKLRELLVGIAMENEAGRCEISELKQVEGEASCNSRK
FT                   GKLIFFYEWNIKLAWKGTVKESGAKHKGLIEIPSLSEENEINDTEVNVSKKKGDGEILK
FT                   DLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAVATQELTLQRKLNENKLQASPVA
FT                   LGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNIS
FT                   GEYVELVTNRKIIMKWRCRNWPEALGFFPRTLCNS"
FT   gene            <5529311..5531196
FT                   /locus_tag="mCG_146074"
FT                   /note="gene_id=mCG146074.0"
FT   mRNA            join(<5529311..5529467,5530018..5530145,5530942..5531196)
FT                   /locus_tag="mCG_146074"
FT                   /product="mCG146074"
FT                   /note="gene_id=mCG146074.0 transcript_id=mCT186177.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<5530120..5530145,5530942..5531158)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146074"
FT                   /product="mCG146074"
FT                   /note="gene_id=mCG146074.0 transcript_id=mCT186177.0
FT                   protein_id=mCP107295.0"
FT                   /protein_id="EDL07888.1"
FT                   /translation="QKLKPPSGKNDKTMEKENPCLAVSLKTADQRGRSPATDGREMTWT
FT                   VGCSGKEAMISGHEKWSHTRLTGCWWEAEGCTLKL"
FT   gene            complement(5547670..5552580)
FT                   /gene="1700093K21Rik"
FT                   /locus_tag="mCG_8766"
FT                   /note="gene_id=mCG8766.2"
FT   mRNA            complement(join(5547670..5548031,5548633..5548801,
FT                   5549462..5549563,5550206..5550401,5550494..5550526,
FT                   5550923..5551042,5552049..5552580))
FT                   /gene="1700093K21Rik"
FT                   /locus_tag="mCG_8766"
FT                   /product="RIKEN cDNA 1700093K21"
FT                   /note="gene_id=mCG8766.2 transcript_id=mCT8873.1 created on
FT                   21-MAY-2002"
FT   CDS             complement(join(5547861..5548031,5548633..5548801,
FT                   5549462..5549563,5550206..5550354))
FT                   /codon_start=1
FT                   /gene="1700093K21Rik"
FT                   /locus_tag="mCG_8766"
FT                   /product="RIKEN cDNA 1700093K21"
FT                   /note="gene_id=mCG8766.2 transcript_id=mCT8873.1
FT                   protein_id=mCP3598.1"
FT                   /protein_id="EDL07889.1"
FT                   /translation="MFTQSDTGKIEEIFTTNTMAFETTAITFFFILLICFICILLLLAI
FT                   FLYKCYRGHNHEEPLKTLCTGEGCVAANAEMDKPEDQDKVLMHFLNMGLPMKPSILVQK
FT                   QSKEEMATSLGDNIKAEDYQKKQTYEPVNARETNHEGELAEKMPIHVHRSSDTGSQKRP
FT                   LKGVTFSKEVIVVDLGNEYPTPRSYAREHKERK"
FT   gene            complement(5599283..5659160)
FT                   /gene="0610010F05Rik"
FT                   /locus_tag="mCG_120830"
FT                   /note="gene_id=mCG120830.1"
FT   mRNA            complement(join(5599283..5601027,5602241..5602332,
FT                   5607106..5607194,5608377..5608450,5608608..5608636,
FT                   5610030..5610121,5614149..5614248,5615465..5615497,
FT                   5618919..5619018,5620874..5621019,5632138..5632290,
FT                   5634526..5634649,5637272..5637382,5637487..5637573,
FT                   5640621..5640781,5642663..5642721,5645754..5645992,
FT                   5647961..5648054,5650461..5650647,5654416..5654574,
FT                   5656748..5656877,5659036..5659160))
FT                   /gene="0610010F05Rik"
FT                   /locus_tag="mCG_120830"
FT                   /product="RIKEN cDNA 0610010F05, transcript variant
FT                   mCT122022"
FT                   /note="gene_id=mCG120830.1 transcript_id=mCT122022.1
FT                   created on 21-MAY-2002"
FT   mRNA            complement(join(5599296..5601027,5602241..5602332,
FT                   5607106..5607194,5608377..5608450,5608608..5608636,
FT                   5610030..5610121,5614149..5614248,5615465..5615497,
FT                   5618919..5619018,5620874..5621019,5632138..5632290,
FT                   5634526..5634649,5637272..5637382,5637470..5637573,
FT                   5640621..5640781,5642663..5642721,5645754..5645992,
FT                   5647961..5648054,5650461..5650647,5654416..5654574,
FT                   5656748..5656877,5657061..5657098,5657319..>5657426))
FT                   /gene="0610010F05Rik"
FT                   /locus_tag="mCG_120830"
FT                   /product="RIKEN cDNA 0610010F05, transcript variant
FT                   mCT190018"
FT                   /note="gene_id=mCG120830.1 transcript_id=mCT190018.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(5600991..5601027,5602241..5602332,
FT                   5607106..5607194,5608377..5608450,5608608..5608636,
FT                   5610030..5610121,5614149..5614248,5615465..5615497,
FT                   5618919..5619018,5620874..5621019,5632138..5632290,
FT                   5634526..5634649,5637272..5637382,5637487..5637573,
FT                   5640621..5640781,5642663..5642721,5645754..5645992,
FT                   5647961..5648054,5650461..5650647,5654416..5654565))
FT                   /codon_start=1
FT                   /gene="0610010F05Rik"
FT                   /locus_tag="mCG_120830"
FT                   /product="RIKEN cDNA 0610010F05, isoform CRA_a"
FT                   /note="gene_id=mCG120830.1 transcript_id=mCT122022.1
FT                   protein_id=mCP71449.1 isoform=CRA_a"
FT                   /protein_id="EDL07890.1"
FT                   /translation="MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPG
FT                   LTPKECVKRFDELKSCGSSPVDNQYNPLMATGEGPVETLATYIKSSLLDTQGDFQETPV
FT                   DQDTVSKAGRHSIATTRNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKEDFI
FT                   CPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPA
FT                   LEPGNVISILISSEFLKMDSLVEQCIQYCHKNMNAIVAAPCNMNCINANLLTRIADLFT
FT                   HNEIDDLKDKKDKFRSKLFCKKIERLFDPEYSNPDSRNNAATLYRCCLCKKLLTRETER
FT                   RIPCIPGKINVDRHGNIIYIHIRDKTWDVHEYLNSLFEELKSWRDVYWRLWGTVNWLTC
FT                   SRCYQAFLCIEFSHCQYHSEVVVYSSTVNSLNTVGTGIYPCCNQKVLRFDPTQLTKGCK
FT                   VRDHMVVLHDQGENDDSPSCPPAKILDDLHKHKDVIAVPFLKDAVSDPGVGSCDEKGLE
FT                   YEILLEPNTPWGSKTGELNAFLSLKNWTLQLKQQSLFSEEEEYTTGSEVTEDEVGDEEE
FT                   IAKKQRKKEKPKKFTKPPKKQLSSPCSQKKEKTLEKSTSRDVSPFVVSMQKNKWDASRS
FT                   LRFNQDAQREDDQRRMSEITGHLIKMRLGDLDRVKAKESKEFAGGIYSRLEAQVRASVP
FT                   VTARQNSSDKNQRSKSRFGQGRPA"
FT   CDS             complement(join(5600991..5601027,5602241..5602332,
FT                   5607106..5607194,5608377..5608450,5608608..5608636,
FT                   5610030..5610121,5614149..5614248,5615465..5615497,
FT                   5618919..5619018,5620874..5621019,5632138..5632290,
FT                   5634526..5634649,5637272..>5637381))
FT                   /codon_start=1
FT                   /gene="0610010F05Rik"
FT                   /locus_tag="mCG_120830"
FT                   /product="RIKEN cDNA 0610010F05, isoform CRA_b"
FT                   /note="gene_id=mCG120830.1 transcript_id=mCT190018.0
FT                   protein_id=mCP110996.0 isoform=CRA_b"
FT                   /protein_id="EDL07891.1"
FT                   /translation="CCLCKKLLTRETERRIPCIPGKINVDRHGNIIYIHIRDKTWDVHE
FT                   YLNSLFEELKSWRDVYWRLWGTVNWLTCSRCYQAFLCIEFSHCQYHSEVVVYSSTVNSL
FT                   NTVGTGIYPCCNQKVLRFDPTQLTKGCKVRDHMVVLHDQGENDDSPSCPPAKILDDLHK
FT                   HKDVIAVPFLKDAVSDPGVGSCDEKGLEYEILLEPNTPWGSKTGELNAFLSLKNWTLQL
FT                   KQQSLFSEEEEYTTGSEVTEDEVGDEEEIAKKQRKKEKPKKFTKPPKKQLSSPCSQKKE
FT                   KTLEKSTSRDVSPFVVSMQKNKWDASRSLRFNQDAQREDDQRRMSEITGHLIKMRLGDL
FT                   DRVKAKESKEFAGGIYSRLEAQVRASVPVTARQNSSDKNQRSKSRFGQGRPA"
FT   gene            complement(5672069..5691451)
FT                   /gene="Pex13"
FT                   /locus_tag="mCG_8768"
FT                   /note="gene_id=mCG8768.2"
FT   mRNA            complement(join(5672069..5675135,5676475..5676600,
FT                   5680982..5681676,5691293..5691451))
FT                   /gene="Pex13"
FT                   /locus_tag="mCG_8768"
FT                   /product="peroxisomal biogenesis factor 13"
FT                   /note="gene_id=mCG8768.2 transcript_id=mCT8878.1 created on
FT                   21-MAY-2002"
FT   CDS             complement(join(5674837..5675135,5676475..5676600,
FT                   5680982..5681676,5691293..5691390))
FT                   /codon_start=1
FT                   /gene="Pex13"
FT                   /locus_tag="mCG_8768"
FT                   /product="peroxisomal biogenesis factor 13"
FT                   /note="gene_id=mCG8768.2 transcript_id=mCT8878.1
FT                   protein_id=mCP3600.1"
FT                   /protein_id="EDL07892.1"
FT                   /translation="MASQPPPPPKPWESRRIPGAGPGPGSGPGPTYQSADLGPTLLTRP
FT                   GQPTLTRVPPPILPRPSQQTGSNNVNTFRPAYSSFSSGYGAYGNSFYGSYSPYSYGYNG
FT                   LGFNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAV
FT                   LDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQWMMGLRRGSENEDLWAESEGTVAC
FT                   LSAEDQATNSAKSWPIFLFFAVILGGPYLIWKLLSTHNDEVTDNTNWASGEDDHVVARA
FT                   EYDFVAVSDEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRR
FT                   GRKTIESSTMLKQQQSFTNPTLIKGVTTTNPLDEQEAAFESVFVETNKVSSAPDSTGKN
FT                   GDKQDL"
FT   gene            5691003..5758548
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /note="gene_id=mCG8778.2"
FT   mRNA            join(5691003..5691294,5692834..5692960,5698058..5698306,
FT                   5698788..5698874,5725462..5725496,5728422..5728533,
FT                   5732417..5732478,5733055..5733100,5734290..5734354,
FT                   5736728..5736813,5737732..5737857,5743094..5743150,
FT                   5744108..5744336,5745636..5745753,5751103..5751245,
FT                   5754646..5754745,5756993..5758547)
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /product="RIKEN cDNA 4933435A13, transcript variant
FT                   mCT8888"
FT                   /note="gene_id=mCG8778.2 transcript_id=mCT8888.2 created on
FT                   06-FEB-2003"
FT   mRNA            join(<5691219..5691294,5692834..5692960,5698058..5698306,
FT                   5698788..5698874,5725462..5725496,5728422..5728533,
FT                   5732417..5732478,5733055..5733100,5734290..5734354,
FT                   5736728..5736813,5737732..5737857,5743094..5743150,
FT                   5744108..5744184,5744281..5744336,5745636..5745753,
FT                   5751103..5751245,5754646..5754745,5756993..5758548)
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /product="RIKEN cDNA 4933435A13, transcript variant
FT                   mCT190014"
FT                   /note="gene_id=mCG8778.2 transcript_id=mCT190014.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5691221..5691294,5692834..5692960,5698058..5698306,
FT                   5698788..5698874,5725462..5725496,5728422..5728533,
FT                   5732417..5732478,5733055..5733100,5734290..5734354,
FT                   5736728..5736813,5737732..5737857,5743094..5743150,
FT                   5744108..5744184,5744281..5744336,5745636..5745753,
FT                   5751103..5751245,5754646..5754745,5756993..5757031)
FT                   /codon_start=1
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /product="RIKEN cDNA 4933435A13, isoform CRA_b"
FT                   /note="gene_id=mCG8778.2 transcript_id=mCT190014.0
FT                   protein_id=mCP111008.0 isoform=CRA_b"
FT                   /protein_id="EDL07894.1"
FT                   /translation="TASTASCQVPALASKVAAQTPHTHCMLPLTEENKHVAQLLFSSGT
FT                   CPRCILRFCGVDLPAPYKHPSKELLNELQKFLEPEKPELILEAPNPPLKKIRLHEDGID
FT                   NLSEDGKEGVSVTEDESMAEKPSKLRVCNVCLGILQEFCEKGFITKVCQKVEASGFEFT
FT                   SVVLSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRNDVVQLKEAYKWITHPLFSEELG
FT                   VPTDGKSLFEVSVVFAHPETAEDCHFLGEVCRDCFKPAKNKQSVFTRMAVLKALSKIKE
FT                   EDFLGQFPCPPNSPKTVCTVLEVECTHGAVFVAGRYNKYSRNLPQTPWIIDGERKMESS
FT                   VEELISDHLLAVFRAESFNFSSSGREDVDVRTLGNGRPFAVELLNPHRVHFTSQEMKEL
FT                   QQTINKSSDKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWTNRAIQKKDIGFLDDL
FT                   KDLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDEHHFRLHLKTQAGTYIKEFVHGDF
FT                   GRTKPNLGSLMNVTADILELDVESVDVDWPPALDD"
FT   mRNA            join(5691243..5691294,5692824..5692960,5698058..5698306,
FT                   5698788..5698874,5725462..5725496,5728422..5728533,
FT                   5732417..5732478,5733055..5733100,5734290..5734354,
FT                   5736728..5736813,5737732..5737857,5743094..5743150,
FT                   5744108..5744184,5744281..5744336,5745636..5745753,
FT                   5751103..5751245,5754646..5754745,5756993..5757197)
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /product="RIKEN cDNA 4933435A13, transcript variant
FT                   mCT179744"
FT                   /note="gene_id=mCG8778.2 transcript_id=mCT179744.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(<5691934..5691999,5692824..5692960,5698058..5698306,
FT                   5698788..5698874,5725462..5725496,5728422..5728533,
FT                   5732417..5732478,5733055..5733100,5734290..5734354,
FT                   5736728..5736813,5737732..5737857,5743094..5743150,
FT                   5744108..5744184,5744281..5744336,5745636..5745753,
FT                   5751103..5751245,5754646..5754745,5756993..5758540)
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /product="RIKEN cDNA 4933435A13, transcript variant
FT                   mCT190015"
FT                   /note="gene_id=mCG8778.2 transcript_id=mCT190015.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5691936..5691999,5692824..5692960,5698058..5698306,
FT                   5698788..5698874,5725462..5725496,5728422..5728533,
FT                   5732417..5732478,5733055..5733100,5734290..5734354,
FT                   5736728..5736813,5737732..5737857,5743094..5743150,
FT                   5744108..5744184,5744281..5744336,5745636..5745753,
FT                   5751103..5751245,5754646..5754745,5756993..5757031)
FT                   /codon_start=1
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /product="RIKEN cDNA 4933435A13, isoform CRA_c"
FT                   /note="gene_id=mCG8778.2 transcript_id=mCT190015.0
FT                   protein_id=mCP111009.0 isoform=CRA_c"
FT                   /protein_id="EDL07895.1"
FT                   /translation="LFPVPTQGRKGLRLGCGILGEVSSSMLPLTEENKHVAQLLFSSGT
FT                   CPRCILRFCGVDLPAPYKHPSKELLNELQKFLEPEKPELILEAPNPPLKKIRLHEDGID
FT                   NLSEDGKEGVSVTEDESMAEKPSKLRVCNVCLGILQEFCEKGFITKVCQKVEASGFEFT
FT                   SVVLSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRNDVVQLKEAYKWITHPLFSEELG
FT                   VPTDGKSLFEVSVVFAHPETAEDCHFLGEVCRDCFKPAKNKQSVFTRMAVLKALSKIKE
FT                   EDFLGQFPCPPNSPKTVCTVLEVECTHGAVFVAGRYNKYSRNLPQTPWIIDGERKMESS
FT                   VEELISDHLLAVFRAESFNFSSSGREDVDVRTLGNGRPFAVELLNPHRVHFTSQEMKEL
FT                   QQTINKSSDKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWTNRAIQKKDIGFLDDL
FT                   KDLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDEHHFRLHLKTQAGTYIKEFVHGDF
FT                   GRTKPNLGSLMNVTADILELDVESVDVDWPPALDD"
FT   CDS             join(5692835..5692960,5698058..5698306,5698788..5698874,
FT                   5725462..5725496,5728422..5728533,5732417..5732478,
FT                   5733055..5733100,5734290..5734354,5736728..5736813,
FT                   5737732..5737857,5743094..5743150,5744108..5744336,
FT                   5745636..5745753,5751103..5751245,5754646..5754745,
FT                   5756993..5757031)
FT                   /codon_start=1
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /product="RIKEN cDNA 4933435A13, isoform CRA_d"
FT                   /note="gene_id=mCG8778.2 transcript_id=mCT8888.2
FT                   protein_id=mCP3597.2 isoform=CRA_d"
FT                   /protein_id="EDL07896.1"
FT                   /translation="MLPLTEENKHVAQLLFSSGTCPRCILRFCGVDLPAPYKHPSKELL
FT                   NELQKFLEPEKPELILEAPNPPLKKIRLHEDGIDNLSEDGKEGVSVTEDESMAEKPSKL
FT                   RVCNVCLGILQEFCEKGFITKVCQKVEASGFEFTSVVLSVSFPPQLSVREHAAWLLVKQ
FT                   EMGKQSLSLGRNDVVQLKEAYKWITHPLFSEELGVPTDGKSLFEVSVVFAHPETAEDCH
FT                   FLGEVCRDCFKPAKNKQSVFTRMAVLKALSKIKEEDFLGQFPCPPNSPKTVCTVLEVEC
FT                   THGAVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAESFNFSSSGR
FT                   EDVDVRTLGNGRPFAVELLNPHRVHFTSQEMKELQQVRAARLRQACVCAELRLSGTESV
FT                   IVFLSPILQTINKSSDKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWTNRAIQKKD
FT                   IGFLDDLKDLKIDQKTPLRVLHRRPLAVRTRAIHSMKTHYLDEHHFRLHLKTQAGTYIK
FT                   EFVHGDFGRTKPNLGSLMNVTADILELDVESVDVDWPPALDD"
FT   CDS             join(5692835..5692960,5698058..5698306,5698788..5698874,
FT                   5725462..5725496,5728422..5728533,5732417..5732478,
FT                   5733055..5733100,5734290..5734354,5736728..5736813,
FT                   5737732..5737857,5743094..5743150,5744108..5744184,
FT                   5744281..5744336,5745636..5745753,5751103..5751245,
FT                   5754646..5754745,5756993..5757031)
FT                   /codon_start=1
FT                   /gene="4933435A13Rik"
FT                   /locus_tag="mCG_8778"
FT                   /product="RIKEN cDNA 4933435A13, isoform CRA_a"
FT                   /note="gene_id=mCG8778.2 transcript_id=mCT179744.0
FT                   protein_id=mCP102666.0 isoform=CRA_a"
FT                   /protein_id="EDL07893.1"
FT                   /translation="MLPLTEENKHVAQLLFSSGTCPRCILRFCGVDLPAPYKHPSKELL
FT                   NELQKFLEPEKPELILEAPNPPLKKIRLHEDGIDNLSEDGKEGVSVTEDESMAEKPSKL
FT                   RVCNVCLGILQEFCEKGFITKVCQKVEASGFEFTSVVLSVSFPPQLSVREHAAWLLVKQ
FT                   EMGKQSLSLGRNDVVQLKEAYKWITHPLFSEELGVPTDGKSLFEVSVVFAHPETAEDCH
FT                   FLGEVCRDCFKPAKNKQSVFTRMAVLKALSKIKEEDFLGQFPCPPNSPKTVCTVLEVEC
FT                   THGAVFVAGRYNKYSRNLPQTPWIIDGERKMESSVEELISDHLLAVFRAESFNFSSSGR
FT                   EDVDVRTLGNGRPFAVELLNPHRVHFTSQEMKELQQTINKSSDKIQVRDLQLVTREAIG
FT                   HMKEGEEEKTKTYSALIWTNRAIQKKDIGFLDDLKDLKIDQKTPLRVLHRRPLAVRTRA
FT                   IHSMKTHYLDEHHFRLHLKTQAGTYIKEFVHGDFGRTKPNLGSLMNVTADILELDVESV
FT                   DVDWPPALDD"
FT   gene            complement(5767190..5796546)
FT                   /gene="Rel"
FT                   /locus_tag="mCG_8770"
FT                   /note="gene_id=mCG8770.2"
FT   mRNA            complement(join(5767190..5768713,5769913..5769981,
FT                   5770111..5770179,5771006..5771218,5771323..5771427,
FT                   5774328..5774468,5778794..5778885,5782476..5782624,
FT                   5786589..5786731,5796256..5796546))
FT                   /gene="Rel"
FT                   /locus_tag="mCG_8770"
FT                   /product="reticuloendotheliosis oncogene"
FT                   /note="gene_id=mCG8770.2 transcript_id=mCT8880.2 created on
FT                   21-MAY-2002"
FT   CDS             complement(join(5767938..5768713,5769913..5769981,
FT                   5770111..5770179,5771006..5771218,5771323..5771427,
FT                   5774328..5774468,5778794..5778885,5782476..5782624,
FT                   5786589..5786731,5796256..5796265))
FT                   /codon_start=1
FT                   /gene="Rel"
FT                   /locus_tag="mCG_8770"
FT                   /product="reticuloendotheliosis oncogene"
FT                   /note="gene_id=mCG8770.2 transcript_id=mCT8880.2
FT                   protein_id=mCP3601.1"
FT                   /db_xref="GOA:A4QPD3"
FT                   /db_xref="InterPro:IPR000451"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR011539"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="MGI:MGI:97897"
FT                   /db_xref="UniProtKB/TrEMBL:A4QPD3"
FT                   /protein_id="EDL07897.1"
FT                   /translation="MASSGYNPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGERSTDNNR
FT                   TYPSVQIMNYYGKGKIRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGPERRPLFFQN
FT                   LGIRCVKKKEVKEAIILRISAGINPFNVPEQQLLDIEDCDLNVVRLCFQVFLPDEHGNF
FT                   TTALPPIVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVL
FT                   NDWEARGVFSQADVHRQVAIVFKTPPYCKAILEPVTVKMQLRRPSDQEVSESMDFRYLP
FT                   DEKDAYGNKSKKQKTTLIFQKLLQDCGHFTEKPRTAPLGSTGEGRFIKKESNLFSHGTV
FT                   LPEMPRSSGVPGQAEPYYSSCGSISSGLPHHPPAIPSVAHQPTSWPPVTHPTSHPVSTN
FT                   TLSTFSAGTLSSNSQGILPFLEGPGVSDLSASNSCLYNPDDLARMETPSMSPTDLYSIS
FT                   DVNMLSTRPLSVMAPSTDGMGDTDNPRLVSINLENPSCNARLGPRDLRQLHQMSPASLS
FT                   AGTSSSSVFVSQSDAFDRSNFSCVDNGLMNEPGLSDDANNPTFVQSSHYSSVNTLQSEQ
FT                   LSDPFTYGFFKI"
FT   gene            complement(5887668..5920283)
FT                   /gene="Papolg"
FT                   /locus_tag="mCG_8779"
FT                   /note="gene_id=mCG8779.2"
FT   mRNA            complement(join(5887668..5889077,5891432..5891488,
FT                   5891651..5891716,5892219..5892439,5892523..5892611,
FT                   5892978..5893147,5893380..5893501,5895214..5895323,
FT                   5895764..5895883,5897448..5897501,5898249..5898333,
FT                   5898811..5898931,5899496..5899568,5901341..5901479,
FT                   5904895..5904984,5907204..5907315,5909082..5909135,
FT                   5910185..5910294,5910512..5910593,5915250..5915316,
FT                   5916764..5916925,5920043..5920283))
FT                   /gene="Papolg"
FT                   /locus_tag="mCG_8779"
FT                   /product="poly(A) polymerase gamma, transcript variant
FT                   mCT8887"
FT                   /note="gene_id=mCG8779.2 transcript_id=mCT8887.2 created on
FT                   21-MAY-2002"
FT   mRNA            complement(join(5887668..5889077,5891432..5891488,
FT                   5891651..5891716,5892219..5892437,5892523..5892611,
FT                   5892978..5893147,5893380..5893501,5895214..5895323,
FT                   5895764..5895883,5897448..5897501,5898249..5898333,
FT                   5898811..5898931,5899496..5899568,5901341..5901479,
FT                   5904895..5904984,5907204..5907315,5909082..5909135,
FT                   5910185..5910294,5910512..5910593,5915250..5915316,
FT                   5916764..5916925,5920043..>5920237))
FT                   /gene="Papolg"
FT                   /locus_tag="mCG_8779"
FT                   /product="poly(A) polymerase gamma, transcript variant
FT                   mCT190016"
FT                   /note="gene_id=mCG8779.2 transcript_id=mCT190016.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(5888979..5889077,5891432..5891488,
FT                   5891651..5891716,5892219..5892439,5892523..5892611,
FT                   5892978..5893147,5893380..5893501,5895214..5895323,
FT                   5895764..5895883,5897448..5897501,5898249..5898333,
FT                   5898811..5898931,5899496..5899568,5901341..5901479,
FT                   5904895..5904984,5907204..5907315,5909082..5909135,
FT                   5910185..5910294,5910512..5910593,5915250..5915316,
FT                   5916764..5916925,5920043..5920059))
FT                   /codon_start=1
FT                   /gene="Papolg"
FT                   /locus_tag="mCG_8779"
FT                   /product="poly(A) polymerase gamma, isoform CRA_b"
FT                   /note="gene_id=mCG8779.2 transcript_id=mCT8887.2
FT                   protein_id=mCP3603.2 isoform=CRA_b"
FT                   /protein_id="EDL07899.1"
FT                   /translation="MKEMSANTMLDSQRQQKHYGITSPISLACPKEIDHIYTQKLIDAM
FT                   KPFGVFEDEEELNHRLVVLGKLNNLVKEWISDISESKNLPPSVVATVGGKIFTFGSYRL
FT                   GVHTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGI
FT                   EIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLT
FT                   LRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWP
FT                   NPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEF
FT                   KQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRV
FT                   LVGNLERNEFITLAHVNPQSFPGNKEHHKANNYVSMWFLGIIFRRVENAESVNIDLTYD
FT                   IQSFTDTVYRQANNINMLKDGMKIEATHVKKKQLHHYLPAEILQKKKKSLSDVSRSSGG
FT                   LQSKRSSLDSTCLDSSRDTDSGTPFNSPVSANKPSNPDSPTGEIERSSAEPVAVVVEKL
FT                   PSVPPAQGLSIPVIGAKVDPTAKAVSSPAVCTIPTVVGRNVIPRITTPHNPVQGQPHLN
FT                   GISNITKNVTPKRSHSPPTDGTSKRLKDIEKFIRLESAFKESRAAEDRKRKPMDSIGGE
FT                   SMPIPTIDTARKKRLPSKELPDSSSPVPANNIRVIKNSIRLTLNR"
FT   CDS             complement(join(5892433..5892437,5892523..5892611,
FT                   5892978..5893147,5893380..5893501,5895214..5895323,
FT                   5895764..5895883,5897448..5897501,5898249..5898333,
FT                   5898811..5898931,5899496..5899568,5901341..5901479,
FT                   5904895..5904984,5907204..5907315,5909082..5909135,
FT                   5910185..5910294,5910512..5910593,5915250..5915316,
FT                   5916764..5916925,5920043..>5920230))
FT                   /codon_start=1
FT                   /gene="Papolg"
FT                   /locus_tag="mCG_8779"
FT                   /product="poly(A) polymerase gamma, isoform CRA_a"
FT                   /note="gene_id=mCG8779.2 transcript_id=mCT190016.0
FT                   protein_id=mCP111010.0 isoform=CRA_a"
FT                   /protein_id="EDL07898.1"
FT                   /translation="IEPVLWCFHYSVECLGCREWGSERATSERRELDRGRKRGQEQDPK
FT                   AKDTRWRETQEAMKEMSANTMLDSQRQQKHYGITSPISLACPKEIDHIYTQKLIDAMKP
FT                   FGVFEDEEELNHRLVVLGKLNNLVKEWISDISESKNLPPSVVATVGGKIFTFGSYRLGV
FT                   HTKGADIDALCVAPRHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEI
FT                   DLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLR
FT                   AVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNP
FT                   VLLKQPEESNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQ
FT                   GLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLV
FT                   GNLERNEFITLAHVNPQSFPGNKEHHKANNYVSMWFLGIIFRRVENAESVNIDLTYDIQ
FT                   SFTDTVYRQANNINMLKDGMKIEATHVKKKQLHHYLPAEILQKKKKSLSDVSRSSGGLQ
FT                   SKRSSLDSTCLDSSRDTDSGTPFNSPVSANKPSNPDSPTGEIERSSAEPVAVVVEKLPS
FT                   VPPAQGLSIPVIGAS"
FT   gene            complement(6074858..>6100958)
FT                   /gene="A830031A19Rik"
FT                   /locus_tag="mCG_144581"
FT                   /note="gene_id=mCG144581.0"
FT   mRNA            complement(join(6074858..6075454,6084673..6084797,
FT                   6100923..>6100958))
FT                   /gene="A830031A19Rik"
FT                   /locus_tag="mCG_144581"
FT                   /product="RIKEN cDNA A830031A19"
FT                   /note="gene_id=mCG144581.0 transcript_id=mCT184005.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(6075156..6075454,6084673..>6084721))
FT                   /codon_start=1
FT                   /gene="A830031A19Rik"
FT                   /locus_tag="mCG_144581"
FT                   /product="RIKEN cDNA A830031A19"
FT                   /note="gene_id=mCG144581.0 transcript_id=mCT184005.0
FT                   protein_id=mCP105187.0"
FT                   /protein_id="EDL07900.1"
FT                   /translation="VEMAMQTTTRQSLFILAGRTAGQRLWRQLLSSARRGDHGHPGCLY
FT                   PRRTRLCLPRRRDPGLHEAGAIVWPESGTAVQVARRDHENVDNIMVVTTLVVKMPSIMC
FT                   VAYRCTSNKGI"
FT   gene            6103665..6200966
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /note="gene_id=mCG13359.2"
FT   mRNA            join(6103665..6104371,6111247..6111576,6185099..6185200,
FT                   6189992..6191734,6200153..6200966)
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /product="B-cell CLL/lymphoma 11A (zinc finger protein),
FT                   transcript variant mCT11858"
FT                   /note="gene_id=mCG13359.2 transcript_id=mCT11858.2 created
FT                   on 12-FEB-2003"
FT   mRNA            join(<6104043..6104288,6190274..6191734,6200153..6200648)
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /product="B-cell CLL/lymphoma 11A (zinc finger protein),
FT                   transcript variant mCT190006"
FT                   /note="gene_id=mCG13359.2 transcript_id=mCT190006.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(6104111..6104371,6111247..6111576,6185099..6185200,
FT                   6189992..6190134,6200153..6200647)
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /product="B-cell CLL/lymphoma 11A (zinc finger protein),
FT                   transcript variant mCT180100"
FT                   /note="gene_id=mCG13359.2 transcript_id=mCT180100.0 created
FT                   on 12-FEB-2003"
FT   CDS             join(<6104261..6104288,6190274..6191734,6200153..6200244)
FT                   /codon_start=1
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /product="B-cell CLL/lymphoma 11A (zinc finger protein),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG13359.2 transcript_id=mCT190006.0
FT                   protein_id=mCP110997.0 isoform=CRA_d"
FT                   /protein_id="EDL07904.1"
FT                   /translation="TEPSSARRRRRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATH
FT                   HPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSK
FT                   PPFLATPPLPPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLC
FT                   DHACTQASKLKRHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAK
FT                   FKSENDPNLIPENGDEEEEEDDEEEEEEEEEEEEELTESERVDYGFGLSLEAARHHENS
FT                   SRGAVVGVGDEGRALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRSHLAEAEGHRDTCDE
FT                   DSVAGESDRIDDGTVNGRGCSPGESASGGLSKKLLLGSPSSLSPFSKRIKLEKEFDLPP
FT                   AAMPNTENVYSQWLAGYAASRQLKDPFLTFGDSRQSPFASSSEHSSENGSLRFSTPPGE
FT                   LDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCPSHTPVRRSTPRAQDVWQFS
FT                   DGSSRTLKF"
FT   CDS             join(6104317..6104371,6111247..6111576,6185099..6185200,
FT                   6189992..6190134,6200153..6200254)
FT                   /codon_start=1
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /product="B-cell CLL/lymphoma 11A (zinc finger protein),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG13359.2 transcript_id=mCT180100.0
FT                   protein_id=mCP103021.0 isoform=CRA_c"
FT                   /protein_id="EDL07903.1"
FT                   /translation="MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDL
FT                   LTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKGVDKPPSPSPIEMKKASNPVEVGIQ
FT                   VTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGIC
FT                   KDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVLHTPPFGVVPR
FT                   ELKMCGSFRMEAQEPLSSEKL"
FT   CDS             join(6104317..6104371,6111247..6111576,6185099..6185200,
FT                   6189992..6191734,6200153..6200244)
FT                   /codon_start=1
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /product="B-cell CLL/lymphoma 11A (zinc finger protein),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13359.2 transcript_id=mCT11858.2
FT                   protein_id=mCP3605.2 isoform=CRA_a"
FT                   /protein_id="EDL07901.1"
FT                   /translation="MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDL
FT                   LTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKGVDKPPSPSPIEMKKASNPVEVGIQ
FT                   VTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGIC
FT                   KDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECP
FT                   SQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIER
FT                   LGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQ
FT                   RLLQPFQPGSKPPFLATPPLPPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSH
FT                   TGEKPYKCNLCDHACTQASKLKRHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGS
FT                   ASSALKSVVAKFKSENDPNLIPENGDEEEEEDDEEEEEEEEEEEEELTESERVDYGFGL
FT                   SLEAARHHENSSRGAVVGVGDEGRALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRSHLA
FT                   EAEGHRDTCDEDSVAGESDRIDDGTVNGRGCSPGESASGGLSKKLLLGSPSSLSPFSKR
FT                   IKLEKEFDLPPAAMPNTENVYSQWLAGYAASRQLKDPFLTFGDSRQSPFASSSEHSSEN
FT                   GSLRFSTPPGELDGGISGRSGTGSGGSTPHISGPGPGRPSSKEGRRSDTCPSHTPVRRS
FT                   TPRAQDVWQFSDGSSRTLKF"
FT   mRNA            join(<6106621..6106666,6111247..6111576,6185099..6185200,
FT                   6189992..6190134,6200153..>6200187)
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /product="B-cell CLL/lymphoma 11A (zinc finger protein),
FT                   transcript variant mCT180099"
FT                   /note="gene_id=mCG13359.2 transcript_id=mCT180099.0 created
FT                   on 12-FEB-2003"
FT   CDS             join(<6106621..6106666,6111247..6111576,6185099..6185200,
FT                   6189992..6190134,6200153..>6200187)
FT                   /codon_start=1
FT                   /gene="Bcl11a"
FT                   /locus_tag="mCG_13359"
FT                   /product="B-cell CLL/lymphoma 11A (zinc finger protein),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13359.2 transcript_id=mCT180099.0
FT                   protein_id=mCP103022.0 isoform=CRA_b"
FT                   /protein_id="EDL07902.1"
FT                   /translation="QSRRGARRCEVTARPAEPLEAILTDDEPDHGPLGAPEGDHDLLTC
FT                   GQCQMNFPLGDILIFIEHKRKQCNGSLCLEKGVDKPPSPSPIEMKKASNPVEVGIQVTP
FT                   EDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDE
FT                   PSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVLHTPPFGVVPR"
FT   gene            complement(6193723..>6200236)
FT                   /locus_tag="mCG_146073"
FT                   /note="gene_id=mCG146073.0"
FT   mRNA            complement(join(6193723..6193908,6195455..6195645,
FT                   6200120..>6200236))
FT                   /locus_tag="mCG_146073"
FT                   /product="mCG146073"
FT                   /note="gene_id=mCG146073.0 transcript_id=mCT186176.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(6195574..6195645,6200120..>6200233))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146073"
FT                   /product="mCG146073"
FT                   /note="gene_id=mCG146073.0 transcript_id=mCT186176.0
FT                   protein_id=mCP107294.0"
FT                   /protein_id="EDL07905.1"
FT                   /translation="GFLSFHPKTATHLELAGYYAERGCVKDLERGWRQRKEKGNNGRTE
FT                   RTFRHNRHSRKSKGDN"
FT   gene            <6228872..>6245024
FT                   /locus_tag="mCG_13361"
FT                   /note="gene_id=mCG13361.1"
FT   mRNA            join(<6228872..6228927,6243778..6243979,6244722..6244878,
FT                   6244996..>6245024)
FT                   /locus_tag="mCG_13361"
FT                   /product="mCG13361"
FT                   /note="gene_id=mCG13361.1 transcript_id=mCT11860.1 created
FT                   on 21-MAY-2002"
FT   CDS             join(<6243827..6243979,6244722..6244878,6244996..>6245024)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13361"
FT                   /product="mCG13361"
FT                   /note="gene_id=mCG13361.1 transcript_id=mCT11860.1
FT                   protein_id=mCP3616.0"
FT                   /protein_id="EDL07906.1"
FT                   /translation="ERLGTSPHVQARWGKPLGGEGSQKPAKEPETHPAHTAWSSTRRPS
FT                   YTTVTQSLHLAAFQMFMENQISRTMWLSADYILHVYDGHVNECVVILICQSSKGKCRGG
FT                   HLEKREHWC"
FT   gene            <6509152..6595921
FT                   /locus_tag="mCG_145913"
FT                   /note="gene_id=mCG145913.0"
FT   mRNA            join(<6509152..6509202,6584997..6585184,6585382..6585433,
FT                   6595468..6595921)
FT                   /locus_tag="mCG_145913"
FT                   /product="mCG145913"
FT                   /note="gene_id=mCG145913.0 transcript_id=mCT186021.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<6509154..6509202,6584997..6585184,6585382..6585414)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145913"
FT                   /product="mCG145913"
FT                   /note="gene_id=mCG145913.0 transcript_id=mCT186021.0
FT                   protein_id=mCP107293.0"
FT                   /protein_id="EDL07907.1"
FT                   /translation="LGSYIPYAGRNKLMLQGYCSAKFCVDLPKLPPSLCLCSTPPTVSS
FT                   LDTFTINKKTVSWKSTGLHENRSPCTVIWNLLQVCYEGLNMLDT"
FT   gene            complement(6578254..6578904)
FT                   /pseudo
FT                   /locus_tag="mCG_1030831"
FT                   /note="gene_id=mCG1030831.1"
FT   mRNA            complement(6578254..6578904)
FT                   /pseudo
FT                   /locus_tag="mCG_1030831"
FT                   /note="gene_id=mCG1030831.1 transcript_id=mCT148535.1
FT                   created on 21-MAY-2002"
FT   gene            6590146..6593945
FT                   /pseudo
FT                   /locus_tag="mCG_1030906"
FT                   /note="gene_id=mCG1030906.1"
FT   mRNA            6590146..6593945
FT                   /pseudo
FT                   /locus_tag="mCG_1030906"
FT                   /note="gene_id=mCG1030906.1 transcript_id=mCT148610.1
FT                   created on 21-MAY-2002"
FT   gene            7352427..7393083
FT                   /locus_tag="mCG_64409"
FT                   /note="gene_id=mCG64409.1"
FT   mRNA            join(7352427..7352723,7356199..7356344,7372433..7372551,
FT                   7383399..7383588,7384107..7384212,7391179..7391352,
FT                   7392004..7392281,7392897..7393083)
FT                   /locus_tag="mCG_64409"
FT                   /product="mCG64409"
FT                   /note="gene_id=mCG64409.1 transcript_id=mCT64592.2 created
FT                   on 01-JUL-2002"
FT   CDS             join(7356305..7356344,7372433..7372551,7383399..7383588,
FT                   7384107..7384117)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64409"
FT                   /product="mCG64409"
FT                   /note="gene_id=mCG64409.1 transcript_id=mCT64592.2
FT                   protein_id=mCP32852.2"
FT                   /protein_id="EDL07908.1"
FT                   /translation="MDEDLSSGTHVLCLMEVLQQKKLFYYLGSTTIFKMRVPSLMKTQV
FT                   AHNEVKTQARITKGAAEVCSEGTMTKHQTESGHVWGDEQTPLRGHLIILFSGFRSKNYP
FT                   TENSCICKTTNRSVL"
FT   gene            complement(7663038..>7696149)
FT                   /gene="5730522E02Rik"
FT                   /locus_tag="mCG_1030915"
FT                   /note="gene_id=mCG1030915.1"
FT   mRNA            complement(join(7663038..7663523,7692075..7692223,
FT                   7696010..>7696142))
FT                   /gene="5730522E02Rik"
FT                   /locus_tag="mCG_1030915"
FT                   /product="RIKEN cDNA 5730522E02, transcript variant
FT                   mCT148619"
FT                   /note="gene_id=mCG1030915.1 transcript_id=mCT148619.0
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(7663477..7663523,7692075..7692223,
FT                   7696010..>7696140))
FT                   /codon_start=1
FT                   /gene="5730522E02Rik"
FT                   /locus_tag="mCG_1030915"
FT                   /product="RIKEN cDNA 5730522E02, isoform CRA_a"
FT                   /note="gene_id=mCG1030915.1 transcript_id=mCT148619.0
FT                   protein_id=mCP71504.0 isoform=CRA_a"
FT                   /protein_id="EDL07909.1"
FT                   /translation="SVSDMSCRKPCQKTGCSRVTSQLPSFSAGKCSWDSILSCLECSSI
FT                   SLCPGCPGICHVEENGLKLTEINSPASAPTLQILRLKVCGSTSGLKVLWLLEALHSDFR
FT                   GSLF"
FT   mRNA            complement(join(7682102..7682356,7692075..7692223,
FT                   7696010..>7696149))
FT                   /gene="5730522E02Rik"
FT                   /locus_tag="mCG_1030915"
FT                   /product="RIKEN cDNA 5730522E02, transcript variant
FT                   mCT171969"
FT                   /note="gene_id=mCG1030915.1 transcript_id=mCT171969.0
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(7682259..7682356,7692075..7692223,
FT                   7696010..>7696146))
FT                   /codon_start=1
FT                   /gene="5730522E02Rik"
FT                   /locus_tag="mCG_1030915"
FT                   /product="RIKEN cDNA 5730522E02, isoform CRA_b"
FT                   /note="gene_id=mCG1030915.1 transcript_id=mCT171969.0
FT                   protein_id=mCP94888.0 isoform=CRA_b"
FT                   /protein_id="EDL07910.1"
FT                   /translation="LGSVSDMSCRKPCQKTGCSRVTSQLPSFSAGKCSWDSILSCLECS
FT                   SISLCPGCPGICHVEENGLKLTEINSPASAPTLQILRLKVCGSTSGLKVLLGACQLQLR
FT                   KSFLNGRHWQRYPRHKKMRIRLL"
FT   assembly_gap    40270..40289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41027..41140
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    42709..43415
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   assembly_gap    44653..44672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    45998..48605
FT                   /estimated_length=2608
FT                   /gap_type="unknown"
FT   assembly_gap    53910..58750
FT                   /estimated_length=4841
FT                   /gap_type="unknown"
FT   assembly_gap    59835..59854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    61036..63222
FT                   /estimated_length=2187
FT                   /gap_type="unknown"
FT   assembly_gap    65640..66099
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    67217..68286
FT                   /estimated_length=1070
FT                   /gap_type="unknown"
FT   assembly_gap    74334..78152
FT                   /estimated_length=3819
FT                   /gap_type="unknown"
FT   assembly_gap    84123..90874
FT                   /estimated_length=6752
FT                   /gap_type="unknown"
FT   assembly_gap    93278..93340
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    96029..97441
FT                   /estimated_length=1413
FT                   /gap_type="unknown"
FT   assembly_gap    102708..102758
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    138409..140106
FT                   /estimated_length=1698
FT                   /gap_type="unknown"
FT   assembly_gap    159702..161202
FT                   /estimated_length=1501
FT                   /gap_type="unknown"
FT   assembly_gap    169825..171105
FT                   /estimated_length=1281
FT                   /gap_type="unknown"
FT   assembly_gap    178399..178418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    180327..180346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    182890..182909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    187508..187527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    192429..192448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    194423..194442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    216714..216733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    218366..218385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222246..222265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    225200..225219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    247318..247927
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    265088..266239
FT                   /estimated_length=1152
FT                   /gap_type="unknown"
FT   assembly_gap    278257..278276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    279500..279917
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    282336..282355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    284194..284213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    295603..295622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    298447..298466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    315119..315701
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    318821..319171
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    338312..338331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    340511..340530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    341893..341912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    366663..367580
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    373945..376183
FT                   /estimated_length=2239
FT                   /gap_type="unknown"
FT   assembly_gap    380540..386217
FT                   /estimated_length=5678
FT                   /gap_type="unknown"
FT   assembly_gap    397882..398024
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    412534..413011
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   assembly_gap    421082..422289
FT                   /estimated_length=1208
FT                   /gap_type="unknown"
FT   assembly_gap    432783..432864
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    453116..453480
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    456910..456929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    462470..462489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    463960..464867
FT                   /estimated_length=908
FT                   /gap_type="unknown"
FT   assembly_gap    469976..470101
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    495180..495199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    527133..527152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    528539..528803
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    535795..535814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    536898..536917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    561800..561819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    563939..563958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    586897..586990
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    590780..599619
FT                   /estimated_length=8840
FT                   /gap_type="unknown"
FT   assembly_gap    609944..611743
FT                   /estimated_length=1800
FT                   /gap_type="unknown"
FT   assembly_gap    622544..622563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    623770..623789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    629631..635678
FT                   /estimated_length=6048
FT                   /gap_type="unknown"
FT   assembly_gap    664432..664451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    666091..666110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    682858..682877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    692631..693610
FT                   /estimated_length=980
FT                   /gap_type="unknown"
FT   assembly_gap    711637..711670
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    720806..721102
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    735924..736210
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    759378..759397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    760467..760486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    776717..776736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    778147..778166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    779289..779308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    781116..783631
FT                   /estimated_length=2516
FT                   /gap_type="unknown"
FT   assembly_gap    813040..813337
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    816776..817118
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    856719..857067
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    858401..858420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    859721..866342
FT                   /estimated_length=6622
FT                   /gap_type="unknown"
FT   assembly_gap    870408..870427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    871555..878234
FT                   /estimated_length=6680
FT                   /gap_type="unknown"
FT   assembly_gap    915368..916435
FT                   /estimated_length=1068
FT                   /gap_type="unknown"
FT   assembly_gap    927365..927384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    935160..935179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    944210..944229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    947925..947944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    956913..957076
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    967204..967277
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    973956..974117
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    976721..976740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1087958..1088007
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    1102572..1102601
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1107003..1107026
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    1131311..1131409
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    1141223..1145238
FT                   /estimated_length=4016
FT                   /gap_type="unknown"
FT   assembly_gap    1152992..1153011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1198267..1198286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1216168..1216237
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1242093..1242222
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    1248314..1248420
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    1259458..1259477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1278190..1278209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1292439..1292770
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    1297186..1297318
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    1341768..1342114
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    1387346..1387365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1428021..1428092
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    1429379..1429398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1452887..1452906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1466101..1467042
FT                   /estimated_length=942
FT                   /gap_type="unknown"
FT   assembly_gap    1522741..1522764
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    1529082..1529101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1530563..1531337
FT                   /estimated_length=775
FT                   /gap_type="unknown"
FT   assembly_gap    1554680..1554823
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    1565468..1566097
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    1575064..1575083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1577971..1577990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1585361..1585380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1608854..1608873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1616230..1616249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1627124..1627367
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    1638370..1639128
FT                   /estimated_length=759
FT                   /gap_type="unknown"
FT   assembly_gap    1643843..1643862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1646459..1646478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1689967..1689986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1691267..1691769
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    1715119..1715239
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    1748546..1749026
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    1788623..1790103
FT                   /estimated_length=1481
FT                   /gap_type="unknown"
FT   assembly_gap    1791405..1791541
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    1797969..1798142
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    1808334..1808595
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    1820358..1820377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1828132..1828276
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1829427..1829531
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    1830822..1830881
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    1835473..1838252
FT                   /estimated_length=2780
FT                   /gap_type="unknown"
FT   assembly_gap    1842220..1842592
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    1857779..1859135
FT                   /estimated_length=1357
FT                   /gap_type="unknown"
FT   assembly_gap    1864213..1864424
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    1866636..1866814
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    1867559..1867608
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    1874421..1874487
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    1884979..1884998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1886562..1887170
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    1889864..1889992
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    1898897..1898935
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    1918523..1923772
FT                   /estimated_length=5250
FT                   /gap_type="unknown"
FT   assembly_gap    1925036..1925055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1926394..1926413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1929621..1930145
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   assembly_gap    1931492..1931728
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    1934128..1934147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1938419..1938466
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    1964650..1964761
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    1968992..1969048
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    1979631..1979751
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    2035542..2035649
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    2053408..2053485
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    2061284..2061355
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2070916..2071137
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    2078366..2079182
FT                   /estimated_length=817
FT                   /gap_type="unknown"
FT   assembly_gap    2096234..2096253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2097921..2100169
FT                   /estimated_length=2249
FT                   /gap_type="unknown"
FT   assembly_gap    2112813..2112867
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    2117685..2117704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2120572..2120591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2121653..2121672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2133312..2133331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2136490..2136538
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    2140660..2140679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2163304..2163323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2197894..2197913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2204909..2204936
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    2222756..2222775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2224925..2224944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2225129..2226460
FT                   /estimated_length=1332
FT                   /gap_type="unknown"
FT   assembly_gap    2230677..2233878
FT                   /estimated_length=3202
FT                   /gap_type="unknown"
FT   assembly_gap    2237028..2237047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2238499..2238518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2241845..2241864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2306573..2306658
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    2326957..2327344
FT                   /estimated_length=388
FT                   /gap_type="unknown"
FT   assembly_gap    2329431..2329570
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    2339073..2339092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2359090..2359109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2360341..2360360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2382874..2384430
FT                   /estimated_length=1557
FT                   /gap_type="unknown"
FT   assembly_gap    2388564..2388600
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    2393141..2393160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2412956..2413071
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    2417653..2417721
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    2432706..2432725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2440421..2440772
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    2463244..2463693
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    2468506..2468525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2470053..2470072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2484100..2484329
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    2495705..2495724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2501170..2502137
FT                   /estimated_length=968
FT                   /gap_type="unknown"
FT   assembly_gap    2551409..2551428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2564794..2564819
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    2593865..2594001
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    2596516..2596535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2605592..2605611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2618288..2618307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2644058..2644305
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    2647364..2647888
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   assembly_gap    2656243..2656418
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    2659701..2660096
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    2690006..2690025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2696486..2696593
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    2756617..2756718
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    2777942..2778219
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    2795211..2795846
FT                   /estimated_length=636
FT                   /gap_type="unknown"
FT   assembly_gap    2815039..2815560
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    2816747..2816766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2837675..2837694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2838204..2838265
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    2850013..2850240
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    2857317..2857336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2881705..2881850
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    2979985..2980004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3027263..3027282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3099423..3099442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3218474..3218566
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    3245014..3245033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3250332..3251087
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    3279382..3279427
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3280359..3281719
FT                   /estimated_length=1361
FT                   /gap_type="unknown"
FT   assembly_gap    3282812..3284037
FT                   /estimated_length=1226
FT                   /gap_type="unknown"
FT   assembly_gap    3287263..3291705
FT                   /estimated_length=4443
FT                   /gap_type="unknown"
FT   assembly_gap    3299093..3299773
FT                   /estimated_length=681
FT                   /gap_type="unknown"
FT   assembly_gap    3533151..3535048
FT                   /estimated_length=1898
FT                   /gap_type="unknown"
FT   assembly_gap    3536094..3536583
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    3686405..3687182
FT                   /estimated_length=778
FT                   /gap_type="unknown"
FT   assembly_gap    3696637..3696697
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    3706762..3709893
FT                   /estimated_length=3132
FT                   /gap_type="unknown"
FT   assembly_gap    3777931..3777996
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    3920310..3920335
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    3933226..3933245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3957506..3957525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3965921..3965940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3967587..3967606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4017935..4018010
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    4048997..4049016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4148470..4148489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4222855..4222874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4266173..4266228
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    4288245..4288316
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    4295630..4295703
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    4331580..4331599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4351739..4351870
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    4364099..4364261
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    4380370..4382071
FT                   /estimated_length=1702
FT                   /gap_type="unknown"
FT   assembly_gap    4428661..4428880
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    4439199..4441264
FT                   /estimated_length=2066
FT                   /gap_type="unknown"
FT   assembly_gap    4464259..4464316
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    4467399..4467418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4468532..4468958
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    4514412..4514598
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    4525999..4526037
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    4555197..4555216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4570365..4570436
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    4583069..4583088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4607513..4607532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4619659..4619921
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    4634261..4634502
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    4679685..4679756
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    4680451..4680738
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    4701960..4706207
FT                   /estimated_length=4248
FT                   /gap_type="unknown"
FT   assembly_gap    4736241..4736260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4737270..4737289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4739658..4739677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4741688..4741707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4761172..4761191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4774578..4775438
FT                   /estimated_length=861
FT                   /gap_type="unknown"
FT   assembly_gap    4799128..4799214
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    4836950..4836969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4838251..4838974
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    4842801..4842855
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    4854806..4854825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4881043..4881349
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    4985101..4985120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4990917..4991017
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5103415..5103565
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    5108806..5109224
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    5111807..5111826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5161710..5161729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5184307..5184514
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    5185353..5185502
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    5193243..5193327
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    5213264..5214646
FT                   /estimated_length=1383
FT                   /gap_type="unknown"
FT   assembly_gap    5223261..5223280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5243967..5244677
FT                   /estimated_length=711
FT                   /gap_type="unknown"
FT   assembly_gap    5248627..5248646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5254688..5254707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5276152..5276985
FT                   /estimated_length=834
FT                   /gap_type="unknown"
FT   assembly_gap    5321456..5321475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5337541..5337744
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    5340278..5340297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5342257..5342276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5345286..5345355
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    5353808..5353827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5367700..5367719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5381514..5381646
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    5425241..5425260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5431630..5431797
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    5473188..5473315
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    5479093..5479112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5481487..5481506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5533558..5533907
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    5539754..5539803
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    5554598..5555439
FT                   /estimated_length=842
FT                   /gap_type="unknown"
FT   assembly_gap    5576583..5577222
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    5578431..5582703
FT                   /estimated_length=4273
FT                   /gap_type="unknown"
FT   assembly_gap    5618454..5618491
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    5625506..5625525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5652763..5652782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5661127..5661312
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    5695742..5695761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5748313..5748522
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    5770591..5770610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5817413..5817466
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    5835123..5835142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5858651..5858863
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    5860478..5865466
FT                   /estimated_length=4989
FT                   /gap_type="unknown"
FT   assembly_gap    5881483..5881619
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    5935678..5935951
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    5941839..5941892
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    5950413..5950432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5951493..5951578
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    5990096..5990115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5994266..5994544
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    6027892..6027911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6032434..6032453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6103629..6103664
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    6126122..6126413
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    6130295..6130314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6169168..6169187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6198482..6198501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6230236..6230255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6251432..6251451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6260342..6260676
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    6269128..6269147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6284442..6284461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6286850..6287110
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    6303391..6303410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6310553..6310572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6313959..6314083
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    6329609..6329733
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    6366393..6366460
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    6375984..6376092
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    6399364..6399383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6414183..6414202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6452375..6452574
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    6528155..6528387
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    6543277..6546790
FT                   /estimated_length=3514
FT                   /gap_type="unknown"
FT   assembly_gap    6552288..6553824
FT                   /estimated_length=1537
FT                   /gap_type="unknown"
FT   assembly_gap    6555585..6555604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6562390..6562409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6565734..6565753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6586729..6586748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6589185..6589204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6591011..6591030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6599446..6599465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6601641..6601660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6619314..6619943
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    6621446..6622749
FT                   /estimated_length=1304
FT                   /gap_type="unknown"
FT   assembly_gap    6645899..6645918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6648536..6648855
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    6703253..6703386
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    6713925..6713944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6715223..6715242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6721624..6721911
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    6774589..6774712
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    6818175..6818221
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    6819503..6819522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6832559..6832578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6834106..6834917
FT                   /estimated_length=812
FT                   /gap_type="unknown"
FT   assembly_gap    6839151..6839905
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    6847291..6847814
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    6877260..6877279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6891355..6893865
FT                   /estimated_length=2511
FT                   /gap_type="unknown"
FT   assembly_gap    6900590..6900609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6905346..6905365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6906564..6906740
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    6915667..6915686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6918606..6927662
FT                   /estimated_length=9057
FT                   /gap_type="unknown"
FT   assembly_gap    6954128..6954147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6955429..6955448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6956778..6956797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6958447..6958466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6995546..6995753
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    7044462..7044552
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    7052316..7053290
FT                   /estimated_length=975
FT                   /gap_type="unknown"
FT   assembly_gap    7057360..7057379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7058442..7058461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7059588..7059607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7087042..7087151
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    7128334..7129086
FT                   /estimated_length=753
FT                   /gap_type="unknown"
FT   assembly_gap    7147809..7148177
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    7149690..7149709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7155829..7155848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7156506..7156975
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    7170123..7170147
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    7221490..7222201
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   assembly_gap    7237580..7237599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7275979..7276097
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    7322030..7322049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7336424..7336443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7344679..7344698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7347381..7347400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7348879..7350253
FT                   /estimated_length=1375
FT                   /gap_type="unknown"
FT   assembly_gap    7398760..7401045
FT                   /estimated_length=2286
FT                   /gap_type="unknown"
FT   assembly_gap    7421498..7421517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7422647..7422666
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7423744..7423763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7429469..7429488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7477391..7477410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7483753..7483772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7485158..7485177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7487057..7487076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7490164..7490183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7491361..7491950
FT                   /estimated_length=590
FT                   /gap_type="unknown"
FT   assembly_gap    7493106..7493125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7501438..7501588
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    7503760..7503779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7518091..7518110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7520260..7520279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7521747..7522142
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    7525756..7525775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7526877..7526896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7528424..7528443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7582400..7582427
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    7597156..7597175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7617478..7617497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7618851..7620446
FT                   /estimated_length=1596
FT                   /gap_type="unknown"
FT   assembly_gap    7622285..7622304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7627528..7627547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7629577..7629596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7636929..7637113
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    7643323..7643342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7664836..7664879
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    7746298..7746317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7752821..7752840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7761848..7761867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7772098..7772200
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    7778839..7778981
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    7783195..7783214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7787978..7787997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7819875..7819962
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    7841270..7841289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7844468..7844487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7855589..7860328
FT                   /estimated_length=4740
FT                   /gap_type="unknown"
FT   assembly_gap    7903566..7903652
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    7912186..7912479
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    7918476..7919727
FT                   /estimated_length=1252
FT                   /gap_type="unknown"
FT   assembly_gap    7941863..7943785
FT                   /estimated_length=1923
FT                   /gap_type="unknown"
FT   assembly_gap    7945961..7945980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7975744..7975941
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    7980155..7980303
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    8029620..8029867
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    8036363..8036495
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    8047620..8047742
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    8061554..8061709
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    8067655..8067674
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8095922..8095941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8102601..8102620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8106333..8106352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8208304..8208452
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    8232959..8232978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8234448..8234791
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    8238759..8239930
FT                   /estimated_length=1172
FT                   /gap_type="unknown"
FT   assembly_gap    8243306..8243325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8244959..8244978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8246097..8246116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8253535..8253554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8270967..8270986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8272126..8272145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8277218..8277641
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    8280966..8280985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8283143..8286524
FT                   /estimated_length=3382
FT                   /gap_type="unknown"
FT   assembly_gap    8287954..8287973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8297303..8298335
FT                   /estimated_length=1033
FT                   /gap_type="unknown"
FT   assembly_gap    8328393..8328412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8341205..8341935
FT                   /estimated_length=731
FT                   /gap_type="unknown"
XX
CO   join(AAHY01091046.1:1..40269,gap(20),AAHY01091047.1:1..737,gap(114),
CO   complement(AAHY01091048.1:1..1568),gap(707),AAHY01091049.1:1..1237,gap(20),
CO   complement(AAHY01091050.1:1..1325),gap(2608),AAHY01091051.1:1..5304,
CO   gap(4841),complement(AAHY01091052.1:1..1084),gap(20),
CO   AAHY01091053.1:1..1181,gap(2187),AAHY01091054.1:1..2417,gap(460),
CO   AAHY01091055.1:1..1117,gap(1070),AAHY01091056.1:1..6047,gap(3819),
CO   AAHY01091057.1:1..5970,gap(6752),AAHY01091058.1:1..2403,gap(63),
CO   AAHY01091059.1:1..2688,gap(1413),AAHY01091060.1:1..5266,gap(51),
CO   AAHY01091061.1:1..35650,gap(1698),AAHY01091062.1:1..19595,gap(1501),
CO   AAHY01091063.1:1..8622,gap(1281),AAHY01091064.1:1..7293,gap(20),
CO   AAHY01091065.1:1..1908,gap(20),AAHY01091066.1:1..2543,gap(20),
CO   AAHY01091067.1:1..4598,gap(20),complement(AAHY01091068.1:1..4901),gap(20),
CO   complement(AAHY01091069.1:1..1974),gap(20),AAHY01091070.1:1..22271,gap(20),
CO   AAHY01091071.1:1..1632,gap(20),AAHY01091072.1:1..3860,gap(20),
CO   AAHY01091073.1:1..2934,gap(20),AAHY01091074.1:1..22098,gap(610),
CO   complement(AAHY01091075.1:1..17160),gap(1152),AAHY01091076.1:1..12017,
CO   gap(20),AAHY01091077.1:1..1223,gap(418),AAHY01091078.1:1..2418,gap(20),
CO   complement(AAHY01091079.1:1..1838),gap(20),
CO   complement(AAHY01091080.1:1..11389),gap(20),
CO   complement(AAHY01091081.1:1..2824),gap(20),AAHY01091082.1:1..16652,
CO   gap(583),complement(AAHY01091083.1:1..3119),gap(351),
CO   AAHY01091084.1:1..19140,gap(20),complement(AAHY01091085.1:1..2179),gap(20),
CO   AAHY01091086.1:1..1362,gap(20),AAHY01091087.1:1..24750,gap(918),
CO   AAHY01091088.1:1..6364,gap(2239),AAHY01091089.1:1..4356,gap(5678),
CO   AAHY01091090.1:1..11664,gap(143),AAHY01091091.1:1..14509,gap(478),
CO   AAHY01091092.1:1..8070,gap(1208),AAHY01091093.1:1..10493,gap(82),
CO   AAHY01091094.1:1..20251,gap(365),AAHY01091095.1:1..3429,gap(20),
CO   AAHY01091096.1:1..5540,gap(20),complement(AAHY01091097.1:1..1470),gap(908),
CO   AAHY01091098.1:1..5108,gap(126),AAHY01091099.1:1..25078,gap(20),
CO   AAHY01091100.1:1..31933,gap(20),AAHY01091101.1:1..1386,gap(265),
CO   AAHY01091102.1:1..6991,gap(20),complement(AAHY01091103.1:1..1083),gap(20),
CO   complement(AAHY01091104.1:1..24882),gap(20),AAHY01091105.1:1..2119,gap(20),
CO   complement(AAHY01091106.1:1..22938),gap(94),AAHY01091107.1:1..3789,
CO   gap(8840),AAHY01091108.1:1..10324,gap(1800),AAHY01091109.1:1..10800,
CO   gap(20),AAHY01091110.1:1..1206,gap(20),AAHY01091111.1:1..5841,gap(6048),
CO   AAHY01091112.1:1..28753,gap(20),AAHY01091113.1:1..1639,gap(20),
CO   AAHY01091114.1:1..16747,gap(20),AAHY01091115.1:1..9753,gap(980),
CO   complement(AAHY01091116.1:1..18026),gap(34),
CO   complement(AAHY01091117.1:1..9135),gap(297),
CO   complement(AAHY01091118.1:1..14821),gap(287),AAHY01091119.1:1..23167,
CO   gap(20),AAHY01091120.1:1..1069,gap(20),AAHY01091121.1:1..16230,gap(20),
CO   AAHY01091122.1:1..1410,gap(20),complement(AAHY01091123.1:1..1122),gap(20),
CO   AAHY01091124.1:1..1807,gap(2516),AAHY01091125.1:1..29408,gap(298),
CO   complement(AAHY01091126.1:1..3438),gap(343),AAHY01091127.1:1..39600,
CO   gap(349),AAHY01091128.1:1..1333,gap(20),complement(AAHY01091129.1:1..1300),
CO   gap(6622),AAHY01091130.1:1..4065,gap(20),AAHY01091131.1:1..1127,gap(6680),
CO   AAHY01091132.1:1..37133,gap(1068),AAHY01091133.1:1..10929,gap(20),
CO   AAHY01091134.1:1..7775,gap(20),complement(AAHY01091135.1:1..9030),gap(20),
CO   AAHY01091136.1:1..3695,gap(20),AAHY01091137.1:1..8968,gap(164),
CO   AAHY01091138.1:1..10127,gap(74),AAHY01091139.1:1..6678,gap(162),
CO   AAHY01091140.1:1..2603,gap(20),AAHY01091141.1:1..111217,gap(50),
CO   complement(AAHY01091142.1:1..14564),gap(30),
CO   complement(AAHY01091143.1:1..4401),gap(24),AAHY01091144.1:1..24284,gap(99),
CO   AAHY01091145.1:1..9813,gap(4016),AAHY01091146.1:1..7753,gap(20),
CO   AAHY01091147.1:1..45255,gap(20),complement(AAHY01091148.1:1..17881),
CO   gap(70),complement(AAHY01091149.1:1..25855),gap(130),
CO   complement(AAHY01091150.1:1..6091),gap(107),AAHY01091151.1:1..11037,
CO   gap(20),complement(AAHY01091152.1:1..18712),gap(20),
CO   complement(AAHY01091153.1:1..14229),gap(332),
CO   complement(AAHY01091154.1:1..4415),gap(133),AAHY01091155.1:1..44449,
CO   gap(347),complement(AAHY01091156.1:1..45231),gap(20),
CO   AAHY01091157.1:1..40655,gap(72),AAHY01091158.1:1..1286,gap(20),
CO   complement(AAHY01091159.1:1..23488),gap(20),AAHY01091160.1:1..13194,
CO   gap(942),AAHY01091161.1:1..55698,gap(24),AAHY01091162.1:1..6317,gap(20),
CO   complement(AAHY01091163.1:1..1461),gap(775),
CO   complement(AAHY01091164.1:1..23342),gap(144),AAHY01091165.1:1..10644,
CO   gap(630),AAHY01091166.1:1..8966,gap(20),complement(AAHY01091167.1:1..2887),
CO   gap(20),complement(AAHY01091168.1:1..7370),gap(20),
CO   complement(AAHY01091169.1:1..23473),gap(20),
CO   complement(AAHY01091170.1:1..7356),gap(20),AAHY01091171.1:1..10874,
CO   gap(244),AAHY01091172.1:1..11002,gap(759),AAHY01091173.1:1..4714,gap(20),
CO   AAHY01091174.1:1..2596,gap(20),AAHY01091175.1:1..43488,gap(20),
CO   AAHY01091176.1:1..1280,gap(503),AAHY01091177.1:1..23349,gap(121),
CO   AAHY01091178.1:1..33306,gap(481),AAHY01091179.1:1..39596,gap(1481),
CO   AAHY01091180.1:1..1301,gap(137),AAHY01091181.1:1..6427,gap(174),
CO   AAHY01091182.1:1..10191,gap(262),AAHY01091183.1:1..11762,gap(20),
CO   AAHY01091184.1:1..7754,gap(145),AAHY01091185.1:1..1150,gap(105),
CO   complement(AAHY01091186.1:1..1290),gap(60),AAHY01091187.1:1..4591,
CO   gap(2780),AAHY01091188.1:1..3967,gap(373),AAHY01091189.1:1..15186,
CO   gap(1357),AAHY01091190.1:1..5077,gap(212),
CO   complement(AAHY01091191.1:1..2211),gap(179),
CO   complement(AAHY01091192.1:1..744),gap(50),AAHY01091193.1:1..6812,gap(67),
CO   AAHY01091194.1:1..10491,gap(20),AAHY01091195.1:1..1563,gap(609),
CO   AAHY01091196.1:1..2693,gap(129),AAHY01091197.1:1..8904,gap(39),
CO   AAHY01091198.1:1..19587,gap(5250),complement(AAHY01091199.1:1..1263),
CO   gap(20),complement(AAHY01091200.1:1..1338),gap(20),AAHY01091201.1:1..3207,
CO   gap(525),AAHY01091202.1:1..1346,gap(237),AAHY01091203.1:1..2399,gap(20),
CO   complement(AAHY01091204.1:1..4271),gap(48),AAHY01091205.1:1..26183,
CO   gap(112),complement(AAHY01091206.1:1..4230),gap(57),
CO   complement(AAHY01091207.1:1..10582),gap(121),AAHY01091208.1:1..55790,
CO   gap(108),AAHY01091209.1:1..17758,gap(78),AAHY01091210.1:1..7798,gap(72),
CO   AAHY01091211.1:1..9560,gap(222),AAHY01091212.1:1..7228,gap(817),
CO   AAHY01091213.1:1..17051,gap(20),AAHY01091214.1:1..1667,gap(2249),
CO   AAHY01091215.1:1..12643,gap(55),AAHY01091216.1:1..4817,gap(20),
CO   AAHY01091217.1:1..2867,gap(20),AAHY01091218.1:1..1061,gap(20),
CO   AAHY01091219.1:1..11639,gap(20),AAHY01091220.1:1..3158,gap(49),
CO   AAHY01091221.1:1..4121,gap(20),AAHY01091222.1:1..22624,gap(20),
CO   AAHY01091223.1:1..34570,gap(20),AAHY01091224.1:1..6995,gap(28),
CO   AAHY01091225.1:1..17819,gap(20),AAHY01091226.1:1..2149,gap(20),
CO   complement(AAHY01091227.1:1..184),gap(1332),AAHY01091228.1:1..4216,
CO   gap(3202),AAHY01091229.1:1..3149,gap(20),
CO   complement(AAHY01091230.1:1..1451),gap(20),AAHY01091231.1:1..3326,gap(20),
CO   AAHY01091232.1:1..64708,gap(86),AAHY01091233.1:1..20298,gap(388),
CO   AAHY01091234.1:1..2086,gap(140),AAHY01091235.1:1..9502,gap(20),
CO   AAHY01091236.1:1..19997,gap(20),AAHY01091237.1:1..1231,gap(20),
CO   AAHY01091238.1:1..22513,gap(1557),AAHY01091239.1:1..4133,gap(37),
CO   AAHY01091240.1:1..4540,gap(20),AAHY01091241.1:1..19795,gap(116),
CO   AAHY01091242.1:1..4581,gap(69),AAHY01091243.1:1..14984,gap(20),
CO   AAHY01091244.1:1..7695,gap(352),AAHY01091245.1:1..22471,gap(450),
CO   complement(AAHY01091246.1:1..4812),gap(20),
CO   complement(AAHY01091247.1:1..1527),gap(20),AAHY01091248.1:1..14027,
CO   gap(230),AAHY01091249.1:1..11375,gap(20),
CO   complement(AAHY01091250.1:1..5445),gap(968),AAHY01091251.1:1..49271,
CO   gap(20),complement(AAHY01091252.1:1..13365),gap(26),
CO   AAHY01091253.1:1..29045,gap(137),complement(AAHY01091254.1:1..2514),
CO   gap(20),AAHY01091255.1:1..9056,gap(20),AAHY01091256.1:1..12676,gap(20),
CO   AAHY01091257.1:1..25750,gap(248),complement(AAHY01091258.1:1..3058),
CO   gap(525),AAHY01091259.1:1..8354,gap(176),
CO   complement(AAHY01091260.1:1..3282),gap(396),AAHY01091261.1:1..29909,
CO   gap(20),complement(AAHY01091262.1:1..6460),gap(108),
CO   AAHY01091263.1:1..60023,gap(102),complement(AAHY01091264.1:1..21223),
CO   gap(278),complement(AAHY01091265.1:1..16991),gap(636),
CO   AAHY01091266.1:1..19192,gap(522),AAHY01091267.1:1..1186,gap(20),
CO   AAHY01091268.1:1..20908,gap(20),complement(AAHY01091269.1:1..509),gap(62),
CO   complement(AAHY01091270.1:1..11747),gap(228),AAHY01091271.1:1..7076,
CO   gap(20),AAHY01091272.1:1..24368,gap(146),
CO   complement(AAHY01091273.1:1..98134),gap(20),AAHY01091274.1:1..47258,
CO   gap(20),AAHY01091275.1:1..72140,gap(20),
CO   complement(AAHY01091276.1:1..119031),gap(93),
CO   complement(AAHY01091277.1:1..26447),gap(20),
CO   complement(AAHY01091278.1:1..5298),gap(756),
CO   complement(AAHY01091279.1:1..28294),gap(46),AAHY01091280.1:1..931,
CO   gap(1361),AAHY01091281.1:1..1092,gap(1226),AAHY01091282.1:1..3225,
CO   gap(4443),AAHY01091283.1:1..7387,gap(681),AAHY01091284.1:1..233377,
CO   gap(1898),AAHY01091285.1:1..1045,gap(490),AAHY01091286.1:1..149821,
CO   gap(778),complement(AAHY01091287.1:1..9454),gap(61),
CO   AAHY01091288.1:1..10064,gap(3132),AAHY01091289.1:1..68037,gap(66),
CO   AAHY01091290.1:1..142313,gap(26),AAHY01091291.1:1..12890,gap(20),
CO   AAHY01091292.1:1..24260,gap(20),AAHY01091293.1:1..8395,gap(20),
CO   complement(AAHY01091294.1:1..1646),gap(20),AAHY01091295.1:1..50328,gap(76),
CO   AAHY01091296.1:1..30986,gap(20),complement(AAHY01091297.1:1..99453),
CO   gap(20),AAHY01091298.1:1..74365,gap(20),AAHY01091299.1:1..43298,gap(56),
CO   AAHY01091300.1:1..22016,gap(72),AAHY01091301.1:1..7313,gap(74),
CO   AAHY01091302.1:1..35876,gap(20),complement(AAHY01091303.1:1..20139),
CO   gap(132),AAHY01091304.1:1..12228,gap(163),AAHY01091305.1:1..16108,
CO   gap(1702),AAHY01091306.1:1..46589,gap(220),AAHY01091307.1:1..10318,
CO   gap(2066),AAHY01091308.1:1..22994,gap(58),AAHY01091309.1:1..3082,gap(20),
CO   complement(AAHY01091310.1:1..1113),gap(427),AAHY01091311.1:1..45453,
CO   gap(187),AAHY01091312.1:1..11400,gap(39),AAHY01091313.1:1..29159,gap(20),
CO   AAHY01091314.1:1..15148,gap(72),AAHY01091315.1:1..12632,gap(20),
CO   AAHY01091316.1:1..24424,gap(20),AAHY01091317.1:1..12126,gap(263),
CO   AAHY01091318.1:1..14339,gap(242),AAHY01091319.1:1..45182,gap(72),
CO   AAHY01091320.1:1..694,gap(288),AAHY01091321.1:1..21221,gap(4248),
CO   complement(AAHY01091322.1:1..30033),gap(20),
CO   complement(AAHY01091323.1:1..1009),gap(20),
CO   complement(AAHY01091324.1:1..2368),gap(20),AAHY01091325.1:1..2010,gap(20),
CO   complement(AAHY01091326.1:1..19464),gap(20),AAHY01091327.1:1..13386,
CO   gap(861),AAHY01091328.1:1..23689,gap(87),AAHY01091329.1:1..37735,gap(20),
CO   AAHY01091330.1:1..1281,gap(724),AAHY01091331.1:1..3826,gap(55),
CO   AAHY01091332.1:1..11950,gap(20),AAHY01091333.1:1..26217,gap(307),
CO   AAHY01091334.1:1..103751,gap(20),AAHY01091335.1:1..5796,gap(101),
CO   AAHY01091336.1:1..112397,gap(151),AAHY01091337.1:1..5240,gap(419),
CO   AAHY01091338.1:1..2582,gap(20),AAHY01091339.1:1..49883,gap(20),
CO   AAHY01091340.1:1..22577,gap(208),complement(AAHY01091341.1:1..838),
CO   gap(150),AAHY01091342.1:1..7740,gap(85),AAHY01091343.1:1..19936,gap(1383),
CO   AAHY01091344.1:1..8614,gap(20),complement(AAHY01091345.1:1..20686),
CO   gap(711),complement(AAHY01091346.1:1..3949),gap(20),AAHY01091347.1:1..6041,
CO   gap(20),AAHY01091348.1:1..21444,gap(834),AAHY01091349.1:1..44470,gap(20),
CO   complement(AAHY01091350.1:1..16065),gap(204),
CO   complement(AAHY01091351.1:1..2533),gap(20),AAHY01091352.1:1..1959,gap(20),
CO   complement(AAHY01091353.1:1..3009),gap(70),
CO   complement(AAHY01091354.1:1..8452),gap(20),AAHY01091355.1:1..13872,gap(20),
CO   AAHY01091356.1:1..13794,gap(133),complement(AAHY01091357.1:1..43594),
CO   gap(20),complement(AAHY01091358.1:1..6369),gap(168),
CO   AAHY01091359.1:1..41390,gap(128),AAHY01091360.1:1..5777,gap(20),
CO   complement(AAHY01091361.1:1..2374),gap(20),
CO   complement(AAHY01091362.1:1..52051),gap(350),
CO   complement(AAHY01091363.1:1..5846),gap(50),
CO   complement(AAHY01091364.1:1..14794),gap(842),
CO   complement(AAHY01091365.1:1..21143),gap(640),AAHY01091366.1:1..1208,
CO   gap(4273),AAHY01091367.1:1..35750,gap(38),AAHY01091368.1:1..7014,gap(20),
CO   AAHY01091369.1:1..27237,gap(20),AAHY01091370.1:1..8344,gap(186),
CO   AAHY01091371.1:1..34429,gap(20),AAHY01091372.1:1..52551,gap(210),
CO   AAHY01091373.1:1..22068,gap(20),AAHY01091374.1:1..46802,gap(54),
CO   AAHY01091375.1:1..17656,gap(20),AAHY01091376.1:1..23508,gap(213),
CO   AAHY01091377.1:1..1614,gap(4989),AAHY01091378.1:1..16016,gap(137),
CO   AAHY01091379.1:1..54058,gap(274),AAHY01091380.1:1..5887,gap(54),
CO   AAHY01091381.1:1..8520,gap(20),AAHY01091382.1:1..1060,gap(86),
CO   AAHY01091383.1:1..38517,gap(20),AAHY01091384.1:1..4150,gap(279),
CO   AAHY01091385.1:1..33347,gap(20),complement(AAHY01091386.1:1..4522),gap(20),
CO   AAHY01091387.1:1..71175,gap(36),AAHY01091388.1:1..22457,gap(292),
CO   AAHY01091389.1:1..3881,gap(20),AAHY01091390.1:1..38853,gap(20),
CO   AAHY01091391.1:1..29294,gap(20),AAHY01091392.1:1..31734,gap(20),
CO   AAHY01091393.1:1..21176,gap(20),AAHY01091394.1:1..8890,gap(335),
CO   AAHY01091395.1:1..8451,gap(20),AAHY01091396.1:1..15294,gap(20),
CO   AAHY01091397.1:1..2388,gap(261),complement(AAHY01091398.1:1..16280),
CO   gap(20),complement(AAHY01091399.1:1..7142),gap(20),AAHY01091400.1:1..3386,
CO   gap(125),complement(AAHY01091401.1:1..15525),gap(125),
CO   complement(AAHY01091402.1:1..36659),gap(68),
CO   complement(AAHY01091403.1:1..9523),gap(109),AAHY01091404.1:1..23271,
CO   gap(20),complement(AAHY01091405.1:1..14799),gap(20),
CO   complement(AAHY01091406.1:1..38172),gap(200),AAHY01091407.1:1..75580,
CO   gap(233),AAHY01091408.1:1..14889,gap(3514),AAHY01091409.1:1..5497,
CO   gap(1537),AAHY01091410.1:1..1760,gap(20),AAHY01091411.1:1..6785,gap(20),
CO   complement(AAHY01091412.1:1..3324),gap(20),AAHY01091413.1:1..20975,gap(20),
CO   AAHY01091414.1:1..2436,gap(20),complement(AAHY01091415.1:1..1806),gap(20),
CO   AAHY01091416.1:1..8415,gap(20),AAHY01091417.1:1..2175,gap(20),
CO   AAHY01091418.1:1..17653,gap(630),AAHY01091419.1:1..1502,gap(1304),
CO   AAHY01091420.1:1..23149,gap(20),AAHY01091421.1:1..2617,gap(320),
CO   AAHY01091422.1:1..54397,gap(134),complement(AAHY01091423.1:1..10538),
CO   gap(20),AAHY01091424.1:1..1278,gap(20),AAHY01091425.1:1..6381,gap(288),
CO   AAHY01091426.1:1..52677,gap(124),AAHY01091427.1:1..43462,gap(47),
CO   AAHY01091428.1:1..1281,gap(20),AAHY01091429.1:1..13036,gap(20),
CO   AAHY01091430.1:1..1527,gap(812),AAHY01091431.1:1..4233,gap(755),
CO   complement(AAHY01091432.1:1..7385),gap(524),AAHY01091433.1:1..29445,
CO   gap(20),AAHY01091434.1:1..14075,gap(2511),AAHY01091435.1:1..6724,gap(20),
CO   AAHY01091436.1:1..4736,gap(20),complement(AAHY01091437.1:1..1198),gap(177),
CO   AAHY01091438.1:1..8926,gap(20),complement(AAHY01091439.1:1..2919),
CO   gap(9057),AAHY01091440.1:1..26465,gap(20),
CO   complement(AAHY01091441.1:1..1281),gap(20),
CO   complement(AAHY01091442.1:1..1329),gap(20),
CO   complement(AAHY01091443.1:1..1649),gap(20),AAHY01091444.1:1..37079,
CO   gap(208),AAHY01091445.1:1..48708,gap(91),AAHY01091446.1:1..7763,gap(975),
CO   complement(AAHY01091447.1:1..4069),gap(20),
CO   complement(AAHY01091448.1:1..1062),gap(20),AAHY01091449.1:1..1126,gap(20),
CO   AAHY01091450.1:1..27434,gap(110),AAHY01091451.1:1..41182,gap(753),
CO   AAHY01091452.1:1..18722,gap(369),AAHY01091453.1:1..1512,gap(20),
CO   AAHY01091454.1:1..6119,gap(20),AAHY01091455.1:1..657,gap(470),
CO   AAHY01091456.1:1..13147,gap(25),AAHY01091457.1:1..51342,gap(712),
CO   AAHY01091458.1:1..15378,gap(20),AAHY01091459.1:1..38379,gap(119),
CO   AAHY01091460.1:1..45932,gap(20),AAHY01091461.1:1..14374,gap(20),
CO   complement(AAHY01091462.1:1..8235),gap(20),AAHY01091463.1:1..2682,gap(20),
CO   AAHY01091464.1:1..1478,gap(1375),AAHY01091465.1:1..48506,gap(2286),
CO   AAHY01091466.1:1..20452,gap(20),complement(AAHY01091467.1:1..1129),gap(20),
CO   AAHY01091468.1:1..1077,gap(20),AAHY01091469.1:1..5705,gap(20),
CO   AAHY01091470.1:1..47902,gap(20),AAHY01091471.1:1..6342,gap(20),
CO   complement(AAHY01091472.1:1..1385),gap(20),
CO   complement(AAHY01091473.1:1..1879),gap(20),AAHY01091474.1:1..3087,gap(20),
CO   AAHY01091475.1:1..1177,gap(590),AAHY01091476.1:1..1155,gap(20),
CO   AAHY01091477.1:1..8312,gap(151),AAHY01091478.1:1..2171,gap(20),
CO   complement(AAHY01091479.1:1..14311),gap(20),AAHY01091480.1:1..2149,gap(20),
CO   AAHY01091481.1:1..1467,gap(396),AAHY01091482.1:1..3613,gap(20),
CO   AAHY01091483.1:1..1101,gap(20),AAHY01091484.1:1..1527,gap(20),
CO   AAHY01091485.1:1..53956,gap(28),AAHY01091486.1:1..14728,gap(20),
CO   AAHY01091487.1:1..20302,gap(20),AAHY01091488.1:1..1353,gap(1596),
CO   complement(AAHY01091489.1:1..1838),gap(20),AAHY01091490.1:1..5223,gap(20),
CO   complement(AAHY01091491.1:1..2029),gap(20),
CO   complement(AAHY01091492.1:1..7332),gap(185),AAHY01091493.1:1..6209,gap(20),
CO   AAHY01091494.1:1..21493,gap(44),AAHY01091495.1:1..81418,gap(20),
CO   AAHY01091496.1:1..6503,gap(20),AAHY01091497.1:1..9007,gap(20),
CO   complement(AAHY01091498.1:1..10230),gap(103),
CO   complement(AAHY01091499.1:1..6638),gap(143),AAHY01091500.1:1..4213,gap(20),
CO   complement(AAHY01091501.1:1..4763),gap(20),AAHY01091502.1:1..31877,gap(88),
CO   AAHY01091503.1:1..21307,gap(20),AAHY01091504.1:1..3178,gap(20),
CO   AAHY01091505.1:1..11101,gap(4740),AAHY01091506.1:1..43237,gap(87),
CO   AAHY01091507.1:1..8533,gap(294),AAHY01091508.1:1..5996,gap(1252),
CO   AAHY01091509.1:1..22135,gap(1923),AAHY01091510.1:1..2175,gap(20),
CO   AAHY01091511.1:1..29763,gap(198),AAHY01091512.1:1..4213,gap(149),
CO   AAHY01091513.1:1..49316,gap(248),AAHY01091514.1:1..6495,gap(133),
CO   AAHY01091515.1:1..11124,gap(123),AAHY01091516.1:1..13811,gap(156),
CO   AAHY01091517.1:1..5945,gap(20),AAHY01091518.1:1..28247,gap(20),
CO   AAHY01091519.1:1..6659,gap(20),AAHY01091520.1:1..3712,gap(20),
CO   AAHY01091521.1:1..101951,gap(149),AAHY01091522.1:1..24506,gap(20),
CO   AAHY01091523.1:1..1469,gap(344),complement(AAHY01091524.1:1..3967),
CO   gap(1172),complement(AAHY01091525.1:1..3375),gap(20),
CO   complement(AAHY01091526.1:1..1633),gap(20),
CO   complement(AAHY01091527.1:1..1118),gap(20),AAHY01091528.1:1..7418,gap(20),
CO   AAHY01091529.1:1..17412,gap(20),AAHY01091530.1:1..1139,gap(20),
CO   AAHY01091531.1:1..5072,gap(424),AAHY01091532.1:1..3324,gap(20),
CO   AAHY01091533.1:1..2157,gap(3382),complement(AAHY01091534.1:1..1429),
CO   gap(20),AAHY01091535.1:1..9329,gap(1033),AAHY01091536.1:1..30057,gap(20),
CO   AAHY01091537.1:1..12792,gap(731),AAHY01091538.1:1..16484)
//


spacer
spacer