spacer

EBI Dbfetch

ID   CH466594; SV 1; linear; genomic DNA; CON; MUS; 8498302 BP.
XX
AC   CH466594;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009773910 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8498302
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-8498302
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 74184317c5350a5c32a811abd3026f49.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000212.
DR   Ensembl-Gn; ENSMUSG00000006442; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023153; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023286; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024793; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028940; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028967; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028972; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028976; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028992; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028996; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029001; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029016; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029026; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029029; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029049; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029050; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029053; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029060; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029063; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029064; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029068; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029075; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029076; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035692; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039662; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039759; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041616; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041954; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042233; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047719; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047875; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048001; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055401; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058183; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059040; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063077; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063524; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073680; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073700; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073705; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078484; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000084845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006611; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030848; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030865; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030886; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030903; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030917; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030940; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030944; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030952; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036680; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049621; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069604; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073600; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080926; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094408; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094451; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097788; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103176; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105569; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105578; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105579; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105663; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105689; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105696; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123952; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000133533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139685; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152498; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167160; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168552; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172710; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176637; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178238; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8498302
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gap             18908..18927
FT                   /estimated_length=20
FT   gap             25320..26623
FT                   /estimated_length=1304
FT   gap             27834..27853
FT                   /estimated_length=20
FT   gap             31373..31556
FT                   /estimated_length=184
FT   gap             32629..32648
FT                   /estimated_length=20
FT   gap             34849..34868
FT                   /estimated_length=20
FT   gap             41081..41647
FT                   /estimated_length=567
FT   gap             42958..42977
FT                   /estimated_length=20
FT   gap             43666..44378
FT                   /estimated_length=713
FT   gap             45343..45713
FT                   /estimated_length=371
FT   gap             47532..47551
FT                   /estimated_length=20
FT   gap             49203..49222
FT                   /estimated_length=20
FT   gap             50675..50694
FT                   /estimated_length=20
FT   gene            complement(51602..52104)
FT                   /pseudo
FT                   /locus_tag="mCG_133672"
FT                   /note="gene_id=mCG133672.1"
FT   mRNA            complement(51602..52104)
FT                   /pseudo
FT                   /locus_tag="mCG_133672"
FT                   /note="gene_id=mCG133672.1 transcript_id=mCT135042.1
FT                   created on 26-DEC-2002"
FT   gap             55749..55768
FT                   /estimated_length=20
FT   gap             56810..56829
FT                   /estimated_length=20
FT   gene            complement(60491..>63559)
FT                   /gene="MGC67181"
FT                   /locus_tag="mCG_133680"
FT                   /note="gene_id=mCG133680.1"
FT   mRNA            complement(join(60491..61724,63173..63233,63433..>63559))
FT                   /gene="MGC67181"
FT                   /locus_tag="mCG_133680"
FT                   /product="zinc finger-like protein"
FT                   /note="gene_id=mCG133680.1 transcript_id=mCT135050.1
FT                   created on 26-DEC-2002"
FT   CDS             complement(join(60509..61724,63173..63233,63433..>63559))
FT                   /codon_start=1
FT                   /gene="MGC67181"
FT                   /locus_tag="mCG_133680"
FT                   /product="zinc finger-like protein"
FT                   /note="gene_id=mCG133680.1 transcript_id=mCT135050.1
FT                   protein_id=mCP76897.1"
FT                   /protein_id="EDL14781.1"
FT                   /translation="DAVSYDDVHVNFTQEEWVLLDPSQKSLYKDVMLETYRNLSAIGYN
FT                   WEAHPTEEHCQSSRRRGRHERSPTGEEPYECNKSGKAFAYHHYPQWHERIHTGEKPYEV
FT                   IQYGEDFVYHSSLQIYKRIAIGEKPYECNQCGKAFTYHSQLRRHKRTHTGEKPYKCNQC
FT                   DKAFSQNGHLIIHKRTHTGEKPYECNQCGKAFTDQSQLRIHKRAHTGEKPYKCNQCDKA
FT                   FLQNINLRIHKRAHTGEKPYKCNQCDKAFAQNGHLIIHKRTHTGEKPYECNQCGKAFAD
FT                   QSQLRIHRRIHTGEKPYKCNQCDKAFAQHSNLRIHKRTHTGEKPYECNQCDKAFLQNIN
FT                   LKIHKRAHTGEKSYECSQCGKAFARYYHLQCHERIHTEEKPYKCNQCDKVFSQSHSLQI
FT                   HKRTHTGEKPYVCNQCGKAFADNSHLRRHKRTHTGEKPYECNQCGSAFSQNSYLRIHKR
FT                   THTGEKHFE"
FT   gap             69137..69653
FT                   /estimated_length=517
FT   gap             71776..71843
FT                   /estimated_length=68
FT   gap             73998..74017
FT                   /estimated_length=20
FT   gap             75249..76009
FT                   /estimated_length=761
FT   gap             80856..82123
FT                   /estimated_length=1268
FT   gap             83539..86603
FT                   /estimated_length=3065
FT   gap             87844..87863
FT                   /estimated_length=20
FT   gap             90525..91791
FT                   /estimated_length=1267
FT   gap             92759..92992
FT                   /estimated_length=234
FT   gap             94482..98169
FT                   /estimated_length=3688
FT   gene            complement(<98226..109020)
FT                   /locus_tag="mCG_11728"
FT                   /note="gene_id=mCG11728.2"
FT   mRNA            complement(join(<98226..98297,98566..98703,102522..102618,
FT                   102714..102843,103173..103225,103304..103412,
FT                   105660..105741,106126..106485,106709..106893,
FT                   108842..109020))
FT                   /locus_tag="mCG_11728"
FT                   /product="mCG11728, transcript variant mCT11924"
FT                   /note="gene_id=mCG11728.2 transcript_id=mCT11924.2 created
FT                   on 20-NOV-2002"
FT   CDS             complement(join(98226..98297,98566..98703,102522..102618,
FT                   102714..102843,103173..103225,103304..103412,
FT                   105660..105741,106126..106485,106709..106831))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11728"
FT                   /product="mCG11728, isoform CRA_a"
FT                   /note="gene_id=mCG11728.2 transcript_id=mCT11924.2
FT                   protein_id=mCP19369.2 isoform=CRA_a"
FT                   /db_xref="GOA:C0KL25"
FT                   /db_xref="MGI:MGI:106506"
FT                   /db_xref="UniProtKB/TrEMBL:C0KL25"
FT                   /protein_id="EDL14782.1"
FT                   /translation="MPNMAETKDPVRLRLLSLELLKQLWAGHEAMCRSVVRAASGSNLD
FT                   CSSNNLEMPLSQETSSASSVAPSSQDKRHMLDPLDSRRDDTFDVAWYVKFNSRMDSFLP
FT                   ATGQHQEPQEELRPPSVPLLATQGLKGPVSLGGPKGLGPDKTQVPRSILSRLSKPSKPR
FT                   VTSQESAVPESSWHSRPYLGYDWIAGSLDNSSPVTSEPEAFFSMLQRFRENNKEDCVCN
FT                   SPEAVFPGLQESSGVEEDHECMYCYRINRRLFPEPVDPGAPCRLCGIPRDEKGPGTLVE
FT                   PVQVRVSIPLSIMDPPHQYRIHRRKSFDASDTLALPRHCLLGWDILPPKSEKTSVPKSL
FT                   DLWSSVSYGAGQRRDLSATSPPCQALPAQVTPPLWSEPQVAQLCPSH"
FT   gap             99341..99360
FT                   /estimated_length=20
FT   gap             100170..100427
FT                   /estimated_length=258
FT   mRNA            complement(join(101447..101753,102023..102075,
FT                   102522..102618,102714..102843,103173..103225,
FT                   103304..103412,105660..105741,106126..106485,
FT                   106709..106893,108842..109020))
FT                   /locus_tag="mCG_11728"
FT                   /product="mCG11728, transcript variant mCT176126"
FT                   /note="gene_id=mCG11728.2 transcript_id=mCT176126.0 created
FT                   on 20-NOV-2002"
FT   CDS             complement(join(101618..101753,102023..102075,
FT                   102522..102618,102714..102843,103173..103225,
FT                   103304..103412,105660..105741,106126..106485,
FT                   106709..106831))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11728"
FT                   /product="mCG11728, isoform CRA_b"
FT                   /note="gene_id=mCG11728.2 transcript_id=mCT176126.0
FT                   protein_id=mCP99048.0 isoform=CRA_b"
FT                   /protein_id="EDL14783.1"
FT                   /translation="MPNMAETKDPVRLRLLSLELLKQLWAGHEAMCRSVVRAASGSNLD
FT                   CSSNNLEMPLSQETSSASSVAPSSQDKRHMLDPLDSRRDDTFDVAWYVKFNSRMDSFLP
FT                   ATGQHQEPQEELRPPSVPLLATQGLKGPVSLGGPKGLGPDKTQVPRSILSRLSKPSKPR
FT                   VTSQESAVPESSWHSRPYLGYDWIAGSLDNSSPVTSEPEAFFSMLQRFRENNKEDCVCN
FT                   SPEAVFPGLQESSGVEEDHECMYCYRINRRLFPEPVDPGAPCRLCGIPRDEKGPGTLVE
FT                   PVQVRVSIPLSIMDPPHQYRIHRRKSFDASDTLALPRPMEQGSAGICQPLAHPVRPCQH
FT                   RSHHLSGQSPRLPSSVPPTRSPEDRRPRRQQYSTSANSLP"
FT   gap             102076..102126
FT                   /estimated_length=51
FT   gap             105004..105229
FT                   /estimated_length=226
FT   gene            <109452..>110699
FT                   /locus_tag="mCG_133676"
FT                   /note="gene_id=mCG133676.0"
FT   mRNA            <109452..>110699
FT                   /locus_tag="mCG_133676"
FT                   /product="mCG133676"
FT                   /note="gene_id=mCG133676.0 transcript_id=mCT135046.0
FT                   created on 20-NOV-2002"
FT   CDS             109452..>110699
FT                   /codon_start=1
FT                   /locus_tag="mCG_133676"
FT                   /product="mCG133676"
FT                   /note="gene_id=mCG133676.0 transcript_id=mCT135046.0
FT                   protein_id=mCP76752.0"
FT                   /protein_id="EDL14784.1"
FT                   /translation="MNFPRALAGFSSWLFKPELAEDSPDNDSPDNDTVNPWRELLQKIN
FT                   VADLPDSSFSSGKELNDSVYHTFEHFCKIRDYDAVGELLLAFLDKVTKERDQFRDEISQ
FT                   LRMHINDLKASKCVLGETLLSYRHRIEVGEKQTEALIVRLADVQSQVMCQPARKVSADK
FT                   VRALIGKEWDPVTWDGDVWEDIDSEGSEEAELPTVLASPSLSEESGYALSKERTQQDKA
FT                   DAPQIQSSTSLVTSEPVTRPKSLSDLTSQKHRHTNHELNSLAHSNRQKAKEHARKWILR
FT                   VWDNGGRLTILDQIEFLSLGPLSLDSEFNVIARTVEDNGVKSLFDWLAEAWVQRWPTTR
FT                   ELQSPDTLEWYFIEDGIKRLRELGMIEWLCVKATCPQWRGPEDVPITRAMRITFVRETV
FT                   ETWKSFVFSLLCIKDIT"
FT   gap             110715..111718
FT                   /estimated_length=1004
FT   gap             113938..116193
FT                   /estimated_length=2256
FT   gene            complement(116194..148891)
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /note="gene_id=mCG11730.2"
FT   mRNA            complement(join(116194..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147116..147198,147543..147685,148844..148891))
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, transcript variant mCT11928"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT11928.2 created
FT                   on 20-NOV-2002"
FT   mRNA            complement(join(116194..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147543..147685,148844..>148877))
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, transcript variant mCT190891"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT190891.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(116299..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147543..147685,148636..>148836))
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, transcript variant mCT190890"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT190890.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(117676..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147543..>147595))
FT                   /codon_start=1
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, isoform CRA_b"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT190890.0
FT                   protein_id=mCP111807.0 isoform=CRA_b"
FT                   /protein_id="EDL14786.1"
FT                   /translation="LQPCPRCPTCEGLLPARNEMSLLFSRCNSIVTVKKDKRHMAEVNA
FT                   SPLKHFVTAKKKINGIFEQLGAYIQESASFLEDTHRNTELDPVTTEEQVLDVKGYLSKV
FT                   RGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEA
FT                   FLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGI
FT                   DVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDA
FT                   SASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMP
FT                   EGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQHTVRAKQIAEAVRLIMDSLH
FT                   IAAQEQRVYCLEMREERQDRLRFIDKQLELLAQDYKLRIKQITEEVERQVSTAMAEEIR
FT                   RLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNLSDRCSTAIASSLQTMQQDMI
FT                   DGLKPLLPVSMRNQIDMLVPRQCFSLSYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFL
FT                   GPKNSRRALLGYSDQVQRPLPLTPANPSMPPLPQSSLTQEELMVSMVTGLASLTSRTSM
FT                   GILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTKAKERAFKRQFVEYASEKLQL
FT                   IISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKKVEALDSLQSRAKLL
FT                   RNKAGWLDSELNMFTHQYLQPSR"
FT   CDS             complement(join(117676..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147543..>147595))
FT                   /codon_start=1
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, isoform CRA_b"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT190891.0
FT                   protein_id=mCP111808.0 isoform=CRA_b"
FT                   /protein_id="EDL14787.1"
FT                   /translation="LQPCPRCPTCEGLLPARNEMSLLFSRCNSIVTVKKDKRHMAEVNA
FT                   SPLKHFVTAKKKINGIFEQLGAYIQESASFLEDTHRNTELDPVTTEEQVLDVKGYLSKV
FT                   RGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEA
FT                   FLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGI
FT                   DVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDA
FT                   SASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMP
FT                   EGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQHTVRAKQIAEAVRLIMDSLH
FT                   IAAQEQRVYCLEMREERQDRLRFIDKQLELLAQDYKLRIKQITEEVERQVSTAMAEEIR
FT                   RLSVLVDEYQMDFHPSPVVLKVYKNELHRHIEEGLGRNLSDRCSTAIASSLQTMQQDMI
FT                   DGLKPLLPVSMRNQIDMLVPRQCFSLSYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFL
FT                   GPKNSRRALLGYSDQVQRPLPLTPANPSMPPLPQSSLTQEELMVSMVTGLASLTSRTSM
FT                   GILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTKAKERAFKRQFVEYASEKLQL
FT                   IISYTGSNCSHQVQQELSGTFAHLCQQVDITRDNLEQEIAAMNKKVEALDSLQSRAKLL
FT                   RNKAGWLDSELNMFTHQYLQPSR"
FT   CDS             complement(join(117676..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142823))
FT                   /codon_start=1
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, isoform CRA_a"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT11928.2
FT                   protein_id=mCP19376.2 isoform=CRA_a"
FT                   /protein_id="EDL14785.1"
FT                   /translation="MSLLFSRCNSIVTVKKDKRHMAEVNASPLKHFVTAKKKINGIFEQ
FT                   LGAYIQESASFLEDTHRNTELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGR
FT                   TSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQL
FT                   AHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADV
FT                   FVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERC
FT                   TSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQN
FT                   FERRFEECISQSAVKTKFEQHTVRAKQIAEAVRLIMDSLHIAAQEQRVYCLEMREERQD
FT                   RLRFIDKQLELLAQDYKLRIKQITEEVERQVSTAMAEEIRRLSVLVDEYQMDFHPSPVV
FT                   LKVYKNELHRHIEEGLGRNLSDRCSTAIASSLQTMQQDMIDGLKPLLPVSMRNQIDMLV
FT                   PRQCFSLSYDLNCDKLCADFQEDIEFHFSLGWTMLVNRFLGPKNSRRALLGYSDQVQRP
FT                   LPLTPANPSMPPLPQSSLTQEELMVSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIA
FT                   LSFGLYGLLYVYERLTWTTKAKERAFKRQFVEYASEKLQLIISYTGSNCSHQVQQELSG
FT                   TFAHLCQQVDITRDNLEQEIAAMNKKVEALDSLQSRAKLLRNKAGWLDSELNMFTHQYL
FT                   QPSR"
FT   gap             130779..130798
FT                   /estimated_length=20
FT   gap             132245..132264
FT                   /estimated_length=20
FT   gap             133953..133972
FT                   /estimated_length=20
FT   gene            complement(153900..180543)
FT                   /gene="Plod1"
FT                   /locus_tag="mCG_11727"
FT                   /note="gene_id=mCG11727.2"
FT   mRNA            complement(join(153900..155017,157159..157284,
FT                   159737..159883,161245..161349,162075..162140,
FT                   162721..162834,164110..164251,164935..165060,
FT                   165326..165430,167052..167173,169406..169537,
FT                   170036..170137,170912..171009,172259..172322,
FT                   173341..173453,174923..175086,175428..175564,
FT                   176532..176623,180406..180543))
FT                   /gene="Plod1"
FT                   /locus_tag="mCG_11727"
FT                   /product="procollagen-lysine, 2-oxoglutarate 5-dioxygenase
FT                   1"
FT                   /note="gene_id=mCG11727.2 transcript_id=mCT11923.2 created
FT                   on 21-NOV-2002"
FT   CDS             complement(join(154862..155017,157159..157284,
FT                   159737..159883,161245..161349,162075..162140,
FT                   162721..162834,164110..164251,164935..165060,
FT                   165326..165430,167052..167173,169406..169537,
FT                   170036..170137,170912..171009,172259..172322,
FT                   173341..173453,174923..175086,175428..175564,
FT                   176532..176623,180406..180481))
FT                   /codon_start=1
FT                   /gene="Plod1"
FT                   /locus_tag="mCG_11727"
FT                   /product="procollagen-lysine, 2-oxoglutarate 5-dioxygenase
FT                   1"
FT                   /note="gene_id=mCG11727.2 transcript_id=mCT11923.2
FT                   protein_id=mCP19360.2"
FT                   /protein_id="EDL14788.1"
FT                   /translation="MRSLLLLAPLAWLLLVQAKDDAKLEDNLLVLTVATKETEGFRRFK
FT                   RSAQFFNYKIQSLGLGEDWSVDGGPAAAGGGQKVRLLKKALEKHADKEDLVILFVDSYD
FT                   VVFASGPRELLKKFQQAKSQVVFSAEEHIYPDRRLEAKYPTVPDGKRFLGSGGFIGYAP
FT                   SLSKLVAEWEGQDSDSDQLFYTKIFLNPEKREQINISLDHRCRIFQNLDGALDEVVLKF
FT                   EMGHVRARNLAYDTLPVVVHGNGPTKLQLNYLGNYIPRFWTFETGCTVCDEGLRSLKGI
FT                   GDEALPTVLVGVFIEQPTPFLSLFFLRLLRLRYPQKQMRLFIHNQERHHKLQVEQFLAE
FT                   HGSEYQSVKLVGPEVRMANADARNMGADLCRQDQTCTYYFSVDADVALTEPNSLRLLIE
FT                   QNKNVIAPLMTRHGRLWSNFWGGLSADGYYARSEDYVDIVQGRRVGVWNVPYISNIYLI
FT                   KGSALRAELQNVDLFHYSKLDSDMSFCANVRQQEVFMFLTNRHTFGHLLSLDNYQTTHL
FT                   HNDLWEVFSNPEDWKEKYIHENYTKALAGKLVETPCPDVYWFPIFTEAACDELVEEMEH
FT                   YGQWSLGDNKDNRIQGGYENVPTIDIHMNQITFEREWHKFLVEYIAPMTEKLYPGYYTR
FT                   AQFDLAFVVRYKPDEQPSLMPHHDASTFTVNIALNRVGEDYEGGGCRFLRYNCSVRAPR
FT                   KGWALLHPGRLTHYHEGLPTTKGTRYIAVSFVDP"
FT   gap             172022..172087
FT                   /estimated_length=66
FT   gap             184573..185041
FT                   /estimated_length=469
FT   gene            <185042..191288
FT                   /gene="2510039O18Rik"
FT                   /locus_tag="mCG_11733"
FT                   /note="gene_id=mCG11733.2"
FT   mRNA            join(<185042..185963,188582..189435,190575..191288)
FT                   /gene="2510039O18Rik"
FT                   /locus_tag="mCG_11733"
FT                   /product="RIKEN cDNA 2510039O18"
FT                   /note="gene_id=mCG11733.2 transcript_id=mCT11929.2 created
FT                   on 21-NOV-2002"
FT   CDS             join(<185042..185963,188582..189435,190575..190592)
FT                   /codon_start=1
FT                   /gene="2510039O18Rik"
FT                   /locus_tag="mCG_11733"
FT                   /product="RIKEN cDNA 2510039O18"
FT                   /note="gene_id=mCG11733.2 transcript_id=mCT11929.2
FT                   protein_id=mCP19395.2"
FT                   /protein_id="EDL14789.1"
FT                   /translation="SGARRAAGGLHLPSWARSEPGAAEPSACLEAATRAWRGLRDRGEA
FT                   VPLGPGVPALVANGFLALDASNNRLWVTPGEREPAVTPDFVPFVQLRPLNVVAEAGEAV
FT                   LLLREGLLRRVRCLQLGTPGSGPAAGVPGPASASGLSAGSGRDCVLLQEDFLAHRGRPH
FT                   VYLQRIQLNNPTERVAALQTVGPTAGPVPKSFTSTLEKVGDHQFLLYSGRSTPLPSGLV
FT                   HLVVVTSKKLVNRLQVAPKTQLDETVLWVVHISGPIHPQVLKSKGAKELKALQDLARKE
FT                   MLELLEMPASELLQDHQYLWAQLFSPGVEMKRITDAHTPSGLTVNLTLYYMLSCSPAPL
FT                   LSPSLSHREREQMEATLNYEDHCFSGHATMHAENLWPGQLSSVQQILQLADLWKLTLQK
FT                   RGCKGLVKVGAPGILQGMVLSFGGLQFTENHLQFQADPEVLHNSYALHGIRYKNDHINL
FT                   AVLVDAEGKPYLHVSLESRGQPVKIYACEAGCLHDPVELTSEPGGHTFSVMVTQPITPL
FT                   LYISTDLTHLQDLRHTLHLKAILAHDEHMAQQDPGLPFLFWFSVASLITLFHLFLFKLI
FT                   YNEYCGPGAKPLFRSKEDPSV"
FT   gap             186281..186949
FT                   /estimated_length=669
FT   gap             194816..195561
FT                   /estimated_length=746
FT   gene            229695..230995
FT                   /gene="Nppb"
FT                   /locus_tag="mCG_11731"
FT                   /note="gene_id=mCG11731.2"
FT   mRNA            join(229695..229898,230093..230315,230759..230995)
FT                   /gene="Nppb"
FT                   /locus_tag="mCG_11731"
FT                   /product="natriuretic peptide precursor type B"
FT                   /note="gene_id=mCG11731.2 transcript_id=mCT11925.2 created
FT                   on 21-NOV-2002"
FT   CDS             join(229773..229898,230093..230315,230759..230775)
FT                   /codon_start=1
FT                   /gene="Nppb"
FT                   /locus_tag="mCG_11731"
FT                   /product="natriuretic peptide precursor type B"
FT                   /note="gene_id=mCG11731.2 transcript_id=mCT11925.2
FT                   protein_id=mCP19391.1"
FT                   /db_xref="GOA:O55086"
FT                   /db_xref="InterPro:IPR000663"
FT                   /db_xref="InterPro:IPR002408"
FT                   /db_xref="UniProtKB/TrEMBL:O55086"
FT                   /protein_id="EDL14790.1"
FT                   /translation="MDLLKVLSQMILFLLFLYLSPLGGHSHPLGSPSQSPEQFKMQKLL
FT                   ELIREKSEEMAQRQLLKDQGLTKEHPKRVLRSQGSTLRVQQRPQNSKVTHISSCFGHKI
FT                   DRIGSVSRLGCNALKLL"
FT   gap             234619..234638
FT                   /estimated_length=20
FT   gap             235896..235915
FT                   /estimated_length=20
FT   gap             238077..238096
FT                   /estimated_length=20
FT   gap             239504..239523
FT                   /estimated_length=20
FT   gene            246404..247884
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /note="gene_id=mCG11724.1"
FT   mRNA            join(246404..246712,246816..247142,247533..247884)
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /product="natriuretic peptide precursor type A, transcript
FT                   variant mCT11920"
FT                   /note="gene_id=mCG11724.1 transcript_id=mCT11920.1 created
FT                   on 26-DEC-2002"
FT   mRNA            join(246506..246712,247103..247142,247533..247780)
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /product="natriuretic peptide precursor type A, transcript
FT                   variant mCT178502"
FT                   /note="gene_id=mCG11724.1 transcript_id=mCT178502.0 created
FT                   on 26-DEC-2002"
FT   CDS             join(246593..246712,247103..247142,247533..247579)
FT                   /codon_start=1
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /product="natriuretic peptide precursor type A, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11724.1 transcript_id=mCT178502.0
FT                   protein_id=mCP101424.0 isoform=CRA_a"
FT                   /protein_id="EDL14791.1"
FT                   /translation="MGSFSITLGFFLVLAFWLPGHIGANPVYSAVSNTDLMDFKDWSPE
FT                   WTRLQQLPVPKITAKEEKAVDSA"
FT   CDS             join(246593..246712,246816..247142,247533..247544)
FT                   /codon_start=1
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /product="natriuretic peptide precursor type A, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11724.1 transcript_id=mCT11920.1
FT                   protein_id=mCP19397.2 isoform=CRA_b"
FT                   /db_xref="GOA:P05125"
FT                   /db_xref="InterPro:IPR000663"
FT                   /db_xref="InterPro:IPR002407"
FT                   /db_xref="MGI:MGI:97367"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05125"
FT                   /protein_id="EDL14792.1"
FT                   /translation="MGSFSITLGFFLVLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDH
FT                   LEEKMPVEDEVMPPQALSEQTEEAGAALSSLPEVPPWTGEVNPPLRDGSALGRSPWDPS
FT                   DRSALLKSKLRALLAGPRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR"
FT   gene            complement(251834..284779)
FT                   /gene="Clcn6"
FT                   /locus_tag="mCG_11729"
FT                   /note="gene_id=mCG11729.2"
FT   mRNA            complement(join(251834..252614,254434..254559,
FT                   254652..254759,256407..256563,256725..256882,
FT                   258370..258556,259429..259535,259620..259779,
FT                   259885..260038,260254..260380,262602..262728,
FT                   263246..263412,263653..263766,264591..264723,
FT                   265493..265551,267231..267298,269144..269270,
FT                   269886..269992,272339..272405,274360..274425,
FT                   275121..275186,283896..283955,284663..284779))
FT                   /gene="Clcn6"
FT                   /locus_tag="mCG_11729"
FT                   /product="chloride channel 6"
FT                   /note="gene_id=mCG11729.2 transcript_id=mCT11927.2 created
FT                   on 21-NOV-2002"
FT   CDS             complement(join(252534..252614,254434..254559,
FT                   254652..254759,256407..256563,256725..256882,
FT                   258370..258556,259429..259535,259620..259779,
FT                   259885..260038,260254..260380,262602..262728,
FT                   263246..263412,263653..263766,264591..264723,
FT                   265493..265551,267231..267298,269144..269270,
FT                   269886..269992,272339..272405,274360..274425,
FT                   275121..275186,283896..283955,284663..284749))
FT                   /codon_start=1
FT                   /gene="Clcn6"
FT                   /locus_tag="mCG_11729"
FT                   /product="chloride channel 6"
FT                   /note="gene_id=mCG11729.2 transcript_id=mCT11927.2
FT                   protein_id=mCP19377.0"
FT                   /db_xref="GOA:Q3UM91"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002248"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:1347049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UM91"
FT                   /protein_id="EDL14793.1"
FT                   /translation="MAGCRGSVCCCCRWCCCCGERESRTPEELTILGETQEEEDEILPR
FT                   KDYESLDYDRCINDPYLEVLETMDNKKGRRYEAVKWMVVFAIGVCTGLVGLFVDFSVRL
FT                   FTQLKFGVVQTSVEECSQKGCLALSLLELLGFNLTFVFLASLLVLIEPVAAGSGIPEIK
FT                   CYLNGVKVPGIVRLRTLLCKVFGVLFSVSGGLFVGKEGPMIHSGAVVGAGLPQFQSISL
FT                   RKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFSLEEGSSFWNQGLTWKVL
FT                   FCSMSATFTLNFFRSGIQFGSWGSFQLPGLLNFGEFKCSDSDKKCHLWTAMDLGFFVVM
FT                   GVIGGLLGATFNCLNKRLAKYRMRNVHPKPKLVRVLESLLVSLVTTVVVFVASMVLGEC
FT                   RQMSSTSQTGNGSFQLQVTSEDVNSTIKAFFCPNDTYNDMATLFFNSQESAILQLFHQD
FT                   GTFSPVTLALFFILYFLLACWTFGTSVPSGLFVPSLLCGAAFGRLVANVLKSYIGLGHL
FT                   YSGTFALIGAAAFLGGVVRMTISLTVILIESTNEITYGLPIMVTLMVAKWTGDLFNKGI
FT                   YDVHIGLRGVPLLEWETDVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFP
FT                   VVTENRGNEKEFMKGNQLISNNIKFKKSSILTRAGEQRKRGQSMKSYPSSELRNVCDEH
FT                   VASEEPAEKEDLLQQMLERRYTPYPNLYPDQSPSEDWTMEERFRPLTFHGLVLRSQLVT
FT                   LLVRGVCYSESQSSASQPRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSP
FT                   FTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITRHNLTNEFLQARLRQHYQTL"
FT   gap             278435..279436
FT                   /estimated_length=1002
FT   gene            284299..302096
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /note="gene_id=mCG11725.2"
FT   mRNA            join(284299..284506,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT176125"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176125.0 created
FT                   on 21-NOV-2002"
FT   CDS             join(284418..284506,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176125.0
FT                   protein_id=mCP99047.0 isoform=CRA_c"
FT                   /protein_id="EDL14798.1"
FT                   /translation="MDGINSSWPRPSLGVQREVIEQNSGWGTRSRNPAMVNEARGSGSP
FT                   NPRSEGSSSGSESSKDSSRCSTPSLDPERHERLREKMRRRMDSGDKWFSLEFFPPRTAE
FT                   GAVNLISRFDRMAAGGPLFVDVTWHPAGDPGSDKETSSMMIASTAVNYCGLETILHMTC
FT                   CQQRPEEITGHLHRAKQLGLKNIMALRGDPVGDHWEAEEGGFSYATDLVKHIRTEFADY
FT                   FDICVAGYPRGHPDAESFEDDLKHLKEKVSAGADFIITQLFFEASTFFSFVKACTEIGI
FT                   SCPILPGIFPIQGYTSLRQLVKLSKLEVPQKIKDVIEPIKDNDAAIRNYGIELAVSLCR
FT                   ELLDSGLVPGLHFYTLNREVATMEVLKQLGMWTEDPRRPLPWALSAHPKRREEDVRPIF
FT                   WASRPKSYIYRTQDWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPREELLKMWGEEL
FT                   TSEESVFEVFEHYLSGEPNRHGYRVTCLPWNDEPLAAETSLMKEELLRVNRLGILTINS
FT                   QPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKTYELRVNYHIVDV
FT                   KGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFALWIEQWGKLYEEE
FT                   SPSRMIIQYIHDNYFLVNLVDNEFPLDSCLWQVVEDTFELLNRHPTERETQAP"
FT   mRNA            join(285059..285114,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT176124"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176124.0 created
FT                   on 21-NOV-2002"
FT   mRNA            join(285108..285391,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT176123"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176123.0 created
FT                   on 21-NOV-2002"
FT   mRNA            join(286792..287811,289407..289645,290427..290537,
FT                   294020..294213,297319..297569,297812..297946,
FT                   298046..298226,298461..298643,299502..299603,
FT                   300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT11921"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT11921.2 created
FT                   on 21-NOV-2002"
FT   mRNA            join(287173..287303,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT176122"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176122.0 created
FT                   on 21-NOV-2002"
FT   CDS             join(287194..287303,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176122.0
FT                   protein_id=mCP99046.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2A7F7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="MGI:MGI:106639"
FT                   /db_xref="UniProtKB/TrEMBL:A2A7F7"
FT                   /protein_id="EDL14795.1"
FT                   /translation="MNHQKAKVLPAGHCYPSLGMWASEAGCVRLSVPPSISRNPAMVNE
FT                   ARGSGSPNPRSEGSSSGSESSKDSSRCSTPSLDPERHERLREKMRRRMDSGDKWFSLEF
FT                   FPPRTAEGAVNLISRFDRMAAGGPLFVDVTWHPAGDPGSDKETSSMMIASTAVNYCGLE
FT                   TILHMTCCQQRPEEITGHLHRAKQLGLKNIMALRGDPVGDHWEAEEGGFSYATDLVKHI
FT                   RTEFADYFDICVAGYPRGHPDAESFEDDLKHLKEKVSAGADFIITQLFFEASTFFSFVK
FT                   ACTEIGISCPILPGIFPIQGYTSLRQLVKLSKLEVPQKIKDVIEPIKDNDAAIRNYGIE
FT                   LAVSLCRELLDSGLVPGLHFYTLNREVATMEVLKQLGMWTEDPRRPLPWALSAHPKRRE
FT                   EDVRPIFWASRPKSYIYRTQDWDEFPNGRWGNSSSPAFGELKDYYLFYLKSKSPREELL
FT                   KMWGEELTSEESVFEVFEHYLSGEPNRHGYRVTCLPWNDEPLAAETSLMKEELLRVNRL
FT                   GILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKTYELRV
FT                   NYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFALWIEQW
FT                   GKLYEEESPSRMIIQYIHDNYFLVNLVDNEFPLDSCLWQVVEDTFELLNRHPTERETQA
FT                   P"
FT   CDS             join(287579..287811,289407..289645,290427..290537,
FT                   294020..294213,297319..297569,297812..297946,
FT                   298046..298226,298461..298643,299502..299603,
FT                   300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT11921.2
FT                   protein_id=mCP19354.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WU20"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="MGI:MGI:106639"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WU20"
FT                   /protein_id="EDL14794.1"
FT                   /translation="MVNEARGSGSPNPRSEGSSSGSESSKDSSRCSTPSLDPERHERLR
FT                   EKMRRRMDSGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLFVDVTWHPAGDPGSDK
FT                   ETSSMMIASTAVNYCGLETILHMTCCQQRPEEITGHLHRAKQLGLKNIMALRGDPVGDH
FT                   WEAEEGGFSYATDLVKHIRTEFADYFDICVAGYPRGHPDAESFEDDLKHLKEKVSAGAD
FT                   FIITQLFFEASTFFSFVKACTEIGISCPILPGIFPIQGYTSLRQLVKLSKLEVPQKIKD
FT                   VIEPIKDNDAAIRNYGIELAVSLCRELLDSGLVPGLHFYTLNREVATMEVLKQLGMWTE
FT                   DPRRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQDWDEFPNGRWGNSSSPAFGEL
FT                   KDYYLFYLKSKSPREELLKMWGEELTSEESVFEVFEHYLSGEPNRHGYRVTCLPWNDEP
FT                   LAAETSLMKEELLRVNRLGILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTS
FT                   RETVEALLQVLKTYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDP
FT                   ISFMFWKDEAFALWIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEFPLDSCLWQVV
FT                   EDTFELLNRHPTERETQAP"
FT   CDS             join(287579..287811,289407..289645,290427..290537,
FT                   294020..294213,297319..297569,297812..297946,
FT                   298046..298226,298461..298643,299502..299603,
FT                   300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176123.0
FT                   protein_id=mCP99045.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WU20"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="MGI:MGI:106639"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WU20"
FT                   /protein_id="EDL14796.1"
FT                   /translation="MVNEARGSGSPNPRSEGSSSGSESSKDSSRCSTPSLDPERHERLR
FT                   EKMRRRMDSGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLFVDVTWHPAGDPGSDK
FT                   ETSSMMIASTAVNYCGLETILHMTCCQQRPEEITGHLHRAKQLGLKNIMALRGDPVGDH
FT                   WEAEEGGFSYATDLVKHIRTEFADYFDICVAGYPRGHPDAESFEDDLKHLKEKVSAGAD
FT                   FIITQLFFEASTFFSFVKACTEIGISCPILPGIFPIQGYTSLRQLVKLSKLEVPQKIKD
FT                   VIEPIKDNDAAIRNYGIELAVSLCRELLDSGLVPGLHFYTLNREVATMEVLKQLGMWTE
FT                   DPRRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQDWDEFPNGRWGNSSSPAFGEL
FT                   KDYYLFYLKSKSPREELLKMWGEELTSEESVFEVFEHYLSGEPNRHGYRVTCLPWNDEP
FT                   LAAETSLMKEELLRVNRLGILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTS
FT                   RETVEALLQVLKTYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDP
FT                   ISFMFWKDEAFALWIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEFPLDSCLWQVV
FT                   EDTFELLNRHPTERETQAP"
FT   CDS             join(287579..287811,289407..289645,290427..290537,
FT                   294020..294213,297319..297569,297812..297946,
FT                   298046..298226,298461..298643,299502..299603,
FT                   300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176124.0
FT                   protein_id=mCP99044.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WU20"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="MGI:MGI:106639"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WU20"
FT                   /protein_id="EDL14797.1"
FT                   /translation="MVNEARGSGSPNPRSEGSSSGSESSKDSSRCSTPSLDPERHERLR
FT                   EKMRRRMDSGDKWFSLEFFPPRTAEGAVNLISRFDRMAAGGPLFVDVTWHPAGDPGSDK
FT                   ETSSMMIASTAVNYCGLETILHMTCCQQRPEEITGHLHRAKQLGLKNIMALRGDPVGDH
FT                   WEAEEGGFSYATDLVKHIRTEFADYFDICVAGYPRGHPDAESFEDDLKHLKEKVSAGAD
FT                   FIITQLFFEASTFFSFVKACTEIGISCPILPGIFPIQGYTSLRQLVKLSKLEVPQKIKD
FT                   VIEPIKDNDAAIRNYGIELAVSLCRELLDSGLVPGLHFYTLNREVATMEVLKQLGMWTE
FT                   DPRRPLPWALSAHPKRREEDVRPIFWASRPKSYIYRTQDWDEFPNGRWGNSSSPAFGEL
FT                   KDYYLFYLKSKSPREELLKMWGEELTSEESVFEVFEHYLSGEPNRHGYRVTCLPWNDEP
FT                   LAAETSLMKEELLRVNRLGILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTS
FT                   RETVEALLQVLKTYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDP
FT                   ISFMFWKDEAFALWIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEFPLDSCLWQVV
FT                   EDTFELLNRHPTERETQAP"
FT   gene            complement(302261..303998)
FT                   /locus_tag="mCG_16670"
FT                   /note="gene_id=mCG16670.1"
FT   mRNA            complement(join(302261..302325,302904..303998))
FT                   /locus_tag="mCG_16670"
FT                   /product="mCG16670"
FT                   /note="gene_id=mCG16670.1 transcript_id=mCT12589.1 created
FT                   on 13-MAR-2003"
FT   CDS             complement(303168..303329)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16670"
FT                   /product="mCG16670"
FT                   /note="gene_id=mCG16670.1 transcript_id=mCT12589.1
FT                   protein_id=mCP19379.2"
FT                   /protein_id="EDL14799.1"
FT                   /translation="MAPGTGVEDMAEKGPSAPGGSTATPERREPGPFPGDFTLVHPASP
FT                   PRPVPPPG"
FT   gap             311437..311721
FT                   /estimated_length=285
FT   gene            complement(313778..314492)
FT                   /pseudo
FT                   /locus_tag="mCG_1027345"
FT                   /note="gene_id=mCG1027345.2"
FT   mRNA            complement(313778..314492)
FT                   /pseudo
FT                   /locus_tag="mCG_1027345"
FT                   /note="gene_id=mCG1027345.2 transcript_id=mCT145049.2
FT                   created on 02-JUL-2003"
FT   gap             315849..316225
FT                   /estimated_length=377
FT   gene            complement(325895..333976)
FT                   /gene="Agtrap"
FT                   /locus_tag="mCG_133678"
FT                   /note="gene_id=mCG133678.1"
FT   mRNA            complement(join(325895..326646,327605..327800,
FT                   328313..328418,329920..329954,333879..333976))
FT                   /gene="Agtrap"
FT                   /locus_tag="mCG_133678"
FT                   /product="angiotensin II, type I receptor-associated
FT                   protein"
FT                   /note="gene_id=mCG133678.1 transcript_id=mCT135048.1
FT                   created on 21-NOV-2002"
FT   CDS             complement(join(326525..326646,327605..327800,
FT                   328313..328418,329920..329954,333879..333905))
FT                   /codon_start=1
FT                   /gene="Agtrap"
FT                   /locus_tag="mCG_133678"
FT                   /product="angiotensin II, type I receptor-associated
FT                   protein"
FT                   /note="gene_id=mCG133678.1 transcript_id=mCT135048.1
FT                   protein_id=mCP76881.0"
FT                   /db_xref="GOA:Q9WVK0"
FT                   /db_xref="InterPro:IPR009436"
FT                   /db_xref="MGI:MGI:1339977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVK0"
FT                   /protein_id="EDL14800.1"
FT                   /translation="MELPAVNLKVILLVHWLLTTWGCLVFSSSYAWGNFTILALGVWAV
FT                   AQRDSIDAIGMFLGGLVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCC
FT                   LVYHMHRERGGELPLRPDFFGPSQEHSAYQTIDSSSDAAADPFASLENKGQAVPRGY"
FT   gap             328438..328534
FT                   /estimated_length=97
FT   gap             336433..337117
FT                   /estimated_length=685
FT   gap             340568..343338
FT                   /estimated_length=2771
FT   gene            complement(343340..371659)
FT                   /gene="2610109H07Rik"
FT                   /locus_tag="mCG_133693"
FT                   /note="gene_id=mCG133693.1"
FT   mRNA            complement(join(343340..343593,348939..349028,
FT                   350608..350697,351031..351142,353697..353890,
FT                   356541..356982,371539..371659))
FT                   /gene="2610109H07Rik"
FT                   /locus_tag="mCG_133693"
FT                   /product="RIKEN cDNA 2610109H07"
FT                   /note="gene_id=mCG133693.1 transcript_id=mCT135063.1
FT                   created on 26-DEC-2002"
FT   CDS             complement(join(343481..343593,348939..349028,
FT                   350608..350697,351031..351142,353697..353890,
FT                   356541..356973))
FT                   /codon_start=1
FT                   /gene="2610109H07Rik"
FT                   /locus_tag="mCG_133693"
FT                   /product="RIKEN cDNA 2610109H07"
FT                   /note="gene_id=mCG133693.1 transcript_id=mCT135063.1
FT                   protein_id=mCP76844.1"
FT                   /protein_id="EDL14801.1"
FT                   /translation="MAGCPVLRVPTLFLILLLFPELHTAGTLASGSSARNLPETHSHLP
FT                   SSALWVSQASHHGRRGLGKKDRGPGRPSRAQEGAVVSATKQASQMTLGQPPAGLLQNKE
FT                   LLLGLTLPYPEKEARSPGWERVKKRGREHKRRRDRLRLHRGRAAIRGPSSLMKKVEPSE
FT                   DRMLEGTMEESSTSLAPTMFFLTMTDGATPTTEESRILPVTSLRPQTQPRSDGEVMPTL
FT                   DMALFDWTDYEDLKPEVWPSAKKKEKHWSHFTSDGNETSPAEGDPCDHHQDCLPGTCCD
FT                   LREHLCTPHNRGLNNKCFDDCMCMEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSF
FT                   INI"
FT   gap             371681..371862
FT                   /estimated_length=182
FT   gene            380552..386417
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /note="gene_id=mCG16659.2"
FT   mRNA            join(380552..380738,381503..381552,381633..381751,
FT                   383702..383773,384258..384358,384980..385081,
FT                   385370..385443,385842..385912,386088..386405)
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /product="MAD2 mitotic arrest deficient-like 2 (yeast),
FT                   transcript variant mCT176349"
FT                   /note="gene_id=mCG16659.2 transcript_id=mCT176349.0 created
FT                   on 26-NOV-2002"
FT   mRNA            join(381205..381552,381633..381751,383702..383773,
FT                   384258..384358,384980..385074,385370..385443,
FT                   385820..385912,386088..386417)
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /product="MAD2 mitotic arrest deficient-like 2 (yeast),
FT                   transcript variant mCT12924"
FT                   /note="gene_id=mCG16659.2 transcript_id=mCT12924.1 created
FT                   on 26-NOV-2002"
FT   CDS             join(381513..381552,381633..381751,383702..383773,
FT                   384258..384358,384980..385081,385370..385443,
FT                   385842..385912,386088..386129)
FT                   /codon_start=1
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /product="MAD2 mitotic arrest deficient-like 2 (yeast),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16659.2 transcript_id=mCT176349.0
FT                   protein_id=mCP99271.0 isoform=CRA_b"
FT                   /protein_id="EDL14803.1"
FT                   /translation="MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKR
FT                   KKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQ
FT                   PPLLSINSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGEMLHIYSPRAHKRSCYSKHG
FT                   EDTGHQDEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKNS"
FT   CDS             join(381513..381552,381633..381751,383702..383773,
FT                   384258..384358,384980..385074,385370..385443,
FT                   385820..385912,386088..386129)
FT                   /codon_start=1
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /product="MAD2 mitotic arrest deficient-like 2 (yeast),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16659.2 transcript_id=mCT12924.1
FT                   protein_id=mCP19374.2 isoform=CRA_a"
FT                   /protein_id="EDL14802.1"
FT                   /translation="MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKR
FT                   KKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQ
FT                   PPLLSINSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKI
FT                   QVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKNS"
FT   gene            complement(386492..392845)
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /note="gene_id=mCG16668.2"
FT   mRNA            complement(join(386492..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390381,
FT                   392742..392845))
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, transcript variant
FT                   mCT176352"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT176352.0 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(386503..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390381,
FT                   391805..391887,392742..392823))
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, transcript variant
FT                   mCT176353"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT176353.0 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(386504..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390381,
FT                   392671..>392720))
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, transcript variant
FT                   mCT190866"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT190866.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(386504..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390381,
FT                   392343..392553))
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, transcript variant
FT                   mCT12587"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT12587.1 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(386632..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..>390367))
FT                   /codon_start=1
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, isoform CRA_b"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT190866.0
FT                   protein_id=mCP111820.0 isoform=CRA_b"
FT                   /protein_id="EDL14806.1"
FT                   /translation="FSVATMVHINELPENILLELFIHIPAPQLLRNCRLVCRLWRDLID
FT                   VVSLWKRKSLREGFFTKDRCEPVEDWKVFYILCSLQKNLLRNPCAEENLSSWRIDSNGG
FT                   DRWKVETLPGSCGTSFPDNKVKKYFVTSFEMCLKSQMVDLKAEGYCEELMDTFRPDIVV
FT                   KDWVAPRADCGCTYQLRVQLASADYIVLASFEPPPVTFQQWNDAKWQEISHTFSDYPPG
FT                   VRHILFQHGGQDTQFWKGWYGPRVTNSSIIISHRTAKNPPPARTLPEETVVIGRRRRAS
FT                   DSNTHEGFFWQGLWQRLRR"
FT   CDS             complement(join(386632..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390352))
FT                   /codon_start=1
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, isoform CRA_a"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT12587.1
FT                   protein_id=mCP19390.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9QZN4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354743"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN4"
FT                   /protein_id="EDL14804.1"
FT                   /translation="MVHINELPENILLELFIHIPAPQLLRNCRLVCRLWRDLIDVVSLW
FT                   KRKSLREGFFTKDRCEPVEDWKVFYILCSLQKNLLRNPCAEENLSSWRIDSNGGDRWKV
FT                   ETLPGSCGTSFPDNKVKKYFVTSFEMCLKSQMVDLKAEGYCEELMDTFRPDIVVKDWVA
FT                   PRADCGCTYQLRVQLASADYIVLASFEPPPVTFQQWNDAKWQEISHTFSDYPPGVRHIL
FT                   FQHGGQDTQFWKGWYGPRVTNSSIIISHRTAKNPPPARTLPEETVVIGRRRRASDSNTH
FT                   EGFFWQGLWQRLRR"
FT   CDS             complement(join(386632..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390352))
FT                   /codon_start=1
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, isoform CRA_a"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT176352.0
FT                   protein_id=mCP99275.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9QZN4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354743"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN4"
FT                   /protein_id="EDL14805.1"
FT                   /translation="MVHINELPENILLELFIHIPAPQLLRNCRLVCRLWRDLIDVVSLW
FT                   KRKSLREGFFTKDRCEPVEDWKVFYILCSLQKNLLRNPCAEENLSSWRIDSNGGDRWKV
FT                   ETLPGSCGTSFPDNKVKKYFVTSFEMCLKSQMVDLKAEGYCEELMDTFRPDIVVKDWVA
FT                   PRADCGCTYQLRVQLASADYIVLASFEPPPVTFQQWNDAKWQEISHTFSDYPPGVRHIL
FT                   FQHGGQDTQFWKGWYGPRVTNSSIIISHRTAKNPPPARTLPEETVVIGRRRRASDSNTH
FT                   EGFFWQGLWQRLRR"
FT   CDS             complement(join(386632..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390352))
FT                   /codon_start=1
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, isoform CRA_a"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT176353.0
FT                   protein_id=mCP99274.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9QZN4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354743"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN4"
FT                   /protein_id="EDL14807.1"
FT                   /translation="MVHINELPENILLELFIHIPAPQLLRNCRLVCRLWRDLIDVVSLW
FT                   KRKSLREGFFTKDRCEPVEDWKVFYILCSLQKNLLRNPCAEENLSSWRIDSNGGDRWKV
FT                   ETLPGSCGTSFPDNKVKKYFVTSFEMCLKSQMVDLKAEGYCEELMDTFRPDIVVKDWVA
FT                   PRADCGCTYQLRVQLASADYIVLASFEPPPVTFQQWNDAKWQEISHTFSDYPPGVRHIL
FT                   FQHGGQDTQFWKGWYGPRVTNSSIIISHRTAKNPPPARTLPEETVVIGRRRRASDSNTH
FT                   EGFFWQGLWQRLRR"
FT   gene            complement(393529..399756)
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /note="gene_id=mCG48975.2"
FT   mRNA            complement(join(393529..394373,396876..397011,
FT                   397125..397220,397310..397436,399467..399755))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT49158"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT49158.1 created
FT                   on 21-FEB-2003"
FT   mRNA            complement(join(393705..394373,396876..397011,
FT                   397125..397220,397387..397436,399467..399754))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT177688"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT177688.0 created
FT                   on 21-FEB-2003"
FT   mRNA            complement(join(394123..394373,396876..397011,
FT                   397339..397436,399467..399754))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT177689"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT177689.0 created
FT                   on 21-FEB-2003"
FT   CDS             complement(join(394198..394373,396876..397011,
FT                   397339..397436,399467..399731))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_e"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT177689.0
FT                   protein_id=mCP100610.0 isoform=CRA_e"
FT                   /db_xref="GOA:A2A7H6"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354744"
FT                   /db_xref="UniProtKB/TrEMBL:A2A7H6"
FT                   /protein_id="EDL14812.1"
FT                   /translation="MAVGNINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVT
FT                   LWKRKCLQEGFITEDWDQPVADWKIFYFLRSLQRNLLHNPCAEEGFEFWSLDVNGGDEW
FT                   KVEDLSKDQRKEFPNDQVCSQARLRVQVPAVRPTPVVSPRTTGNLPAGPGDDSAEKRCQ
FT                   VEGGFTHILQLSSRRPLHLVSARRRGHSLLGRLVRPESHKQQHHHRAPAALMPPEPQSS
FT                   EP"
FT   CDS             complement(join(394230..394373,396876..397011,
FT                   397125..397220,397310..397436,399467..399731))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_d"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT49158.1
FT                   protein_id=mCP39813.2 isoform=CRA_d"
FT                   /db_xref="GOA:A2A7H5"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354744"
FT                   /db_xref="UniProtKB/TrEMBL:A2A7H5"
FT                   /protein_id="EDL14811.1"
FT                   /translation="MAVGNINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVT
FT                   LWKRKCLQEGFITEDWDQPVADWKIFYFLRSLQRNLLHNPCAEEGFEFWSLDVNGGDEW
FT                   KVEDLSKDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDW
FT                   FAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPVMIQQKSDAKWREVSHTFSNYPPGVRY
FT                   IWFQHGGVDTHYWAGWYGPRVTNSSITIGPPLP"
FT   CDS             complement(join(394230..394373,396876..397011,
FT                   397125..397220,397387..397406))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_a"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT177688.0
FT                   protein_id=mCP100611.0 isoform=CRA_a"
FT                   /protein_id="EDL14808.1"
FT                   /translation="MEAMNGSTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDWFAARPD
FT                   CGSKYQLCVQLLSSAHAPLGTFQPDPVMIQQKSDAKWREVSHTFSNYPPGVRYIWFQHG
FT                   GVDTHYWAGWYGPRVTNSSITIGPPLP"
FT   mRNA            complement(join(394995..395162,396876..397011,
FT                   397125..397220,397310..397436,399467..399756))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT180685"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT180685.0 created
FT                   on 21-FEB-2003"
FT   CDS             complement(join(395151..395162,396876..397011,
FT                   397125..397220,397310..397436,399467..399731))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_c"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT180685.0
FT                   protein_id=mCP103607.0 isoform=CRA_c"
FT                   /protein_id="EDL14810.1"
FT                   /translation="MAVGNINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVT
FT                   LWKRKCLQEGFITEDWDQPVADWKIFYFLRSLQRNLLHNPCAEEGFEFWSLDVNGGDEW
FT                   KVEDLSKDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDW
FT                   FAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPVMIQQKSDAKWREGLM"
FT   mRNA            complement(join(396227..397011,397125..397220,
FT                   397310..397436,399467..399756))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT180684"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT180684.0 created
FT                   on 21-FEB-2003"
FT   CDS             complement(join(396669..397011,397125..397220,
FT                   397310..397436,399467..399731))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_b"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT180684.0
FT                   protein_id=mCP103606.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UYF5"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354744"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYF5"
FT                   /protein_id="EDL14809.1"
FT                   /translation="MAVGNINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVT
FT                   LWKRKCLQEGFITEDWDQPVADWKIFYFLRSLQRNLLHNPCAEEGFEFWSLDVNGGDEW
FT                   KVEDLSKDQRKEFPNDQVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIEVKDW
FT                   FAARPDCGSKYQLCVQLLSSAHAPLGTFQPDPVMIQQKSDAKWREVCGQGPHGNLGLTC
FT                   FSRRIGVSFQLRQQSRETERAPTQKQFPERMPPWCTDCLASIHRALCSIPSAKK"
FT   gap             398563..398822
FT                   /estimated_length=260
FT   gap             400283..401356
FT                   /estimated_length=1074
FT   gene            401357..407270
FT                   /gene="Fbxo2"
FT                   /locus_tag="mCG_16665"
FT                   /note="gene_id=mCG16665.2"
FT   mRNA            join(401357..401553,404915..405295,405666..405795,
FT                   405868..405963,406499..406628,406820..407270)
FT                   /gene="Fbxo2"
FT                   /locus_tag="mCG_16665"
FT                   /product="F-box only protein 2"
FT                   /note="gene_id=mCG16665.2 transcript_id=mCT12293.2 created
FT                   on 05-FEB-2003"
FT   CDS             join(401532..401553,404915..405295,405666..405795,
FT                   405868..405963,406499..406628,406820..406954)
FT                   /codon_start=1
FT                   /gene="Fbxo2"
FT                   /locus_tag="mCG_16665"
FT                   /product="F-box only protein 2"
FT                   /note="gene_id=mCG16665.2 transcript_id=mCT12293.2
FT                   protein_id=mCP19355.2"
FT                   /protein_id="EDL14813.1"
FT                   /translation="MDGDGDPESVSHPEEASPEEQPEEAGAEASAEEEQLREAEEEEEA
FT                   EAVEYLAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPE
FT                   GSADEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEF
FT                   TQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYE
FT                   LTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWK
FT                   GWFGARVTNSSVWVEP"
FT   gap             407984..408003
FT                   /estimated_length=20
FT   gap             411414..411464
FT                   /estimated_length=51
FT   gap             441203..442911
FT                   /estimated_length=1709
FT   gap             450051..450070
FT                   /estimated_length=20
FT   gap             458615..459166
FT                   /estimated_length=552
FT   gene            complement(482425..529667)
FT                   /locus_tag="mCG_16661"
FT                   /note="gene_id=mCG16661.2"
FT   mRNA            complement(join(482425..483515,484621..484787,
FT                   485207..485320,485982..486141,491019..491164,
FT                   491620..491746,492498..492670,492764..492894,
FT                   494555..494739,496112..496248,496998..497111,
FT                   498667..498828,499758..499919,500098..500246,
FT                   500708..500850,502452..502588,503038..503174,
FT                   511992..512211,513064..514027,529434..529667))
FT                   /locus_tag="mCG_16661"
FT                   /product="mCG16661"
FT                   /note="gene_id=mCG16661.2 transcript_id=mCT12290.2 created
FT                   on 04-APR-2003"
FT   CDS             complement(join(483153..483515,484621..484787,
FT                   485207..485320,485982..486141,491019..491164,
FT                   491620..491746,492498..492670,492764..492894,
FT                   494555..494739,496112..496248,496998..497111,
FT                   498667..498828,499758..499919,500098..500246,
FT                   500708..500850,502452..502588,503038..503174,
FT                   511992..512211,513064..514024))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16661"
FT                   /product="mCG16661"
FT                   /note="gene_id=mCG16661.2 transcript_id=mCT12290.2
FT                   protein_id=mCP19382.2"
FT                   /protein_id="EDL14814.1"
FT                   /translation="MDSEDDPLLQDVWLEEEQPEDEACRGVPGPGLQSGAQGCWRRWTL
FT                   PSRPPTLGFWSTLGWAFTNPCCAGLVLFLGCSIPMVLSAFMFLYYPPLDIDISYNAFEI
FT                   RNHEASQRFDALALALKSQFGSWGRNRRDLADFTSETLQRLISEQLQQLHLGNHSRPAS
FT                   RAPRSAPRDTVATQTSAANSSERRRREAPPPEGQVTNQSRARRGASRWDYSRTYVSANT
FT                   QTHAHWRIELIFLARGDAERNIFTSERLVTIHEIERKIMDHPGFREFCWKPHEVLKDLP
FT                   LGSYSYCSPPSSLMTYFFPTERGGKIYYDGMGQDLADIRGSLELAMTHPEFYWYVDEGL
FT                   SVDNLKSSLLRSEILFGAPLPNYYSVDDRWEEQRAKFQSFVVTYVAMLAKQSTSKVQVL
FT                   YGGTDLFDYEVRRTFNNDMLLAFISSSCIAALVYILTSCSVFLSFFGIASIGLSCLVAL
FT                   FLYHVVFGIQYLGILNGVAAFVIVGIGQIPAVHDFGLFMSLIVTCCWLAVLFTMPAALG
FT                   LWSLYMAPLESSCQNSCHQKCGRKSSLHFPGDLFTAPERAGGGPAQGPLPYLDDDIPLL
FT                   NVEDEPASLELGDVSLVSVHCEGLQPTPDANSRGQLLAQLQELLHHWVLWAAVKSRWVI
FT                   VGLFASILILSLVFASRLRPASRAPLLFRPDTNIQVLLDLKYNLSAEGISCITCSGLFQ
FT                   EKPHSLQNNVRTSLEKKKRGSGVSWASRPETTAQESMSTVYISKVKSKGHPAVYRLSLN
FT                   ASLPAPWQAVSPGDGEVPSFQVYRAPFGDFTKKLTACMSTVGLLQAASPSRKWMVTALA
FT                   CDARRGWKFDFSFYVATKEQQHTRKLYFAQSHKPPFHGRLCVAPPGCLLSSSPDGPTKG
FT                   FFYVPSDKVPKARISATFGFNPCVNTGCGKPAVRPLVDTGAMVFVVFGIIGLNRTQQMD
FT                   NHVIGDPGSVIYDSSFDLFKEIGHLCRLCKAIAGNLELVKPGGAQCLPSGYSISSFLQM
FT                   LHPECKELPEPNLLPGQLSHGAVGVKEGRVQWISMAFESTTYKGKSSFQTYSDYLRWES
FT                   FLRQQLQTFPEGSALHRGFQTCEHWKQIFMEIIGVQSALYGLVLSLLICVAAVAVFTTH
FT                   VLLLLPVLLSILGIVCLVVTIMYWSGWEMGAVEAISLSILVGSSVDYCVHLVEGYLLAG
FT                   ENLPPQQAEDPSSQRQWRTLEAVRHVGVAIVSSALTTVIATVPLFFCIIAPFAKFGKIV
FT                   ALNTGVSILYTLTVSTALLGIMAPGSFTRTRTSFLKALGAVLLAGALGLGACLVLLRSG
FT                   YKIPLPSGATL"
FT   gap             498938..499077
FT                   /estimated_length=140
FT   gap             501395..502061
FT                   /estimated_length=667
FT   gap             519345..519473
FT                   /estimated_length=129
FT   gap             544316..544335
FT                   /estimated_length=20
FT   gene            548274..557895
FT                   /locus_tag="mCG_1050988"
FT                   /note="gene_id=mCG1050988.0"
FT   mRNA            join(548274..548493,550246..550371,553565..553627,
FT                   557281..557895)
FT                   /locus_tag="mCG_1050988"
FT                   /product="mCG1050988"
FT                   /note="gene_id=mCG1050988.0 transcript_id=mCT194777.0
FT                   created on 27-JAN-2005"
FT   CDS             557411..557671
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050988"
FT                   /product="mCG1050988"
FT                   /note="gene_id=mCG1050988.0 transcript_id=mCT194777.0
FT                   protein_id=mCP115806.0"
FT                   /protein_id="EDL14815.1"
FT                   /translation="MAGKPIAAARRTARTMASSLHTWNSKSQRGKTRDFSGSLPAHTAN
FT                   TRAMNINLVPNYQSLVSLNFLLPQPRAGYAIWPMKVDKGSS"
FT   gap             566463..566482
FT                   /estimated_length=20
FT   gap             568651..569700
FT                   /estimated_length=1050
FT   gap             570783..570802
FT                   /estimated_length=20
FT   gap             578185..578212
FT                   /estimated_length=28
FT   gap             580990..581232
FT                   /estimated_length=243
FT   gap             588983..589098
FT                   /estimated_length=116
FT   gene            complement(595276..598349)
FT                   /locus_tag="mCG_1027379"
FT                   /note="gene_id=mCG1027379.1"
FT   mRNA            complement(join(595276..595454,598299..598349))
FT                   /locus_tag="mCG_1027379"
FT                   /product="mCG1027379"
FT                   /note="gene_id=mCG1027379.1 transcript_id=mCT145083.1
FT                   created on 07-MAR-2003"
FT   CDS             complement(join(595337..595454,598299..598324))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027379"
FT                   /product="mCG1027379"
FT                   /note="gene_id=mCG1027379.1 transcript_id=mCT145083.1
FT                   protein_id=mCP76738.1"
FT                   /protein_id="EDL14816.1"
FT                   /translation="MKPLGSFYWDPRRPPFYCRMDLNTSTAYSYIQMATSSIIFAVTQP
FT                   KH"
FT   gap             597658..597677
FT                   /estimated_length=20
FT   gap             598803..598902
FT                   /estimated_length=100
FT   gap             600772..601112
FT                   /estimated_length=341
FT   gap             602021..602061
FT                   /estimated_length=41
FT   gap             610211..610230
FT                   /estimated_length=20
FT   gap             626405..626657
FT                   /estimated_length=253
FT   gap             631923..631942
FT                   /estimated_length=20
FT   gap             641661..641680
FT                   /estimated_length=20
FT   gap             649052..649734
FT                   /estimated_length=683
FT   gap             668076..668184
FT                   /estimated_length=109
FT   gene            complement(674318..684684)
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /note="gene_id=mCG16655.1"
FT   mRNA            complement(join(674318..676465,683858..684684))
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /product="UbiA prenyltransferase domain containing 1,
FT                   transcript variant mCT12922"
FT                   /note="gene_id=mCG16655.1 transcript_id=mCT12922.1 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(674465..676465,683858..684059,
FT                   684472..684654))
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /product="UbiA prenyltransferase domain containing 1,
FT                   transcript variant mCT176347"
FT                   /note="gene_id=mCG16655.1 transcript_id=mCT176347.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(675978..676465,683858..684380))
FT                   /codon_start=1
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /product="UbiA prenyltransferase domain containing 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16655.1 transcript_id=mCT12922.1
FT                   protein_id=mCP19394.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DC60"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="MGI:MGI:1918957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DC60"
FT                   /protein_id="EDL14817.1"
FT                   /translation="MAAVQAPGEKINILAGETAKVGDPQKNEWPEQDRFPERSWRHKCA
FT                   SYVLALRPWSFSASLTPVALGSALAYRSQGVLDPRLLLGCAVAVLAVHGAGNLVNTYYD
FT                   FSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYTLGCVCAACLYYLSALKLEHLALIYF
FT                   GGLSGSFLYTGGIGFKYVALGDLVILITFGPLAVMFAYAVQVGSLAIFPLIYAIPLALS
FT                   TEAILHSNNTRDMESDREAGIVTLAILIGPTFSYVLYNTLLFVPYLIFTILATHCSISL
FT                   ALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPRL"
FT   CDS             complement(675978..676397)
FT                   /codon_start=1
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /product="UbiA prenyltransferase domain containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16655.1 transcript_id=mCT176347.0
FT                   protein_id=mCP99269.0 isoform=CRA_b"
FT                   /protein_id="EDL14818.1"
FT                   /translation="MFAYAVQVGSLAIFPLIYAIPLALSTEAILHSNNTRDMESDREAG
FT                   IVTLAILIGPTFSYVLYNTLLFVPYLIFTILATHCSISLALPLLTIPMAFSLERQFRSQ
FT                   AFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPRL"
FT   gene            <688742..798685
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /note="gene_id=mCG16666.1"
FT   mRNA            join(688742..688822,692535..692710,693300..693408,
FT                   694030..694262,694874..695074,696307..696441,
FT                   699602..699877,699959..700067,703542..703728,
FT                   704447..704575,705058..705302,705702..705917,
FT                   706652..706857,709011..709133,709750..709839,
FT                   710129..710221,710981..711115,711331..711460,
FT                   712674..712924,721615..721701,724305..724472,
FT                   725060..725172,725376..725538,726792..726884,
FT                   727519..727669,730223..730365,732085..732247,
FT                   732371..732516,752472..752547,755522..755661,
FT                   762050..762150,765121..765236,766353..766430,
FT                   766627..766734,771111..771236,771307..771438,
FT                   774489..774604,775547..775664,777150..777398,
FT                   778001..778101,778503..778599,778916..779014,
FT                   779103..779225,779368..779550,780623..780757,
FT                   780927..781101,785095..785230,786388..786535,
FT                   787279..787401,788485..788567,790219..790291,
FT                   790642..790716,790940..791075,791785..791850,
FT                   793725..793805,794044..794124,797276..797381,
FT                   797854..798685)
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /product="FK506 binding protein 12-rapamycin associated
FT                   protein 1, transcript variant mCT12294"
FT                   /note="gene_id=mCG16666.1 transcript_id=mCT12294.1 created
FT                   on 26-NOV-2002"
FT   mRNA            join(<688742..688822,692535..692710,693300..693408,
FT                   694030..694262,694874..695074,696307..696441,
FT                   699602..699877,699959..700067,703542..703728,
FT                   704447..704575,705058..705302,705702..705917,
FT                   706652..706857,709011..709133,709750..709839,
FT                   710129..710221,710981..711115,711331..711460,
FT                   712674..712924,721615..721701,724305..724472,
FT                   725060..725172,725376..725538,726792..726884,
FT                   727519..727665,730223..730365,732085..732247,
FT                   732371..732516,752472..752547,755522..755661,
FT                   762050..762150,765121..765236,766353..766430,
FT                   766627..766734,771111..771236,771307..771438,
FT                   774489..774604,775547..775664,777150..777398,
FT                   778001..778101,778503..778599,778916..779014,
FT                   779103..779225,779368..779550,780623..780757,
FT                   780927..781101,785095..785230,786388..786535,
FT                   787279..787401,788485..788567,790219..790291,
FT                   790642..790716,790940..791075,791785..791850,
FT                   793725..793805,794044..794124,797276..797381,
FT                   797854..798685)
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /product="FK506 binding protein 12-rapamycin associated
FT                   protein 1, transcript variant mCT190862"
FT                   /note="gene_id=mCG16666.1 transcript_id=mCT190862.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<688744..688822,692535..692710,693300..693408,
FT                   694030..694262,694874..695074,696307..696441,
FT                   699602..699877,699959..700067,703542..703728,
FT                   704447..704575,705058..705302,705702..705917,
FT                   706652..706857,709011..709133,709750..709839,
FT                   710129..710221,710981..711115,711331..711460,
FT                   712674..712924,721615..721701,724305..724472,
FT                   725060..725172,725376..725538,726792..726884,
FT                   727519..727665,730223..730365,732085..732247,
FT                   732371..732516,752472..752547,755522..755661,
FT                   762050..762150,765121..765236,766353..766430,
FT                   766627..766734,771111..771236,771307..771438,
FT                   774489..774604,775547..775664,777150..777398,
FT                   778001..778101,778503..778599,778916..779014,
FT                   779103..779225,779368..779550,780623..780757,
FT                   780927..781101,785095..785230,786388..786535,
FT                   787279..787401,788485..788567,790219..790291,
FT                   790642..790716,790940..791075,791785..791850,
FT                   793725..793805,794044..794124,797276..797381,
FT                   797854..797869)
FT                   /codon_start=1
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /product="FK506 binding protein 12-rapamycin associated
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16666.1 transcript_id=mCT190862.0
FT                   protein_id=mCP111819.0 isoform=CRA_a"
FT                   /protein_id="EDL14819.1"
FT                   /translation="AGGEAGGLKRRYRLRRRQLRRWPKPREPQGKMLGTGPAVATASAA
FT                   TSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHHIFE
FT                   LVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDPVVMEMASKAIGR
FT                   LAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFF
FT                   DNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLA
FT                   KEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFGTK
FT                   PRHITPFTSFQAVQPQQPNALVGLLGYSSPQGLMGFGTSPSPAKSTLVESRCCRDLMEE
FT                   KFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKE
FT                   KERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTVQVDATVFTCI
FT                   SMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSL
FT                   VLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVASITLALRTLGSFEFEGHSLTQFVR
FT                   HCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVG
FT                   ITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMN
FT                   PAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALIL
FT                   KLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
FT                   LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKH
FT                   KVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRI
FT                   FRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLG
FT                   MLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIP
FT                   HMLRVFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAA
FT                   LETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPM
FT                   VNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSSQGDALASGPVETG
FT                   PMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNP
FT                   MARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGP
FT                   LPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAS
FT                   GVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKEDPELMLGRMRCLEALGE
FT                   WGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRA
FT                   VLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKL
FT                   VPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRL
FT                   ALAHKTLVLLLGVDPSRQLDHPLPTAHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQ
FT                   QQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDR
FT                   SWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAASAAAATS
FT                   TEGSNSESEAESNENSPTPSPLQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQD
FT                   TLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLL
FT                   TDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVA
FT                   ILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLM
FT                   EAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLEL
FT                   AVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDER
FT                   VMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREK
FT                   KKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFD
FT                   RRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEK
FT                   IPFRLTRMLTNAMEVTGLDGNYRTTCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMD
FT                   TNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKAGTTVPESIHSFIGDGLVKPEA
FT                   LNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW"
FT   gap             692125..692144
FT                   /estimated_length=20
FT   CDS             join(692549..692710,693300..693408,694030..694262,
FT                   694874..695074,696307..696441,699602..699877,
FT                   699959..700067,703542..703728,704447..704575,
FT                   705058..705302,705702..705917,706652..706857,
FT                   709011..709133,709750..709839,710129..710221,
FT                   710981..711115,711331..711460,712674..712924,
FT                   721615..721701,724305..724472,725060..725172,
FT                   725376..725538,726792..726884,727519..727669,
FT                   730223..730365,732085..732123)
FT                   /codon_start=1
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /product="FK506 binding protein 12-rapamycin associated
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG16666.1 transcript_id=mCT12294.1
FT                   protein_id=mCP19396.1 isoform=CRA_b"
FT                   /protein_id="EDL14820.1"
FT                   /translation="MLGTGPAVATASAATSSNVSVLQQFASGLKSRNEETRAKAAKELQ
FT                   HYVTMELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRI
FT                   GRFANYLRNLLPSSDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEG
FT                   RRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQ
FT                   REPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGER
FT                   LREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQAVQPQQPNALVGLLGYSSPQ
FT                   GLMGFGTSPSPAKSTLVESRCCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRL
FT                   AAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDI
FT                   IRAALPPKDFAHKRQKTVQVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPAL
FT                   TAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEA
FT                   SDVASITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIH
FT                   LISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQ
FT                   ALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQS
FT                   ARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLE
FT                   MRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNF
FT                   LKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYS
FT                   TSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQF
FT                   LPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSI
FT                   QSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSQGRIVSIKLLAAIQLFGANL
FT                   DDYLHLLLPPIVKLFDAPEVPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQS
FT                   PELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE
FT                   EEDPLIYQHRMLRSSQGDALASGPVETGPMKKLHVSTINLQKAGLGSCQKGLQGRLAGV
FT                   AEALESGASEGLLIALPALMLGPGAGLQPHGQGSLQCCLCVLLV"
FT   gene            complement(736014..741235)
FT                   /locus_tag="mCG_16663"
FT                   /note="gene_id=mCG16663.2"
FT   mRNA            complement(join(736014..736675,736719..737102,
FT                   737271..737469,738061..738255,738766..738866,
FT                   740714..741235))
FT                   /locus_tag="mCG_16663"
FT                   /product="mCG16663"
FT                   /note="gene_id=mCG16663.2 transcript_id=mCT12292.2 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(736933..737102,737271..737469,
FT                   738061..738255,738766..738866,740714..741062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16663"
FT                   /product="mCG16663"
FT                   /note="gene_id=mCG16663.2 transcript_id=mCT12292.2
FT                   protein_id=mCP19352.1"
FT                   /protein_id="EDL14821.1"
FT                   /translation="MLRETWLCVILVAFVSHPVWLQKPHKRKTQLKAAGCCEEMRELKA
FT                   QVANLSSLLGELSRKQESDWVSVVMQVMELESSSKHMESRLSTAESKYSEMNNQIDIMQ
FT                   LQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDEFLGSPELEVFCDMETSGGGWT
FT                   IIQRRKSGLVSFYQDWRQYKQGFGSIRGDFWLGNEHIHRLTRQPSRLRVELEDWEGNAR
FT                   YAEYSYFALGNELNSYRLFLGNYSGNVGKDALLYHNNTVFSTKDKDNDNCLDKCAQLRK
FT                   GGYWYNCCTDSNLNGVYYRLGEHRKHMDGISWYGWHGANYSLKRVEMKIRPEAFKP"
FT   gene            <799435..823309
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /note="gene_id=mCG16664.2"
FT   mRNA            join(<799435..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   817018..817092,819292..819379,820291..820367,
FT                   821272..821443,822016..822077,822676..822748,
FT                   823198..>823307)
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, transcript variant
FT                   mCT190859"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT190859.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(799462..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   817018..817092,819292..819379,820291..820367,
FT                   821272..821443,822016..822077,822672..822748,
FT                   823198..823309)
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, transcript variant
FT                   mCT12586"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT12586.1 created
FT                   on 26-NOV-2002"
FT   CDS             join(<799463..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   817018..817092,819292..819379,820291..820367,
FT                   821272..821443,822016..822077,822676..822748,
FT                   823198..>823307)
FT                   /codon_start=1
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, isoform CRA_a"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT190859.0
FT                   protein_id=mCP111817.0 isoform=CRA_a"
FT                   /protein_id="EDL14822.1"
FT                   /translation="DGKMAPPSPREHQSAPATSATKPDAEMVLPGFPDADSFVKFALGS
FT                   VVAVTKASGGLPQFGDEYDFYRSFPAFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRS
FT                   KVTELEDKFDLLVDTNDVILERVGMLLDEASGVNKHQQPVLPAGLQVPKTIVSSWNRKA
FT                   GEYGKKAKSETFRLLHAKNIVRPQLRFREKIDNSNTPFLPKIFVKPNARKPLPLALSKE
FT                   RRERPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHPYQYELDHFTPPQSVLQRPKPQ
FT                   LYRAVGETPCHLVSSLDELVELNEKLLGCQEFAVDLEHHSYRSFLGLTCLMQISTRTED
FT                   FIVDTLELRSDMYILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLL
FT                   NLARHSLDHLLRLYCGVESNKQYQLADWRIRPLPEEMLSYARDDTHYLLYIYDRMRLEL
FT                   WERGNHQPVQLQVVWQRSRDICLKKFVKPIFTDESYLELYRKQKKHLNSQQLTAFQLLF
FT                   AWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLI
FT                   QQAREMPLLKSENAAGVRKSGPLPSAERLENDLFGPHDCSHAPPDNYQNTSTDGTLPLQ
FT                   KQPSLFTEGKEETSVDAGCLLATAVITLFSEPNTEEGGKTPLTVAQKKAQNIMQSFENP
FT                   FRMFLPSLEHKAHISQAAKFDPSSKIYEISNRWKLASQVQVQKEPKEATKKKVAEQTAA
FT                   REEAKEEAAAGVLEQAIPVRQQAALENATKKRERATSDLRTVEQKQEKKRLKSSKKAKD
FT                   PDPPGKDFSPYDYSQSDFRAFAGDSKSKPSSQFDPNKLAPSGKVLEPKNLNSRWETKAC
FT                   HLLLESRTEASATTGQRDSAGGTPGAADSAALYTPILKPLKCIPT"
FT   mRNA            join(<799466..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   819292..819379,820291..820367,821272..821443,
FT                   822016..822077,822672..822748,823198..823307)
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, transcript variant
FT                   mCT190860"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT190860.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<799466..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   819292..819379,820291..820367,821272..821443,
FT                   822016..822077,822672..822748,823198..823228)
FT                   /codon_start=1
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, isoform CRA_b"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT190860.0
FT                   protein_id=mCP111818.0 isoform=CRA_b"
FT                   /protein_id="EDL14823.1"
FT                   /translation="GKMAPPSPREHQSAPATSATKPDAEMVLPGFPDADSFVKFALGSV
FT                   VAVTKASGGLPQFGDEYDFYRSFPAFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSK
FT                   VTELEDKFDLLVDTNDVILERVGMLLDEASGVNKHQQPVLPAGLQVPKTIVSSWNRKAG
FT                   EYGKKAKSETFRLLHAKNIVRPQLRFREKIDNSNTPFLPKIFVKPNARKPLPLALSKER
FT                   RERPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHPYQYELDHFTPPQSVLQRPKPQL
FT                   YRAVGETPCHLVSSLDELVELNEKLLGCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDF
FT                   IVDTLELRSDMYILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLN
FT                   LARHSLDHLLRLYCGVESNKQYQLADWRIRPLPEEMLSYARDDTHYLLYIYDRMRLELW
FT                   ERGNHQPVQLQVVWQRSRDICLKKFVKPIFTDESYLELYRKQKKHLNSQQLTAFQLLFA
FT                   WRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQ
FT                   QAREMPLLKSENAAGVRKSGPLPSAERLENDLFGPHDCSHAPPDNYQNTSTDGTLPLQK
FT                   QPSLFTEGKEETSVDAGCLLATAVITLFSEPNTEEGGKTPLTVAQKKAQNIMQSFENPF
FT                   RMISNRWKLASQVQVQKEPKEATKKKVAEQTAAREEAKEEAAAGVLEQAIPVRQQAALE
FT                   NATKKRERATSDLRTVEQKQEKKRLKSSKKAKDPDPPGKDFSPYDYSQSDFRAFAGDSK
FT                   SKPSSQFDPNKLAPSGKKGVGAKKFKQSVGNKSMSFAVGKSDRGFRHNWPKR"
FT   CDS             join(799472..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   817018..817092,819292..819379,820291..820367,
FT                   821272..821443,822016..822077,822672..822748,
FT                   823198..823228)
FT                   /codon_start=1
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, isoform CRA_c"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT12586.1
FT                   protein_id=mCP19385.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UNK6"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="MGI:MGI:1355322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UNK6"
FT                   /protein_id="EDL14824.1"
FT                   /translation="MAPPSPREHQSAPATSATKPDAEMVLPGFPDADSFVKFALGSVVA
FT                   VTKASGGLPQFGDEYDFYRSFPAFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVT
FT                   ELEDKFDLLVDTNDVILERVGMLLDEASGVNKHQQPVLPAGLQVPKTIVSSWNRKAGEY
FT                   GKKAKSETFRLLHAKNIVRPQLRFREKIDNSNTPFLPKIFVKPNARKPLPLALSKERRE
FT                   RPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHPYQYELDHFTPPQSVLQRPKPQLYR
FT                   AVGETPCHLVSSLDELVELNEKLLGCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIV
FT                   DTLELRSDMYILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLA
FT                   RHSLDHLLRLYCGVESNKQYQLADWRIRPLPEEMLSYARDDTHYLLYIYDRMRLELWER
FT                   GNHQPVQLQVVWQRSRDICLKKFVKPIFTDESYLELYRKQKKHLNSQQLTAFQLLFAWR
FT                   DKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQA
FT                   REMPLLKSENAAGVRKSGPLPSAERLENDLFGPHDCSHAPPDNYQNTSTDGTLPLQKQP
FT                   SLFTEGKEETSVDAGCLLATAVITLFSEPNTEEGGKTPLTVAQKKAQNIMQSFENPFRM
FT                   FLPSLEHKAHISQAAKFDPSSKIYEISNRWKLASQVQVQKEPKEATKKKVAEQTAAREE
FT                   AKEEAAAGVLEQAIPVRQQAALENATKKRERATSDLRTVEQKQEKKRLKSSKKAKDPDP
FT                   PGKDFSPYDYSQSDFRAFAGDSKSKPSSQFDPNKLAPSGKKGVGAKKFKQSVGNKSMSF
FT                   AVGKSDRGFRHNWPKR"
FT   gene            complement(809918..810670)
FT                   /pseudo
FT                   /locus_tag="mCG_133682"
FT                   /note="gene_id=mCG133682.1"
FT   mRNA            complement(809918..810670)
FT                   /pseudo
FT                   /locus_tag="mCG_133682"
FT                   /note="gene_id=mCG133682.1 transcript_id=mCT135052.1
FT                   created on 26-DEC-2002"
FT   gene            complement(825673..826923)
FT                   /locus_tag="mCG_1027381"
FT                   /note="gene_id=mCG1027381.0"
FT   mRNA            complement(join(825673..825967,826761..826923))
FT                   /locus_tag="mCG_1027381"
FT                   /product="mCG1027381"
FT                   /note="gene_id=mCG1027381.0 transcript_id=mCT145085.0
FT                   created on 07-MAR-2003"
FT   CDS             complement(825829..825924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027381"
FT                   /product="mCG1027381"
FT                   /note="gene_id=mCG1027381.0 transcript_id=mCT145085.0
FT                   protein_id=mCP76743.1"
FT                   /protein_id="EDL14825.1"
FT                   /translation="MLITGQRMVLTVSLLHALTVVTGESLLGLCS"
FT   gene            832443..835548
FT                   /locus_tag="mCG_16662"
FT                   /note="gene_id=mCG16662.1"
FT   mRNA            join(832443..832727,832985..833105,833423..833515,
FT                   834235..834388,834716..834945,835031..835153,
FT                   835235..835548)
FT                   /locus_tag="mCG_16662"
FT                   /product="mCG16662"
FT                   /note="gene_id=mCG16662.1 transcript_id=mCT12291.1 created
FT                   on 19-SEP-2002"
FT   CDS             join(832561..832727,832985..833105,833423..833515,
FT                   834235..834388,834716..834945,835031..835153,
FT                   835235..835255)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16662"
FT                   /product="mCG16662"
FT                   /note="gene_id=mCG16662.1 transcript_id=mCT12291.1
FT                   protein_id=mCP19378.1"
FT                   /db_xref="GOA:Q543H0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="MGI:MGI:102690"
FT                   /db_xref="UniProtKB/TrEMBL:Q543H0"
FT                   /protein_id="EDL14826.1"
FT                   /translation="MEPGPDGPAAPGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRR
FT                   SRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGD
FT                   GGVLREVVKHPSVESVVQCEIDEDVIEVSKKFLPGMAVGFSSSKLTLHVGDGFEFMKQN
FT                   QDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRH
FT                   FCKSLFPVVDYAYCSIPTYPSGQIGFMLCSKNPSTNFREPVQQLTQAQVEQMQLKYYNS
FT                   DMHRAAFVLPEFTRKALNDIS"
FT   gene            843199..856166
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /note="gene_id=mCG16660.1"
FT   mRNA            join(843199..843558,843659..843836,844354..844485,
FT                   846265..846461,846714..846861,848607..848725,
FT                   850787..850865,852700..852831,853316..853390,
FT                   854418..856166)
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2,
FT                   transcript variant mCT176350"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT176350.0 created
FT                   on 26-NOV-2002"
FT   mRNA            join(843221..843257,843335..843563,843659..843836,
FT                   844354..844485,846265..846461,846714..846861,
FT                   848607..848725,850787..850865,852700..852831,
FT                   853316..853390,854418..856166)
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2,
FT                   transcript variant mCT176351"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT176351.0 created
FT                   on 26-NOV-2002"
FT   mRNA            join(843221..843257,843335..843563,843659..843836,
FT                   844354..844485,844923..845080)
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2,
FT                   transcript variant mCT12289"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT12289.0 created
FT                   on 26-NOV-2002"
FT   CDS             join(843253..843257,843335..843563,843659..843836,
FT                   844354..844485,846265..846461,846714..846861,
FT                   848607..848725,850787..850865,852700..852831,
FT                   853316..853390,854418..855181)
FT                   /codon_start=1
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT176351.0
FT                   protein_id=mCP99272.0 isoform=CRA_c"
FT                   /protein_id="EDL14829.1"
FT                   /translation="MRLLIFLGLLWSLVATLLGSKWPEPVFGRLVSPGFPEKYADHQDR
FT                   SWTLTAPPGYRLRLYFTHFDLELSYRCEYDFVKLSSGTKVLATLCGQESTDTEQAPGND
FT                   TFYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAEDVDECRVSLGDSVPCDHYCHNYLGGY
FT                   YCSCRAGYILHQNKHTCSALCSGQVFTGRSGYLSSPEYPQPYPKLSSCTYSIRLEDGFS
FT                   VILDFVESFDVETHPEAQCPYDSLKIQTDKGEHGPFCGKTLPPRIETDSHKVTITFATD
FT                   ESGNHTGWKIHYTSTARPCPDPTAPPNGSISPVQATYVLKDRFSVFCKTGFELLQGSVP
FT                   LKSFTAVCQKDGSWDRPMPECSIIDCGPPDDLPNGHVDYITGPQVTTYKAVIQYSCEET
FT                   FYTMSSNGKYVCEADGFWTSSKGEKLPPVCEPVCGLSTHTIGGRIVGGQPAKPGDFPWQ
FT                   VLLLGQTTAAAGALIHDNWVLTAAHAVYEKRMAASSLNIRMGILKRLSPHYTQAWPEEI
FT                   FIHEGYTHGAGFDNDIALIKLKNKVTINGSIMPVCLPRKEAASLMRTDFTGTVAGWGLT
FT                   QKGLLARNLMFVDIPIADHQKCTTVYEKLYPGVRVSANMLCAGLETGGKDSCRGDSGGA
FT                   LVFLDNETQRWFVGGIVSWGSINCGAADQYGVYTKVINYIPWIENIISNF"
FT   CDS             join(843253..843257,843335..843563,843659..843836,
FT                   844354..844485,844923..844936)
FT                   /codon_start=1
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT12289.0
FT                   protein_id=mCP19370.1 isoform=CRA_b"
FT                   /protein_id="EDL14828.1"
FT                   /translation="MRLLIFLGLLWSLVATLLGSKWPEPVFGRLVSPGFPEKYADHQDR
FT                   SWTLTAPPGYRLRLYFTHFDLELSYRCEYDFVKLSSGTKVLATLCGQESTDTEQAPGND
FT                   TFYSLGPSLKVTFHSDYSNEKPFTGFEAFYAAEDVDECRVSLGDSVPCDHYCHNYLGGY
FT                   YCSCRAGYILHQNKHTCSEQSL"
FT   CDS             join(843550..843558,843659..843836,844354..844485,
FT                   846265..846461,846714..846861,848607..848725,
FT                   850787..850865,852700..852831,853316..853390,
FT                   854418..855181)
FT                   /codon_start=1
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT176350.0
FT                   protein_id=mCP99273.0 isoform=CRA_a"
FT                   /protein_id="EDL14827.1"
FT                   /translation="MTLLSSGTKVLATLCGQESTDTEQAPGNDTFYSLGPSLKVTFHSD
FT                   YSNEKPFTGFEAFYAAEDVDECRVSLGDSVPCDHYCHNYLGGYYCSCRAGYILHQNKHT
FT                   CSALCSGQVFTGRSGYLSSPEYPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPE
FT                   AQCPYDSLKIQTDKGEHGPFCGKTLPPRIETDSHKVTITFATDESGNHTGWKIHYTSTA
FT                   RPCPDPTAPPNGSISPVQATYVLKDRFSVFCKTGFELLQGSVPLKSFTAVCQKDGSWDR
FT                   PMPECSIIDCGPPDDLPNGHVDYITGPQVTTYKAVIQYSCEETFYTMSSNGKYVCEADG
FT                   FWTSSKGEKLPPVCEPVCGLSTHTIGGRIVGGQPAKPGDFPWQVLLLGQTTAAAGALIH
FT                   DNWVLTAAHAVYEKRMAASSLNIRMGILKRLSPHYTQAWPEEIFIHEGYTHGAGFDNDI
FT                   ALIKLKNKVTINGSIMPVCLPRKEAASLMRTDFTGTVAGWGLTQKGLLARNLMFVDIPI
FT                   ADHQKCTTVYEKLYPGVRVSANMLCAGLETGGKDSCRGDSGGALVFLDNETQRWFVGGI
FT                   VSWGSINCGAADQYGVYTKVINYIPWIENIISNF"
FT   gene            complement(855413..867722)
FT                   /locus_tag="mCG_16669"
FT                   /note="gene_id=mCG16669.2"
FT   mRNA            complement(join(855413..857511,858233..858372,
FT                   859332..859458,859855..860025,861263..861403,
FT                   862627..862790,865830..866084,867383..867722))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT12588"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT12588.2 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(855977..857511,858233..858492,
FT                   859332..859458,859855..860025,861263..861403,
FT                   862627..862790,865830..866081,867383..867471))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT176356"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176356.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(856109..859458,859855..860025,
FT                   861263..861403,862627..862790,865830..866081,
FT                   867383..867460))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT176355"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176355.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(856586..857511,858233..858372,
FT                   859332..859458,859855..860025,861263..861403,
FT                   862627..862790,865830..866081,867383..>867468))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT190868"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190868.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(857393..858372,859341..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..866081,867383..867460))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT176354"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176354.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(857393..857511,858233..858404,
FT                   859411..859458,859855..860025,861263..861403,
FT                   862627..862790,865830..866081,867383..>867459))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT190867"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190867.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(857400..859458,859855..860025,
FT                   861263..861403,862627..862790,865830..866079,
FT                   867383..>867460))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT190869"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190869.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(858303..858404,859411..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..>866073))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_c"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190867.0
FT                   protein_id=mCP111821.0 isoform=CRA_c"
FT                   /protein_id="EDL14832.1"
FT                   /translation="AKMSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRY
FT                   RNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQK
FT                   TSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV
FT                   MSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDV
FT                   FIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISYNMKPSFNLCSSSHFKCLWKKHFIE
FT                   SSAVNILP"
FT   CDS             complement(join(858317..858372,859332..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..>866073))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_d"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190868.0
FT                   protein_id=mCP111822.0 isoform=CRA_d"
FT                   /protein_id="EDL14833.1"
FT                   /translation="AKMSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRY
FT                   RNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQK
FT                   TSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV
FT                   MSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDV
FT                   FIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGN
FT                   PVHLISNVYGRSTSLKVVL"
FT   CDS             complement(join(858317..858372,859341..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..866067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_a"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176354.1
FT                   protein_id=mCP99278.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R0B4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R0B4"
FT                   /protein_id="EDL14830.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGVHLI
FT                   SNVYGRSTSLKVVL"
FT   CDS             complement(join(858317..858372,859332..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..866067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_f"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT12588.2
FT                   protein_id=mCP19362.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q8BLD4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BLD4"
FT                   /protein_id="EDL14835.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPV
FT                   HLISNVYGRSTSLKVVL"
FT   CDS             complement(join(858467..858492,859332..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..866067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_g"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176356.1
FT                   protein_id=mCP99277.1 isoform=CRA_g"
FT                   /protein_id="EDL14836.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPG
FT                   KSPFGRS"
FT   CDS             complement(join(858928..859458,859855..860025,
FT                   861263..861403,862627..862790,865830..>866073))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_e"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190869.0
FT                   protein_id=mCP111823.0 isoform=CRA_e"
FT                   /protein_id="EDL14834.1"
FT                   /translation="AKMSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRY
FT                   RNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQK
FT                   TSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV
FT                   MSQRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDV
FT                   FIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGN
FT                   PGGFGNQGGFGNSRGGGAGLGNNQGGNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMG
FT                   MLASQQNQSGPSGNNQSQGSMQREPNQAFGSGNNSYSGSNSGAPLGWGSASNAGSGSGF
FT                   NGGFGSSMDSKSSGWGM"
FT   CDS             complement(join(858928..859458,859855..860025,
FT                   861263..861403,862627..862790,865830..866067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_b"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176355.1
FT                   protein_id=mCP99276.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q544R5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q544R5"
FT                   /protein_id="EDL14831.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPG
FT                   GFGNQGGFGNSRGGGAGLGNNQGGNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGML
FT                   ASQQNQSGPSGNNQSQGSMQREPNQAFGSGNNSYSGSNSGAPLGWGSASNAGSGSGFNG
FT                   GFGSSMDSKSSGWGM"
FT   gap             879351..881692
FT                   /estimated_length=2342
FT   gene            <884378..912710
FT                   /locus_tag="mCG_54852"
FT                   /note="gene_id=mCG54852.2"
FT   mRNA            join(<884378..884444,892283..892383,896046..896144,
FT                   899229..899353,900123..900268,908113..908170,
FT                   908762..908846,909833..910029,910264..910387,
FT                   912452..912710)
FT                   /locus_tag="mCG_54852"
FT                   /product="mCG54852"
FT                   /note="gene_id=mCG54852.2 transcript_id=mCT55035.2 created
FT                   on 07-MAR-2003"
FT   CDS             join(<884383..884444,892283..892383,896046..896144,
FT                   899229..899353,900123..900268,908113..908170,
FT                   908762..908846,909833..910029,910264..910387,
FT                   912452..912576)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54852"
FT                   /product="mCG54852"
FT                   /note="gene_id=mCG54852.2 transcript_id=mCT55035.2
FT                   protein_id=mCP39810.2"
FT                   /protein_id="EDL14837.1"
FT                   /translation="TPPGEERVTQLRMWGSVAVVWAICLACIQPAVFPWILPVRSNKDR
FT                   PRPAHGALTEKVECFSDYMTLQIPSSHVQGLKQWLVGVLRLPGSKRAPNHLDSLLTKCG
FT                   YLLHPAHEGGFIFRALYSGCFVQKEKANYRLEIRMFQKGAKRLKQSDRYIMRCPMMVAR
FT                   LGEQSVRCHPSFIQVRHHGCCPFEGSWWLLWRTPVWNTSLELLPLWLVSGSYAYSFEAA
FT                   CPLVSSQPGSEISVHIPKQRLGLVKRGSLIEESLSPRFLQVQQTDTFTVAEDRDFVIVS
FT                   IPSTRLLQDQPCQKARESPGTQAFYRVDLSLDFAEMDSPVHWTVENFFQCVDSCGTDID
FT                   FEREGWNATRPVCSQRSEATRWGGVSPAACEQR"
FT   gap             892719..893305
FT                   /estimated_length=587
FT   gap             906244..906263
FT                   /estimated_length=20
FT   gap             914650..918568
FT                   /estimated_length=3919
FT   gap             927161..927201
FT                   /estimated_length=41
FT   gap             950621..950640
FT                   /estimated_length=20
FT   gap             954008..954036
FT                   /estimated_length=29
FT   gap             960048..960132
FT                   /estimated_length=85
FT   gap             961628..961974
FT                   /estimated_length=347
FT   gap             963908..964154
FT                   /estimated_length=247
FT   gap             965498..965785
FT                   /estimated_length=288
FT   gap             968167..968277
FT                   /estimated_length=111
FT   gap             982933..983026
FT                   /estimated_length=94
FT   gap             999625..1000413
FT                   /estimated_length=789
FT   gap             1007670..1008507
FT                   /estimated_length=838
FT   gap             1031997..1032129
FT                   /estimated_length=133
FT   gap             1042467..1044151
FT                   /estimated_length=1685
FT   gap             1052402..1052520
FT                   /estimated_length=119
FT   gap             1053264..1053295
FT                   /estimated_length=32
FT   gap             1056223..1057194
FT                   /estimated_length=972
FT   gap             1058110..1058620
FT                   /estimated_length=511
FT   gene            1067756..1090076
FT                   /locus_tag="mCG_61360"
FT                   /note="gene_id=mCG61360.2"
FT   mRNA            join(1067756..1067877,1077658..1077763,1081393..1081547,
FT                   1084388..1084510,1087554..1087710,1089732..1090076)
FT                   /locus_tag="mCG_61360"
FT                   /product="mCG61360"
FT                   /note="gene_id=mCG61360.2 transcript_id=mCT61543.2 created
FT                   on 26-DEC-2002"
FT   CDS             join(1067839..1067877,1077658..1077763,1081393..1081547,
FT                   1084388..1084510,1087554..1087710,1089732..1089979)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61360"
FT                   /product="mCG61360"
FT                   /note="gene_id=mCG61360.2 transcript_id=mCT61543.2
FT                   protein_id=mCP39821.2"
FT                   /protein_id="EDL14838.1"
FT                   /translation="MAQRDALRTHFQKACTGHLSTDVAFGCKVQMFPGSPCVLLETCFQ
FT                   AGRGTQTLLTEGRPSPSHLPSNCLSYPLLLLRGTLQLPGGVHWNGLRTLDSWDAKTAES
FT                   VLGTVHHHRGSSRRHQESGEQWLQLLEQEDDGWDEEKEANGRAKDARPSVLLELFIWWR
FT                   EANNGTDKRISAASTCAEGNPGRKGVEEAAGTTSFRALRWEQKGLGGGGASWWEPLPLP
FT                   ELSASSPARPAVWPWFLSRLLPVLPLTDIVSMGIYISLTTLSPNGIKSKASDK"
FT   gap             1070494..1070617
FT                   /estimated_length=124
FT   gap             1090612..1090745
FT                   /estimated_length=134
FT   gap             1097301..1097352
FT                   /estimated_length=52
FT   gap             1105469..1105853
FT                   /estimated_length=385
FT   gap             1109974..1110161
FT                   /estimated_length=188
FT   gap             1114491..1114795
FT                   /estimated_length=305
FT   gene            <1132158..1134712
FT                   /locus_tag="mCG_145234"
FT                   /note="gene_id=mCG145234.0"
FT   mRNA            join(<1132158..1132261,1133099..1133153,1133733..1134712)
FT                   /locus_tag="mCG_145234"
FT                   /product="mCG145234"
FT                   /note="gene_id=mCG145234.0 transcript_id=mCT184658.0
FT                   created on 05-JUN-2003"
FT   CDS             <1133812..1134132
FT                   /codon_start=1
FT                   /locus_tag="mCG_145234"
FT                   /product="mCG145234"
FT                   /note="gene_id=mCG145234.0 transcript_id=mCT184658.0
FT                   protein_id=mCP105936.0"
FT                   /protein_id="EDL14839.1"
FT                   /translation="PVERQCYVNSGACPAGEQAGCSHPSFPAPRGGGQTQHRALGSKPV
FT                   CFPFVSRVSGARLRPAPVLSRWPPPHREHGGREESPLAPTAASLSDFKGSPSIVCACGQ
FT                   WP"
FT   gap             1143593..1144124
FT                   /estimated_length=532
FT   gene            <1144416..1196219
FT                   /locus_tag="mCG_132113"
FT                   /note="gene_id=mCG132113.1"
FT   mRNA            join(<1144416..1144470,1171994..1172143,1172294..1172482,
FT                   1175668..1176502,1177491..1177559,1179077..1179167,
FT                   1179870..1180034,1181046..1181218,1181380..1182227,
FT                   1184188..1184320,1184573..1184636,1185809..1185963,
FT                   1186108..1186230,1187164..1187502,1188929..1189127,
FT                   1189896..1190067,1191430..1191581,1191699..1191840,
FT                   1194358..1196219)
FT                   /locus_tag="mCG_132113"
FT                   /product="mCG132113"
FT                   /note="gene_id=mCG132113.1 transcript_id=mCT133461.1
FT                   created on 16-DEC-2002"
FT   CDS             join(1144416..1144470,1171994..1172143,1172294..1172482,
FT                   1175668..1176502,1177491..1177559,1179077..1179167,
FT                   1179870..1180034,1181046..1181218,1181380..1182227,
FT                   1184188..1184320,1184573..1184636,1185809..1185963,
FT                   1186108..1186230,1187164..1187502,1188929..1189127,
FT                   1189896..1190067,1191430..1191581,1191699..1191840,
FT                   1194358..1195481)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132113"
FT                   /product="mCG132113"
FT                   /note="gene_id=mCG132113.1 transcript_id=mCT133461.1
FT                   protein_id=mCP76850.1"
FT                   /protein_id="EDL14840.1"
FT                   /translation="MAFLEEFGTKERRMDLGTAESTRCTDPPAGKPPMAAKRKGGLKLN
FT                   AICAKLSRQVVVEKGAEAGSQAEVLARIARDQELPPEGVYMVQPQGCSDEEDHAEEPSK
FT                   DNSVLEEKESDGTASKDDSGPSARQASGETSSLRDYAASTMTEFLGMFGYDDQNTRDEL
FT                   AKKISFEKPHAGSTPEVAASSMLPSSEDTLSKRARFSKYEEYIRKLKAGEQLPWPAHGS
FT                   KAEDRAGKEVVGPLPSLRLPSNTAHLETKATILPLPSHSSVQMQNLVARASKYDFFIHK
FT                   LKTGENLRPQNGSTYKKPSKYDLENVKYLHLFKPGEGSPDMGGAIAFKTGKVGRPSKYD
FT                   VRGIQKPGPTKIPPAPSLVPTPLTNVPSAPSTPGPGPEPPASLSFNTPEYLKSTFSKTD
FT                   SITTGTVSTVKNGLPTDKPAVTEDVNIYQKYIARFSGSQHCGHIHCAYQYREHYHCLDP
FT                   ECNYQRFTSKQDVIRHYNMHKKRDNSLQHGFMRFSPLDDCSVYYHGCHLNGKSTHYHCM
FT                   QVGCNKVYTSTSDVMTHENFHKKNTQLINDGFQRFRATEDCGTADCQFYGQKTTHFHCR
FT                   RPGCTFTFKNKCDIEKHKSYHIKDDAYAKDGFKKFYKYEECKYEGCVYSKATNHFHCIR
FT                   AGCGFTFTSTSQMTSHKRKHERRHIRSSGALGLPASLLGAKDTEHEESSNDDLVDFSAL
FT                   SSKNSSLSASPTSQQSSASLAAAAAATTAEAIPSATKPPNSKMAGLLPQGLSGSIPLAL
FT                   ALSNSGLPTTTPYFPLLPNRGSASLPVGSPGLLGSMSSGATTSATPDMPALMASRAGDS
FT                   APTAATSLSVPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQPTPTKFPQ
FT                   AQVKQEPDSAGTPGPHEASQDRSLDLTVKDPSNESNGHAVSANSSLLSSLMNKMSQGNP
FT                   SLESFLNIKTEAEGSPAGEPSPFLGKAVKALVQEKLSEPWKVYLRRFGTKDFCDAQCDF
FT                   LHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGTAKGTPEASFPTSAAETKPPLAP
FT                   SSPPAPPGTMVAGSSLEGPAPSPVSVPSTPTLLAWKQLASTIPQMPQIPSSVPHLPTSP
FT                   LATTSLESAKPQVKPGFLQFQDNDPCLATDCKYASKFHFHCLFGNCKYVCKTSGKAESH
FT                   CLDHINPSNSLVNVRDQFAYYSLQCLCPNQHCEFRMRGHYHCLRTGCYFVTNITTKLPW
FT                   HIKKHEKAERRAANGFKYFTKREECGRLGCKYNQVNSHFHCIREGCQFSFLLKHQMTSH
FT                   ARKHMRRMLGKNFDRVPPSQGPPSLMDAETDEGMDYTGCSPGAASSESSTMDRSCSSTP
FT                   VGNESTAAGNTISMPTASGAKKRFWIIEDMSPFGKRRKTASSRKMLDEGMMLEGFRRFD
FT                   LYEDCKDTACQFSLKVTHYHCTRENCGYKFCGRTHMYKHAQHHDRVDNLVLDDFKRFKA
FT                   SLSCHFADCPFSGTSTHFHCLRCRFRCTDSTKVTAHRKHHGKQDVISAAGFCQFSSSAD
FT                   CAVPDCKYKLKCSHFHCTYPGCRHTVVGMSQMDSHKRKHEKQERGEPPAASPGAPVNLD
FT                   GSLTLAAEQGSLLFLQTAAAGLGLLGDTGDPGPPVTASGTRDGPAAPTPAAAATTTTTT
FT                   TTATATAGESSQEDDEELELPEEEAEDDDEDDDEEDDDDEDDDDDDDDEDLRTDSEESL
FT                   PEAAGEAGARTPLAALGGPGPAPTAASP"
FT   gap             1151094..1151113
FT                   /estimated_length=20
FT   gap             1154312..1154510
FT                   /estimated_length=199
FT   gap             1155436..1155552
FT                   /estimated_length=117
FT   gap             1157904..1158118
FT                   /estimated_length=215
FT   gap             1163257..1163435
FT                   /estimated_length=179
FT   gene            <1203161..1227689
FT                   /locus_tag="mCG_132114"
FT                   /note="gene_id=mCG132114.2"
FT   mRNA            join(<1203161..1203286,1214879..1215055,1225035..1227689)
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, transcript variant mCT185863"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT185863.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(<1203161..1203286,1209587..1209767,1210564..1210815)
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, transcript variant mCT133462"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT133462.2
FT                   created on 19-JUN-2003"
FT   mRNA            join(<1203161..1203286,1204246..1206682,1209587..1209852)
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, transcript variant mCT185862"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT185862.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<1203207..1203286,1204246..1205059)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, isoform CRA_a"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT185862.0
FT                   protein_id=mCP107121.0 isoform=CRA_a"
FT                   /protein_id="EDL14841.1"
FT                   /translation="RVPSLLLSGECRPPQTPARGRSPSSCSFSTCSLICPSPPRRSSLC
FT                   TPRTSSSSTWLTSSSSSSSSSLSSLFSSSPCTSILTWPLTSSTPSPSSWGPSRWYVAVE
FT                   PSGLWLSFPGEDDVDSLLTGEMSLLLWWLTAAGLEGDEDFTGICQEGIFGADGEGGNCL
FT                   LAVDKEKEKQVEVGDSTWLQCHTSPWSLIPEHSSDGSSFSRVTRQGPLEAPSAKLVCLP
FT                   EVFSAARCPNAASPTPGQDLPTLATVGLPAGGPTRSGVAPPTFNIVPTPLLWPDGDKEA
FT                   KEDQGWEPGSPWLMCP"
FT   gene            complement(1203399..1346789)
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /note="gene_id=mCG16658.2"
FT   mRNA            complement(join(1203399..1204654,1206310..1206401,
FT                   1209076..1209173,1210380..1210482,1213406..1213491,
FT                   1227055..1227183,1284730..1284814,1319259..1319306,
FT                   1346740..1346789))
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /product="peroxisomal biogenesis factor 14, transcript
FT                   variant mCT12288"
FT                   /note="gene_id=mCG16658.2 transcript_id=mCT12288.1 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(1203399..1204654,1206310..1206401,
FT                   1209076..1209173,1210380..1210482,1213406..1213491,
FT                   1227055..1227183,1319259..1319306,1346740..1346781))
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /product="peroxisomal biogenesis factor 14, transcript
FT                   variant mCT176348"
FT                   /note="gene_id=mCG16658.2 transcript_id=mCT176348.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1204201..1204654,1206310..1206401,
FT                   1209076..1209173,1210380..1210482,1213406..1213491,
FT                   1227055..1227183,1284730..1284814,1319259..1319306,
FT                   1346740..1346775))
FT                   /codon_start=1
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /product="peroxisomal biogenesis factor 14, isoform CRA_b"
FT                   /note="gene_id=mCG16658.2 transcript_id=mCT12288.1
FT                   protein_id=mCP19361.1 isoform=CRA_b"
FT                   /protein_id="EDL14845.1"
FT                   /translation="MASSEQAEQPNQPSSPPGSENVVPREPLIATAVKFLQNSRVRQSP
FT                   LATRRAFLKKKGLTDEEIDLAFQQSGTAADEPSPLGPATPVVPVQPPHLTPQPYSPRGS
FT                   RWRDYGALAIIMAGIAFGFHQLYKRYLLPLILGGREDRKQLERMAASLSELSGTVAQTV
FT                   TQVQTTLASVQELLRQQQQKVQELAHELATAKATTSTNWILESQNINELKSEINSLKGL
FT                   LLNRRQFPPSPSAPKIPSWQIPVKSSSPSSPAAVNHHSSSDISPVSNESTSSSPGKDSH
FT                   SPEGSTATYHLLGPQEEGEGVLDVKGQVRMEVQGEEEKREDKEDEDDEDDDVSHVDEED
FT                   VLGVQREDRRGGDGQINEQVEKLRRPEGASNETERD"
FT   CDS             complement(join(1204201..1204654,1206310..1206401,
FT                   1209076..1209173,1210380..1210482,1213406..1213444))
FT                   /codon_start=1
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /product="peroxisomal biogenesis factor 14, isoform CRA_a"
FT                   /note="gene_id=mCG16658.2 transcript_id=mCT176348.0
FT                   protein_id=mCP99270.0 isoform=CRA_a"
FT                   /protein_id="EDL14844.1"
FT                   /translation="MAGIAFGFHQLYKRYLLPLILGGREDRKQLERMAASLSELSGTVA
FT                   QTVTQVQTTLASVQELLRQQQQKVQELAHELATAKATTSTNWILESQNINELKSEINSL
FT                   KGLLLNRRQFPPSPSAPKIPSWQIPVKSSSPSSPAAVNHHSSSDISPVSNESTSSSPGK
FT                   DSHSPEGSTATYHLLGPQEEGEGVLDVKGQVRMEVQGEEEKREDKEDEDDEDDDVSHVD
FT                   EEDVLGVQREDRRGGDGQINEQVEKLRRPEGASNETERD"
FT   CDS             join(<1209744..1209767,1210564..1210761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, isoform CRA_c"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT133462.2
FT                   protein_id=mCP76861.2 isoform=CRA_c"
FT                   /protein_id="EDL14843.1"
FT                   /translation="RIPDSSAQVTPQKSCTLHTRNKVLEKVTSLRSRPGKNFHLNRDQD
FT                   QKEVSLQVGLGASSVSELTPQPWEVLPV"
FT   gap             1220917..1220936
FT                   /estimated_length=20
FT   CDS             <1227188..1227646
FT                   /codon_start=1
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, isoform CRA_b"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT185863.0
FT                   protein_id=mCP107120.0 isoform=CRA_b"
FT                   /protein_id="EDL14842.1"
FT                   /translation="REEQRTLMSISCQRPTLSKIFLCKQALTATERALHLSVLPPRFRI
FT                   LGNLSLSQFNLKRQNISLNTASKCGSFNFLNLSLSLLLLLKSLRTAILHSSPENRYHQL
FT                   QMWLILICNGVKKRGEKTNNNARKQTGKQKTNYWVRRLISLDRFRRRE"
FT   gap             1235434..1235453
FT                   /estimated_length=20
FT   gap             1251081..1251100
FT                   /estimated_length=20
FT   gap             1253583..1253602
FT                   /estimated_length=20
FT   gap             1259124..1259418
FT                   /estimated_length=295
FT   gap             1275651..1275670
FT                   /estimated_length=20
FT   gap             1286001..1286020
FT                   /estimated_length=20
FT   gap             1294774..1294875
FT                   /estimated_length=102
FT   gap             1321508..1321527
FT                   /estimated_length=20
FT   gap             1324184..1324203
FT                   /estimated_length=20
FT   gap             1325353..1325372
FT                   /estimated_length=20
FT   gap             1326455..1326474
FT                   /estimated_length=20
FT   gap             1328240..1328259
FT                   /estimated_length=20
FT   gap             1335317..1335336
FT                   /estimated_length=20
FT   gap             1347536..1347621
FT                   /estimated_length=86
FT   gene            <1351154..1366252
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /note="gene_id=mCG17410.3"
FT   mRNA            join(<1351154..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1364384)
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit,
FT                   transcript variant mCT190886"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190886.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1351164..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363452)
FT                   /codon_start=1
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190886.0
FT                   protein_id=mCP111829.0 isoform=CRA_c"
FT                   /protein_id="EDL14848.1"
FT                   /translation="GSGSGLPGISQSRQVPTLRMELSRGASAPDPDDVRPLKPCLLRRN
FT                   HSRDQHGVAASSLEELRSKACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKF
FT                   VALACNEKWTYNDSDGGTAWVSQESFEADEPDSRAGVKWKNVARQLKEDLSSIILLSEE
FT                   DLQALIDIPCAELAQELCQSCATVQGLQSTLQQVLDQREEARQSKQLLELYLQALEKEG
FT                   NILSNQKESKAALSEELDAVDTGVGREMASEVLLRSQILTTLKEKPAPELSLSSQDLEV
FT                   GKN"
FT   mRNA            join(<1351167..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363639,1364314..1364376)
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit,
FT                   transcript variant mCT190884"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190884.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1351167..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363452)
FT                   /codon_start=1
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190884.0
FT                   protein_id=mCP111827.0 isoform=CRA_a"
FT                   /protein_id="EDL14846.1"
FT                   /translation="SGSGLPGISQSRQVPTLRMELSRGASAPDPDDVRPLKPCLLRRNH
FT                   SRDQHGVAASSLEELRSKACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFV
FT                   ALACNEKWTYNDSDGGTAWVSQESFEADEPDSRAGVKWKNVARQLKEDLSSIILLSEED
FT                   LQALIDIPCAELAQELCQSCATVQGLQSTLQQVLDQREEARQSKQLLELYLQALEKEGN
FT                   ILSNQKESKAALSEELDAVDTGVGREMASEVLLRSQILTTLKEKPAPELSLSSQDLEVG
FT                   KN"
FT   mRNA            join(<1351182..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363437,1364681..1366252)
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit,
FT                   transcript variant mCT190885"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190885.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1351182..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363437,1364681..1364893)
FT                   /codon_start=1
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190885.0
FT                   protein_id=mCP111828.0 isoform=CRA_b"
FT                   /protein_id="EDL14847.1"
FT                   /translation="PGISQSRQVPTLRMELSRGASAPDPDDVRPLKPCLLRRNHSRDQH
FT                   GVAASSLEELRSKACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFVALACN
FT                   EKWTYNDSDGGTAWVSQESFEADEPDSRAGVKWKNVARQLKEDLSSIILLSEEDLQALI
FT                   DIPCAELAQELCQSCATVQGLQSTLQQVLDQREEARQSKQLLELYLQALEKEGNILSNQ
FT                   KESKAALSEELDAVDTGVGREMASEVLLRSQILTTLKEKPAPELSLSSQDLESVSKEDP
FT                   KALAVALSWDIRKAETVQQACTTELALRLQQVQSLHSLRNLSARRSPLPGEPQRPKRAK
FT                   RDSS"
FT   mRNA            join(<1351221..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363452,1364681..1366249)
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit,
FT                   transcript variant mCT12731"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT12731.1 created
FT                   on 26-NOV-2002"
FT   CDS             join(1351221..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363452)
FT                   /codon_start=1
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT12731.1
FT                   protein_id=mCP19359.1 isoform=CRA_d"
FT                   /protein_id="EDL14849.1"
FT                   /translation="MELSRGASAPDPDDVRPLKPCLLRRNHSRDQHGVAASSLEELRSK
FT                   ACELLAIDKSLTPITLVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWTYNDSDGGTA
FT                   WVSQESFEADEPDSRAGVKWKNVARQLKEDLSSIILLSEEDLQALIDIPCAELAQELCQ
FT                   SCATVQGLQSTLQQVLDQREEARQSKQLLELYLQALEKEGNILSNQKESKAALSEELDA
FT                   VDTGVGREMASEVLLRSQILTTLKEKPAPELSLSSQDLEVGKN"
FT   gap             1354001..1354353
FT                   /estimated_length=353
FT   gap             1355190..1357118
FT                   /estimated_length=1929
FT   gap             1358457..1360573
FT                   /estimated_length=2117
FT   gene            complement(1370530..1372231)
FT                   /gene="Cort"
FT                   /locus_tag="mCG_17408"
FT                   /note="gene_id=mCG17408.1"
FT   mRNA            complement(join(1370530..1370958,1372016..1372231))
FT                   /gene="Cort"
FT                   /locus_tag="mCG_17408"
FT                   /product="cortistatin"
FT                   /note="gene_id=mCG17408.1 transcript_id=mCT12729.1 created
FT                   on 03-JAN-2003"
FT   CDS             complement(join(1370758..1370958,1372016..1372135))
FT                   /codon_start=1
FT                   /gene="Cort"
FT                   /locus_tag="mCG_17408"
FT                   /product="cortistatin"
FT                   /note="gene_id=mCG17408.1 transcript_id=mCT12729.1
FT                   protein_id=mCP19357.1"
FT                   /protein_id="EDL14850.1"
FT                   /translation="MMGGRGTGGKWPSAFGLLLLWGVAASALPLESGPTGQDSVQEATE
FT                   GRSGLLTFLAWWASQASSSTPVGGGTPGLSKSQERPPPQQPPHLDKKPCKNFFWKTFSS
FT                   CK"
FT   gene            complement(1372606..1382999)
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /note="gene_id=mCG17407.2"
FT   mRNA            complement(join(1372606..1372634,1372771..1372926,
FT                   1377048..1377081,1377629..1377752,1382853..1382999))
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /product="RIKEN cDNA 2610040C18, transcript variant
FT                   mCT176357"
FT                   /note="gene_id=mCG17407.2 transcript_id=mCT176357.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1372824..1372926,1377048..1377081,
FT                   1377629..1377752,1382853..1382900))
FT                   /codon_start=1
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /product="RIKEN cDNA 2610040C18, isoform CRA_b"
FT                   /note="gene_id=mCG17407.2 transcript_id=mCT176357.0
FT                   protein_id=mCP99279.0 isoform=CRA_b"
FT                   /db_xref="GOA:A6PWQ2"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="MGI:MGI:1917178"
FT                   /db_xref="UniProtKB/TrEMBL:A6PWQ2"
FT                   /protein_id="EDL14852.1"
FT                   /translation="MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVTLNKQVNFSKQT
FT                   IAAISEVTFRQCENFAKDLEMFARNVQTADLGILESPRPGTLQVCMSLRGPGQRPWH"
FT   mRNA            complement(join(1373776..1374341,1375566..1375632,
FT                   1377048..1377081,1377629..1377752,1382853..1382998))
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /product="RIKEN cDNA 2610040C18, transcript variant
FT                   mCT12750"
FT                   /note="gene_id=mCG17407.2 transcript_id=mCT12750.1 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1374186..1374341,1375566..1375632,
FT                   1377048..1377081,1377629..1377752,1382853..1382900))
FT                   /codon_start=1
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /product="RIKEN cDNA 2610040C18, isoform CRA_a"
FT                   /note="gene_id=mCG17407.2 transcript_id=mCT12750.1
FT                   protein_id=mCP19383.2 isoform=CRA_a"
FT                   /db_xref="GOA:B2KFX4"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="MGI:MGI:1917178"
FT                   /db_xref="UniProtKB/TrEMBL:B2KFX4"
FT                   /protein_id="EDL14851.1"
FT                   /translation="MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVTLNKQVNFSKQT
FT                   IAAISEVTFRQCENFAKDLEMFARHAKRSTVTTEDVKLLARRNNSLLKYITEKNEEIAQ
FT                   LNLKRKAKKKRKPEDESRSSRESMAEELDGAEELQSES"
FT   gap             1384377..1384782
FT                   /estimated_length=406
FT   gap             1386488..1386762
FT                   /estimated_length=275
FT   gene            complement(1387943..1388977)
FT                   /pseudo
FT                   /locus_tag="mCG_17396"
FT                   /note="gene_id=mCG17396.0"
FT   mRNA            complement(1387943..1388977)
FT                   /pseudo
FT                   /locus_tag="mCG_17396"
FT                   /note="gene_id=mCG17396.0 transcript_id=mCT12523.1 created
FT                   on 26-DEC-2002"
FT   gene            complement(1395482..>1412168)
FT                   /locus_tag="mCG_141692"
FT                   /note="gene_id=mCG141692.1"
FT   mRNA            complement(join(1395482..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399489,1399658..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1407124..1407189,1410539..1410718,
FT                   1411496..1411571,1412080..1412165))
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, transcript variant mCT176358"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT176358.0
FT                   created on 26-NOV-2002"
FT   mRNA            complement(join(1395483..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399374,1399742..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1407124..1407189,1410539..1410718,
FT                   1411496..1411571,1412080..>1412168))
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, transcript variant mCT190854"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT190854.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(1395695..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399489,1399658..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1410536..1410718,1411496..1411571,
FT                   1412080..1412165))
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, transcript variant mCT176360"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT176360.0
FT                   created on 26-NOV-2002"
FT   CDS             complement(join(1396134..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399489,1399658..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1407124..1407189,1410539..1410718,
FT                   1411496..1411571,1412080..1412087))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, isoform CRA_a"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT176358.0
FT                   protein_id=mCP99281.0 isoform=CRA_a"
FT                   /protein_id="EDL14853.1"
FT                   /translation="MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLAN
FT                   EAKGTKVVGAQSLKDMVSKLKKPRRVILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNS
FT                   EYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKAIFQAIAAK
FT                   VGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEE
FT                   WNKTELDSFLIEITANILKYRDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLI
FT                   GEAVFARCLSSLKEERVQASQKLKGPKVVQLEGSKKSFLEDIRKALYASKIISYAQGFM
FT                   LLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAV
FT                   DNCQDSWRRVISTGVQAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELL
FT                   TKPGEFIHTNWTGHGGSVSSSSYNA"
FT   CDS             complement(join(1396134..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399489,1399658..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1410536..1410718,1411496..1411571,
FT                   1412080..1412087))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, isoform CRA_b"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT176360.0
FT                   protein_id=mCP99280.0 isoform=CRA_b"
FT                   /protein_id="EDL14854.1"
FT                   /translation="MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLAN
FT                   EAKGTKVVGAQSLKDMVSKLKKPRRVILLVKAGQAVDDFIEKLVRRCRDLKAKGILFVG
FT                   SGVSGGEEGARYGPSLMPGGNKEAWPHIKAIFQAIAAKVGTGEPCCDWVGDEGAGHFVK
FT                   MVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEEWNKTELDSFLIEITANILKYR
FT                   DTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQASQ
FT                   KLKGPKVVQLEGSKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALM
FT                   WRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDNCQDSWRRVISTGVQAGIPM
FT                   PCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLTKPGEFIHTNWTGHGGSVSSS
FT                   SYNA"
FT   CDS             complement(join(1396638..1396702,1399356..1399374,
FT                   1399742..1399788,1402099..1402288,1403453..1403587,
FT                   1405551..1405620,1406327..1406445,1407124..1407189,
FT                   1410539..1410718,1411496..1411571,1412080..>1412168))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, isoform CRA_c"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT190854.0
FT                   protein_id=mCP111815.0 isoform=CRA_c"
FT                   /protein_id="EDL14855.1"
FT                   /translation="AGLHCTCLGALGPSRFFLLDSASSASAMAQADIALIGLAVMGQNL
FT                   ILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKDMVSKLKKPRRVILLVKA
FT                   GQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGAR
FT                   YGPSLMPGGNKEAWPHIKAIFQAIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDM
FT                   QLICEAYHLMKDVLGMRHEEMAQAFEEWNKTELDSFLIEITANILKYRDTDGKELLPKI
FT                   RDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERGAASSEVCSWEKLKMH
FT                   LSETQNFRTYC"
FT   gene            complement(1421590..1554005)
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /note="gene_id=mCG141691.0"
FT   mRNA            complement(join(1421590..1426079,1426753..1426871,
FT                   1427078..1427270,1427537..1427686,1429578..1429699,
FT                   1431372..1431443,1432860..1433099,1433268..1433413,
FT                   1434993..1435054,1436419..1436552,1437843..1437957,
FT                   1443634..1443739,1444457..1444541,1447709..1447775,
FT                   1449387..1449489,1451919..1451974,1453040..1453158,
FT                   1455213..1455303,1458467..1458629,1458794..1458923,
FT                   1459250..1459335,1460078..1460196,1465711..1465959,
FT                   1467396..1467556,1467722..1467749,1470219..1470369,
FT                   1471394..1471487,1490489..1490561,1490693..1490873,
FT                   1491488..1491571,1492379..1492485,1492955..1493034,
FT                   1496889..1496964,1498819..1498898,1503017..1503150,
FT                   1507289..1507431,1507852..1507930,1508768..1508843,
FT                   1511405..1511470,1514107..1514184,1516617..1516728,
FT                   1517504..1517682,1520540..1520605,1521675..1521854,
FT                   1523606..1523682,1537837..1538011,1553743..1554005))
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, transcript variant
FT                   mCT176359"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT176359.0
FT                   created on 03-JAN-2003"
FT   mRNA            complement(join(1421591..1426079,1426753..1426871,
FT                   1427078..1427270,1427537..1427686,1429578..1429699,
FT                   1431372..1431443,1432860..1433099,1433268..1433413,
FT                   1434993..1435054,1436419..1436552,1437843..1437957,
FT                   1443634..1443739,1444457..1444541,1447709..1447775,
FT                   1449387..1449495,1451919..1451974,1453040..1453158,
FT                   1455213..1455303,1458467..1458629,1458794..1458923,
FT                   1459250..1459335,1460078..1460196,1465711..1465959,
FT                   1467396..1467533,1467722..1467749,1470219..1470369,
FT                   1471394..1471487,1490489..1490561,1490693..1490873,
FT                   1491488..1491571,1492379..1492485,1492955..1493034,
FT                   1496889..1496964,1498819..1498898,1503017..1503228,
FT                   1506307..1506348,1507289..1507431,1507852..1507930,
FT                   1508768..1508843,1511394..1511470,1514107..1514184,
FT                   1516617..1516728,1517504..1517682,1520540..1520605,
FT                   1521675..1521854,1523606..1523682,1537837..1538011,
FT                   1553743..1553938))
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, transcript variant
FT                   mCT178252"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT178252.0
FT                   created on 03-JAN-2003"
FT   CDS             complement(join(1426037..1426079,1426753..1426871,
FT                   1427078..1427270,1427537..1427686,1429578..1429699,
FT                   1431372..1431443,1432860..1433099,1433268..1433413,
FT                   1434993..1435054,1436419..1436552,1437843..1437957,
FT                   1443634..1443739,1444457..1444541,1447709..1447775,
FT                   1449387..1449489,1451919..1451974,1453040..1453158,
FT                   1455213..1455303,1458467..1458629,1458794..1458923,
FT                   1459250..1459335,1460078..1460196,1465711..1465959,
FT                   1467396..1467556,1467722..1467749,1470219..1470369,
FT                   1471394..1471487,1490489..1490561,1490693..1490873,
FT                   1491488..1491571,1492379..1492485,1492955..1493034,
FT                   1496889..1496964,1498819..1498898,1503017..1503150,
FT                   1507289..1507431,1507852..1507930,1508768..1508843,
FT                   1511405..1511470,1514107..1514184,1516617..1516728,
FT                   1517504..1517682,1520540..1520605,1521675..1521854,
FT                   1523606..1523682,1537837..1537942))
FT                   /codon_start=1
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, isoform CRA_b"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT176359.0
FT                   protein_id=mCP99282.0 isoform=CRA_b"
FT                   /protein_id="EDL14857.1"
FT                   /translation="MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKE
FT                   APKSFSFDYSYWSHTSPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKS
FT                   YTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNK
FT                   GNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFT
FT                   IVFTQKKQDPETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKV
FT                   ISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLR
FT                   YADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSS
FT                   CSLNSQVGLTSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRME
FT                   REALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADA
FT                   ERRQDIVLSGAHIKEEHCLFRSERSNTGEVIVTLEPCERSETYVNGKRVAHPVQLRSGN
FT                   RIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKR
FT                   LQEMEILYKKEKEEADLLLEQQRLDYESKLQALQRQVETRSLAAETTEEEEEEEEVPWT
FT                   QHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAISVELKKKVHVLLYVLLTCTP
FT                   YPLNRQRLDLMREMYDRAGEVASSAQDDSETTMTGSDPFYDRFHWFKLVGSSPIFHGCV
FT                   NERLADRTPSPTFSTADSDITELADEQQDAMEDFDDEAFVDDTGSDAGTEEGSELFSDG
FT                   HDPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEE
FT                   APDYGSGIRQSGTAKISFDNEYFNQSDFSSAAMTRSGLSLEELRIVEGQGQSSEVISPP
FT                   EEVNRMNDLDLKSGTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADI
FT                   FCQFNFLHRHDEAFSTEPLKNNGRGSPLGFYHVQNIAVEVTESFVDYIKTKPIVFEVFG
FT                   HYQQHPLHLQGQDLNSPPQPSRRFFPPPMPLSKPATKLNTMNKTTLGQSMSKYDLLVWF
FT                   EISELEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELV
FT                   VGRIRNKPEVDEAAVDAVLSLNIISAKSLKAAHSSSRTFYRFEAVWDSSLHNSLLLNRV
FT                   TPYGEKIYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRNLFGSGYSKSP
FT                   DSNRVTGIYELSLCKMADTGSPGMQRRRRKVLDTSVAYVRGEENLAGWRPRGDSLILEH
FT                   QWELEKLELLHEVEKTRHFLLLRERLGDSVPKSLSDSLSPSLSSGTLSTSTSISSQIST
FT                   TTFESAITPSESSGYDSADVESLVDREKELATKCLQLLTHTFNREFSQVHGSISDCKLS
FT                   DISPIGRDPSVSSFSSSTLTPSSTCPSLVDSRSSSMDQKTPEANSRASSPCQEFEQFQI
FT                   VPTVETPYLARAGKNEFLNLVPDIEEVRAGSVVSKKGYLHFKEPLSSNWAKHFVVVRRP
FT                   YVFIYNSDKDPVERGIINLSTAQVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDM
FT                   NDWLYAFNPLLAGTIRSKLSRRCPSQPKY"
FT   gap             1439793..1439812
FT                   /estimated_length=20
FT   gap             1467964..1469087
FT                   /estimated_length=1124
FT   mRNA            complement(join(1481053..1483634,1490489..1490561,
FT                   1490693..1490873,1491488..1491571,1492379..1492485,
FT                   1492955..1493034,1496889..1496964,1498819..1498898,
FT                   1503017..1503150,1507289..1507431,1507852..1507930,
FT                   1508768..1508843,1511405..1511470,1514107..1514184,
FT                   1516617..1516728,1517504..1517682,1520540..1520605,
FT                   1521675..1521854,1523606..1523682,1537837..1538011,
FT                   1553743..1553938))
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, transcript variant
FT                   mCT178253"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT178253.0
FT                   created on 03-JAN-2003"
FT   CDS             complement(join(1482159..1483634,1490489..1490561,
FT                   1490693..1490873,1491488..1491571,1492379..1492485,
FT                   1492955..1493034,1496889..1496964,1498819..1498898,
FT                   1503017..1503150,1507289..1507431,1507852..1507930,
FT                   1508768..1508843,1511405..1511470,1514107..1514184,
FT                   1516617..1516728,1517504..1517682,1520540..1520605,
FT                   1521675..1521854,1523606..1523682,1537837..1537942))
FT                   /codon_start=1
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT178253.0
FT                   protein_id=mCP101174.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AH75"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="MGI:MGI:108426"
FT                   /db_xref="UniProtKB/TrEMBL:A2AH75"
FT                   /protein_id="EDL14856.1"
FT                   /translation="MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKE
FT                   APKSFSFDYSYWSHTSPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKS
FT                   YTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNK
FT                   GNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFT
FT                   IVFTQKKQDPETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKV
FT                   ISALAEVSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLR
FT                   YADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSS
FT                   CSLNSQVGLTSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRME
FT                   REALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADA
FT                   ERRQDIVLSGAHIKEEHCLFRSERSNTGEVIVTLEPCERSETYVNGKRVAHPVQLRSGN
FT                   RIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKR
FT                   LQEMEILYKKEKEEADLLLEQQRLDADSDSGDDSDKRSCEESWKLITSLREKLPPSKLQ
FT                   TIVKKCGLPSSGKKREPIKMYQIPQRRRLSKDSKWVTISDLKIQAVKEICYEVALNDFR
FT                   HSRQEIEALAIVKMKELCAMYGKKDPNERDSWRAVARDVWDTVGVGDEKIEDMMVTGKG
FT                   GTDVDDLKVHIDKLEDILQEVKKQNNMKDEEIKVLRNKMLKMEKVLPLIGSQEQKSQGS
FT                   HKTKEPLVAGANSVSDNGVSKGESGELGKEERVSQLMNGDPAFRRGRLRWMRQEQIRFK
FT                   NLQQQEITKQLRRQNVPHRFIPPENRKPRFPFKSNPKHRNSWSPGTHIIITEDEVIELR
FT                   IPKDEEGRKGNKEESQEKVGRAASRDVQSAWGTRSQDHIQVSKQHISNQQPPPQLRWRS
FT                   NSLNNGQPKTTRCQATASSESLNSHSGHPTADLQTFQAKRHIHQHRQPYCNYNTGGQVE
FT                   GSTASCCQKQTDKPSHCNQFVTPPRMRRQFSAPNLKAGRETTV"
FT   CDS             complement(join(1507895..1507930,1508768..1508843,
FT                   1511394..1511470,1514107..1514184,1516617..1516728,
FT                   1517504..1517682,1520540..1520605,1521675..1521854,
FT                   1523606..1523682,1537837..1537942))
FT                   /codon_start=1
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, isoform CRA_c"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT178252.0
FT                   protein_id=mCP101175.0 isoform=CRA_c"
FT                   /protein_id="EDL14858.1"
FT                   /translation="MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKE
FT                   APKSFSFDYSYWSHTSPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKS
FT                   YTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNK
FT                   GNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFT
FT                   IVFTQKKQDPETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKV
FT                   ISALAEVVSFLVKRRRKLILFLIGILYLLGSFEKISVATPELQWLLL"
FT   gap             1513331..1513350
FT                   /estimated_length=20
FT   gap             1514539..1514558
FT                   /estimated_length=20
FT   gap             1533101..1533224
FT                   /estimated_length=124
FT   gap             1558149..1558239
FT                   /estimated_length=91
FT   gap             1564709..1564808
FT                   /estimated_length=100
FT   gene            complement(1574667..1673225)
FT                   /gene="Ube4b"
FT                   /locus_tag="mCG_132104"
FT                   /note="gene_id=mCG132104.0"
FT   mRNA            complement(join(1574667..1575985,1576439..1576585,
FT                   1577571..1577745,1581368..1581559,1583641..1583775,
FT                   1589280..1589424,1590916..1591042,1594328..1594563,
FT                   1597048..1597146,1597848..1597975,1601789..1601927,
FT                   1603994..1604192,1605566..1605679,1606651..1606749,
FT                   1606833..1606949,1607657..1607713,1611793..1611876,
FT                   1614640..1614754,1617494..1617594,1619163..1619304,
FT                   1627422..1627650,1629977..1630121,1631379..1631466,
FT                   1633363..1633498,1645174..1645360,1672357..1673225))
FT                   /gene="Ube4b"
FT                   /locus_tag="mCG_132104"
FT                   /product="ubiquitination factor E4B, UFD2 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG132104.0 transcript_id=mCT133452.1
FT                   created on 26-NOV-2002"
FT   gap             1586305..1586324
FT                   /estimated_length=20
FT   gap             1588484..1588503
FT                   /estimated_length=20
FT   CDS             complement(join(1597918..1597975,1601789..1601927,
FT                   1603994..1604192,1605566..1605679,1606651..1606749,
FT                   1606833..1606949,1607657..1607713,1611793..1611876,
FT                   1614640..1614754,1617494..1617594,1619163..1619304,
FT                   1627422..1627650,1629977..1630121,1631379..1631466,
FT                   1633363..1633498,1645174..1645360,1672357..1672380))
FT                   /codon_start=1
FT                   /gene="Ube4b"
FT                   /locus_tag="mCG_132104"
FT                   /product="ubiquitination factor E4B, UFD2 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG132104.0 transcript_id=mCT133452.1
FT                   protein_id=mCP76710.1"
FT                   /protein_id="EDL14859.1"
FT                   /translation="MEELSADEIRRRRLARLAGGQTSQPTTPLTSPQRENPPGPPIAAS
FT                   APGPSQSLGLNVHNMTPATSPIGAAGVAHRSQSSEGVSSLSSSPSNSLETQSQSLSRSQ
FT                   SMDIDGVSCEKSMSQVDVDSGIENMEVDENDRREKRSLSDKEPSSGPEVSEEQALQLVC
FT                   KIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPF
FT                   ASLTATSQPIATAARSPDRNLMLNTGSSSGTSPMFCNMGSFSTSSLSSLGASGGASNWD
FT                   SYSDHFTIETCKETDMLNYLIECFDRVGIEEKKAPKMCSQPAVSQLLSNIRSQCISHTA
FT                   LVLQGSLTQPRSLQQPSFLVPYMLCRNLPYGFIQELVRTTHQDEEVFKQIFIPILQGLA
FT                   LAAKECSLESDYFKYPLMALGELCETKFGKTHPMCNLVASLPLWLPKSLSPGSGRELQR
FT                   LSYLGAFFSFSVFAEDDAKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHS
FT                   ILLNGETREAALSYMAALVNANMKKAQMQADDRLVSTDGFMLNLLWVLQQLSTKIKLET
FT                   VDPTYIFHPRCRITLPNDETRINATMEDVNERLTELYGDQPPFSEPKFPTECFFLTLHA
FT                   HHLSILPSCRRYIRRLRAIRELNRNWYGARPVLTLAYLTRAS"
FT   gene            1598322..1611625
FT                   /locus_tag="mCG_1050987"
FT                   /note="gene_id=mCG1050987.0"
FT   mRNA            join(1598322..1598561,1603956..1604087,1610979..1611625)
FT                   /locus_tag="mCG_1050987"
FT                   /product="mCG1050987"
FT                   /note="gene_id=mCG1050987.0 transcript_id=mCT194776.0
FT                   created on 27-JAN-2005"
FT   gap             1599295..1599749
FT                   /estimated_length=455
FT   CDS             1611296..1611556
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050987"
FT                   /product="mCG1050987"
FT                   /note="gene_id=mCG1050987.0 transcript_id=mCT194776.0
FT                   protein_id=mCP115805.0"
FT                   /protein_id="EDL14860.1"
FT                   /translation="MFKSQVWLACCSVNQQDASDSHPLCWLPRIARHIPTVPHSLLSRT
FT                   GSGGAWKAANTLGWLRTQSHKCLAYSRVSGFTSEGESDLHL"
FT   gap             1636763..1636886
FT                   /estimated_length=124
FT   gene            1680573..1682753
FT                   /locus_tag="mCG_147510"
FT                   /note="gene_id=mCG147510.0"
FT   mRNA            join(1680573..1680843,1682507..1682753)
FT                   /locus_tag="mCG_147510"
FT                   /product="mCG147510"
FT                   /note="gene_id=mCG147510.0 transcript_id=mCT187773.0
FT                   created on 13-JAN-2004"
FT   gap             1681040..1681059
FT                   /estimated_length=20
FT   gap             1682368..1682387
FT                   /estimated_length=20
FT   CDS             1682509..1682709
FT                   /codon_start=1
FT                   /locus_tag="mCG_147510"
FT                   /product="mCG147510"
FT                   /note="gene_id=mCG147510.0 transcript_id=mCT187773.0
FT                   protein_id=mCP109469.0"
FT                   /protein_id="EDL14861.1"
FT                   /translation="MSYQGIYVTKEYLVHFEVVPGGLYLKNVLGTVFSWEGSNFRVRSF
FT                   GVKSLGVFWEQSLDGRGWAPR"
FT   gene            complement(1693221..1698362)
FT                   /gene="Rbp7"
FT                   /locus_tag="mCG_17412"
FT                   /note="gene_id=mCG17412.1"
FT   mRNA            complement(join(1693221..1693443,1696242..1696343,
FT                   1696749..1696927,1698271..1698362))
FT                   /gene="Rbp7"
FT                   /locus_tag="mCG_17412"
FT                   /product="retinol binding protein 7, cellular"
FT                   /note="gene_id=mCG17412.1 transcript_id=mCT12733.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1693393..1693443,1696242..1696343,
FT                   1696749..1696927,1698271..1698343))
FT                   /codon_start=1
FT                   /gene="Rbp7"
FT                   /locus_tag="mCG_17412"
FT                   /product="retinol binding protein 7, cellular"
FT                   /note="gene_id=mCG17412.1 transcript_id=mCT12733.0
FT                   protein_id=mCP19363.1"
FT                   /db_xref="GOA:Q540P4"
FT                   /db_xref="InterPro:IPR000463"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:1890409"
FT                   /db_xref="UniProtKB/TrEMBL:Q540P4"
FT                   /protein_id="EDL14862.1"
FT                   /translation="MPADLSGTWNLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQ
FT                   NGDSFTIQTCSSLRNYLVKFKVGEEFEEDNKGLDNRKCTSLVTWENDKLTCVQRGEKKN
FT                   RGWSHWIEGDQLHLEMFCEGQVCKQTFQRA"
FT   gap             1694735..1694754
FT                   /estimated_length=20
FT   gene            1700694..1701271
FT                   /locus_tag="mCG_132103"
FT                   /note="gene_id=mCG132103.0"
FT   mRNA            1700694..1701271
FT                   /locus_tag="mCG_132103"
FT                   /product="mCG132103"
FT                   /note="gene_id=mCG132103.0 transcript_id=mCT133451.0
FT                   created on 16-DEC-2002"
FT   CDS             1700728..1701105
FT                   /codon_start=1
FT                   /locus_tag="mCG_132103"
FT                   /product="mCG132103"
FT                   /note="gene_id=mCG132103.0 transcript_id=mCT133451.0
FT                   protein_id=mCP76706.1"
FT                   /protein_id="EDL14863.1"
FT                   /translation="MKLLTHNLLSSHVRGVGTRGFPLRLQATEVRINPVEFNPEFVARM
FT                   IPKVEWAALVQAADTLNLAEVPKEPTEGYEHDETFLRKMHHVLLEVDVLEGTLQCPESG
FT                   RLFPISRGIPNMLLNDEETET"
FT   gap             1709231..1709394
FT                   /estimated_length=164
FT   gene            complement(1711494..1728093)
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /note="gene_id=mCG17404.2"
FT   mRNA            complement(join(1711494..1712073,1712502..1712644,
FT                   1716145..1716328,1717244..1717411,1727906..1728093))
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /product="nicotinamide nucleotide adenylyltransferase 1,
FT                   transcript variant mCT12766"
FT                   /note="gene_id=mCG17404.2 transcript_id=mCT12766.2 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(1711494..1712073,1712502..1712644,
FT                   1716145..1716328,1717244..1717411,1727700..>1727969))
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /product="nicotinamide nucleotide adenylyltransferase 1,
FT                   transcript variant mCT190911"
FT                   /note="gene_id=mCG17404.2 transcript_id=mCT190911.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1711658..1712073,1712502..1712644,
FT                   1716145..1716328,1717244..1717411,1727700..>1727721))
FT                   /codon_start=1
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /product="nicotinamide nucleotide adenylyltransferase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17404.2 transcript_id=mCT190911.0
FT                   protein_id=mCP111867.0 isoform=CRA_b"
FT                   /protein_id="EDL14865.1"
FT                   /translation="LSCDLGADNIAVRGLHVGQHHQLLPMDSSKKTEVVLLACGSFNPI
FT                   TNMHLRLFELAKDYMHATGKYSVIKGIISPVGDAYKKKGLIPAHHRIIMAELATKNSHW
FT                   VEVDTWESLQKEWVETVKVLRYHQEKLATGSCSYPQSSPALEKPGRKRKWADQKQDSSP
FT                   QKPQEPKPTGVPKVKLLCGADLLESFSVPNLWKMEDITQIVANFGLICITRAGSDAQKF
FT                   IYESDVLWRHQSNIHLVNEWITNDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHELYN
FT                   TESEGRNAGVTLAPLQRNAAEAKHNHSTL"
FT   CDS             complement(join(1711658..1712073,1712502..1712644,
FT                   1716145..1716328,1717244..1717358))
FT                   /codon_start=1
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /product="nicotinamide nucleotide adenylyltransferase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17404.2 transcript_id=mCT12766.2
FT                   protein_id=mCP19381.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V449"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V449"
FT                   /protein_id="EDL14864.1"
FT                   /translation="MDSSKKTEVVLLACGSFNPITNMHLRLFELAKDYMHATGKYSVIK
FT                   GIISPVGDAYKKKGLIPAHHRIIMAELATKNSHWVEVDTWESLQKEWVETVKVLRYHQE
FT                   KLATGSCSYPQSSPALEKPGRKRKWADQKQDSSPQKPQEPKPTGVPKVKLLCGADLLES
FT                   FSVPNLWKMEDITQIVANFGLICITRAGSDAQKFIYESDVLWRHQSNIHLVNEWITNDI
FT                   SSTKIRRALRRGQSIRYLVPDLVQEYIEKHELYNTESEGRNAGVTLAPLQRNAAEAKHN
FT                   HSTL"
FT   gene            1728090..1739601
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /note="gene_id=mCG17405.2"
FT   mRNA            join(1728090..1728389,1728655..1728796,1729684..1729792,
FT                   1730988..1731123,1731562..1731660,1736123..1736218,
FT                   1736656..1736737,1739016..1739600)
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /product="leucine zipper and CTNNBIP1 domain containing,
FT                   transcript variant mCT12749"
FT                   /note="gene_id=mCG17405.2 transcript_id=mCT12749.1 created
FT                   on 14-DEC-2002"
FT   mRNA            join(1728122..1728796,1729684..1729792,1730988..1731123,
FT                   1731562..1731660,1736123..1736218,1736656..1736737,
FT                   1739016..1739601)
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /product="leucine zipper and CTNNBIP1 domain containing,
FT                   transcript variant mCT177243"
FT                   /note="gene_id=mCG17405.2 transcript_id=mCT177243.0 created
FT                   on 14-DEC-2002"
FT   CDS             join(1729692..1729792,1730988..1731123,1731562..1731660,
FT                   1736123..1736218,1736656..1736737,1739016..1739074)
FT                   /codon_start=1
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /product="leucine zipper and CTNNBIP1 domain containing,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17405.2 transcript_id=mCT177243.0
FT                   protein_id=mCP100165.0 isoform=CRA_a"
FT                   /protein_id="EDL14866.1"
FT                   /translation="MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDADEYEET
FT                   KKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPG
FT                   QLRTRLAEMDRDLMVGKLERELYTQRKVEILTALRKLGEKLTEDDETFLSANASAVLSQ
FT                   FEKVSTELGSGDKVLALAGFDVEKAKK"
FT   CDS             join(1729692..1729792,1730988..1731123,1731562..1731660,
FT                   1736123..1736218,1736656..1736737,1739016..1739074)
FT                   /codon_start=1
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /product="leucine zipper and CTNNBIP1 domain containing,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17405.2 transcript_id=mCT12749.1
FT                   protein_id=mCP19393.1 isoform=CRA_a"
FT                   /protein_id="EDL14867.1"
FT                   /translation="MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDADEYEET
FT                   KKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPG
FT                   QLRTRLAEMDRDLMVGKLERELYTQRKVEILTALRKLGEKLTEDDETFLSANASAVLSQ
FT                   FEKVSTELGSGDKVLALAGFDVEKAKK"
FT   gene            complement(1742326..1747266)
FT                   /locus_tag="mCG_1027388"
FT                   /note="gene_id=mCG1027388.0"
FT   mRNA            complement(join(1742326..1742629,1747139..1747266))
FT                   /locus_tag="mCG_1027388"
FT                   /product="mCG1027388"
FT                   /note="gene_id=mCG1027388.0 transcript_id=mCT145092.1
FT                   created on 13-MAR-2003"
FT   CDS             complement(1742385..1742483)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027388"
FT                   /product="mCG1027388"
FT                   /note="gene_id=mCG1027388.0 transcript_id=mCT145092.1
FT                   protein_id=mCP76772.1"
FT                   /protein_id="EDL14868.1"
FT                   /translation="MQKFSPKHRGIRILKASCCEWQTFQVPERMTM"
FT   gap             1761144..1761218
FT                   /estimated_length=75
FT   gene            1761302..1811000
FT                   /gene="Ctnnbip1"
FT                   /locus_tag="mCG_17406"
FT                   /note="gene_id=mCG17406.1"
FT   mRNA            join(1761302..1761357,1784365..1784449,1790251..1790371,
FT                   1790942..1791032,1808769..1811000)
FT                   /gene="Ctnnbip1"
FT                   /locus_tag="mCG_17406"
FT                   /product="catenin beta interacting protein 1"
FT                   /note="gene_id=mCG17406.1 transcript_id=mCT12728.1 created
FT                   on 26-NOV-2002"
FT   gap             1777275..1777294
FT                   /estimated_length=20
FT   CDS             join(1790276..1790371,1790942..1791032,1808769..1808827)
FT                   /codon_start=1
FT                   /gene="Ctnnbip1"
FT                   /locus_tag="mCG_17406"
FT                   /product="catenin beta interacting protein 1"
FT                   /note="gene_id=mCG17406.1 transcript_id=mCT12728.1
FT                   protein_id=mCP19353.1"
FT                   /protein_id="EDL14869.1"
FT                   /translation="MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYA
FT                   GVVSSQLSQLPQHSIDQGAEDVVMAFSRSETEDRRQ"
FT   gap             1817023..1817042
FT                   /estimated_length=20
FT   gap             1830564..1831151
FT                   /estimated_length=588
FT   gene            <1831152..1894902
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /note="gene_id=mCG17403.2"
FT   mRNA            join(1831152..1831259,1860008..1860130,1872053..1872082,
FT                   1873179..1873374,1875282..1875490,1877703..1877852,
FT                   1877964..1878149,1880652..1880900,1881215..1881336,
FT                   1884238..1884400,1887646..1887703,1889184..1889341,
FT                   1889570..1889718,1889961..1890187,1890874..1891044,
FT                   1891326..1891471,1892245..1892380,1892770..1892954,
FT                   1893377..1894902)
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /product="calsyntenin 1, transcript variant mCT12748"
FT                   /note="gene_id=mCG17403.2 transcript_id=mCT12748.2 created
FT                   on 26-NOV-2002"
FT   mRNA            join(<1831152..1831259,1860008..1860130,1873179..1873374,
FT                   1875282..1875490,1877703..1877852,1877964..1878149,
FT                   1880652..1880900,1881215..1881336,1884238..1884400,
FT                   1887646..1887703,1889184..1889341,1889570..1889718,
FT                   1889961..1890187,1890874..1891044,1891326..1891471,
FT                   1892245..1892380,1892770..1892954,1893377..1894902)
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /product="calsyntenin 1, transcript variant mCT190910"
FT                   /note="gene_id=mCG17403.2 transcript_id=mCT190910.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1831154..1831259,1860008..1860130,1873179..1873374,
FT                   1875282..1875490,1877703..1877852,1877964..1878149,
FT                   1880652..1880900,1881215..1881336,1884238..1884400,
FT                   1887646..1887674)
FT                   /codon_start=1
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /product="calsyntenin 1, isoform CRA_b"
FT                   /note="gene_id=mCG17403.2 transcript_id=mCT190910.0
FT                   protein_id=mCP111866.0 isoform=CRA_b"
FT                   /protein_id="EDL14871.1"
FT                   /translation="PRARAMLRRLAPALAPAVRLLLAGLLCGGGVWAARVNKHKPWLEP
FT                   TYHGIVTENDNTVLLDPPLIALDKDSPLRFAGEICGFKIHGQNVPFDAVVVDKSTGEGI
FT                   IRSKEKLDCELQKDYTFTIQAYDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPVFKEKS
FT                   YKAAVVEGKQHSSILRVEAVDADCSPQFSQICSYEILTPDVPFTVDKDGYIKNTEKLNY
FT                   GKEHQYKLTVTAYDCGKKRATEDVLVKISVKPTCSPGWQGWSSRIEYEPGTGALAVFPS
FT                   IHLETCDEPVASVQATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTSELLPSPSSSF
FT                   NWTVGLPTDNGHDSDQVFEFNGTQAVRIPDGVVTLDPKEPFTISVWMRHGPFGRKKETI
FT                   LCSSDKTDMNRHHYSLYVHGCRLVFLLRQDPSEEKKYRPAEFHWKLNQVCDEDWHHFVL
FT                   NVEVPSVTLYVDGIPHEPFSVTEDYPLHPTKIETQLVVGACWQEYSGSGEWQ"
FT   CDS             join(1831169..1831259,1860008..1860130,1872053..1872082,
FT                   1873179..1873374,1875282..1875490,1877703..1877852,
FT                   1877964..1878149,1880652..1880900,1881215..1881336,
FT                   1884238..1884400,1887646..1887674)
FT                   /codon_start=1
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /product="calsyntenin 1, isoform CRA_a"
FT                   /note="gene_id=mCG17403.2 transcript_id=mCT12748.2
FT                   protein_id=mCP19389.2 isoform=CRA_a"
FT                   /protein_id="EDL14870.1"
FT                   /translation="MLRRLAPALAPAVRLLLAGLLCGGGVWAARVNKHKPWLEPTYHGI
FT                   VTENDNTVLLDPPLIALDKDSPLRFAESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKS
FT                   TGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPV
FT                   FKEKSYKAAVVEGKQHSSILRVEAVDADCSPQFSQICSYEILTPDVPFTVDKDGYIKNT
FT                   EKLNYGKEHQYKLTVTAYDCGKKRATEDVLVKISVKPTCSPGWQGWSSRIEYEPGTGAL
FT                   AVFPSIHLETCDEPVASVQATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTSELLPS
FT                   PSSSFNWTVGLPTDNGHDSDQVFEFNGTQAVRIPDGVVTLDPKEPFTISVWMRHGPFGR
FT                   KKETILCSSDKTDMNRHHYSLYVHGCRLVFLLRQDPSEEKKYRPAEFHWKLNQVCDEDW
FT                   HHFVLNVEVPSVTLYVDGIPHEPFSVTEDYPLHPTKIETQLVVGACWQEYSGSGEWQ"
FT   gap             1839206..1839225
FT                   /estimated_length=20
FT   gap             1840801..1840820
FT                   /estimated_length=20
FT   gap             1849883..1849902
FT                   /estimated_length=20
FT   gap             1852093..1852112
FT                   /estimated_length=20
FT   gap             1854257..1854276
FT                   /estimated_length=20
FT   gap             1881837..1881856
FT                   /estimated_length=20
FT   gap             1890784..1890827
FT                   /estimated_length=44
FT   gene            complement(1895110..>1920815)
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /note="gene_id=mCG17400.2"
FT   mRNA            complement(join(1895110..1896781,1897750..1897882,
FT                   1898212..1898357,1898596..1898719,1899296..1899463,
FT                   1899792..1899870,1900008..1900120,1900210..1900388,
FT                   1900503..1900602,1900801..1900944,1901112..1901233,
FT                   1901321..1901485,1901566..1901616,1902366..1902496,
FT                   1902589..1902685,1903231..1903452,1904367..1904456,
FT                   1904697..1904846,1904956..1905135,1905646..1905875,
FT                   1905955..1906183,1909128..1909300,1920690..1920815))
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide, transcript variant mCT12519"
FT                   /note="gene_id=mCG17400.2 transcript_id=mCT12519.2 created
FT                   on 27-NOV-2002"
FT   mRNA            complement(join(1895174..1896781,1897750..1897882,
FT                   1898212..1898357,1898596..1898719,1899296..1899463,
FT                   1899792..1899870,1900008..1900123,1900210..1900388,
FT                   1900503..1900602,1900801..1900944,1901112..1901233,
FT                   1901321..1901488,1901566..1901616,1902366..1902496,
FT                   1902589..1902685,1903231..1903452,1904367..1904456,
FT                   1904697..1904846,1904956..1905135,1905646..1905875,
FT                   1905955..1906183,1909128..1909300,1920690..>1920815))
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide, transcript variant mCT190905"
FT                   /note="gene_id=mCG17400.2 transcript_id=mCT190905.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1896644..1896781,1897750..1897882,
FT                   1898212..1898357,1898596..1898719,1899296..1899463,
FT                   1899792..1899870,1900008..1900123,1900210..1900388,
FT                   1900503..1900602,1900801..1900944,1901112..1901233,
FT                   1901321..1901488,1901566..1901616,1902366..1902496,
FT                   1902589..1902685,1903231..1903452,1904367..1904456,
FT                   1904697..1904846,1904956..1905135,1905646..1905875,
FT                   1905955..1906183,1909128..>1909277))
FT                   /codon_start=1
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG17400.2 transcript_id=mCT190905.0
FT                   protein_id=mCP111826.0 isoform=CRA_b"
FT                   /protein_id="EDL14873.1"
FT                   /translation="HNRMPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANL
FT                   STIKQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRL
FT                   VAREGDRVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWV
FT                   EWLQYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMAC
FT                   ALRKKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVH
FT                   SSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADE
FT                   RMKLVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYA
FT                   VVEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNP
FT                   AGTVRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEEQLQLREI
FT                   LERRGSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPE
FT                   LPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKF
FT                   LLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSK
FT                   LKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCSVEQC
FT                   TFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDL
FT                   RMTPYGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEA
FT                   LDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGIN
FT                   RERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAG
FT                   LPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
FT                   "
FT   CDS             complement(join(1896644..1896781,1897750..1897882,
FT                   1898212..1898357,1898596..1898719,1899296..1899463,
FT                   1899792..1899870,1900008..1900120,1900210..1900388,
FT                   1900503..1900602,1900801..1900944,1901112..1901233,
FT                   1901321..1901485,1901566..1901616,1902366..1902496,
FT                   1902589..1902685,1903231..1903452,1904367..1904456,
FT                   1904697..1904846,1904956..1905135,1905646..1905875,
FT                   1905955..1906183,1909128..1909268))
FT                   /codon_start=1
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG17400.2 transcript_id=mCT12519.2
FT                   protein_id=mCP19384.2 isoform=CRA_a"
FT                   /db_xref="GOA:O35904"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="MGI:MGI:1098211"
FT                   /db_xref="PDB:2WXF"
FT                   /db_xref="PDB:2WXG"
FT                   /db_xref="PDB:2WXH"
FT                   /db_xref="PDB:2WXI"
FT                   /db_xref="PDB:2WXJ"
FT                   /db_xref="PDB:2WXK"
FT                   /db_xref="PDB:2WXL"
FT                   /db_xref="PDB:2WXM"
FT                   /db_xref="PDB:2WXN"
FT                   /db_xref="PDB:2WXO"
FT                   /db_xref="PDB:2WXP"
FT                   /db_xref="PDB:2WXQ"
FT                   /db_xref="PDB:2WXR"
FT                   /db_xref="PDB:2X38"
FT                   /db_xref="PDB:4AJW"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35904"
FT                   /protein_id="EDL14872.1"
FT                   /translation="MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTI
FT                   KQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAR
FT                   EGDRVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWL
FT                   QYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALR
FT                   KKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSS
FT                   ILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMK
FT                   LVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVE
FT                   KAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGT
FT                   VRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEELQLREILERR
FT                   GSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVL
FT                   SALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGR
FT                   ALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKAL
FT                   NDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDS
FT                   KMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPY
FT                   GCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAI
FT                   EEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVP
FT                   FILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELS
FT                   CSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ"
FT   gap             1906367..1906386
FT                   /estimated_length=20
FT   gap             1908765..1908972
FT                   /estimated_length=208
FT   gap             1910360..1910379
FT                   /estimated_length=20
FT   gap             1935918..1936223
FT                   /estimated_length=306
FT   gap             1937687..1937930
FT                   /estimated_length=244
FT   gap             1943398..1946777
FT                   /estimated_length=3380
FT   gap             1950636..1952089
FT                   /estimated_length=1454
FT   gap             1955276..1955944
FT                   /estimated_length=669
FT   gap             1958859..1958886
FT                   /estimated_length=28
FT   gene            complement(1960949..>1968008)
FT                   /locus_tag="mCG_17402"
FT                   /note="gene_id=mCG17402.2"
FT   mRNA            complement(join(1960949..1962643,1963586..1963723,
FT                   1964217..1964510,1965078..1965149,1967776..>1968008))
FT                   /locus_tag="mCG_17402"
FT                   /product="mCG17402"
FT                   /note="gene_id=mCG17402.2 transcript_id=mCT12765.2 created
FT                   on 26-DEC-2002"
FT   CDS             complement(join(1962546..1962643,1963586..1963723,
FT                   1964217..1964510,1965078..1965149,1967776..>1968007))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17402"
FT                   /product="mCG17402"
FT                   /note="gene_id=mCG17402.2 transcript_id=mCT12765.2
FT                   protein_id=mCP19387.2"
FT                   /protein_id="EDL14874.1"
FT                   /translation="YFSGDSASLFPSSPSLAVPYPSVTSSPASLFIPTPPGFLPLTKQQ
FT                   LFRSPRRVSPSSLPGRLSRALSLGTIPPLTRTDSGYLFSGSRPPSRVSPAGEVSLSDYF
FT                   SLLSSSFPASPLPSPAPSVASSVASSSGSLRHRRPLISPARLNLKGQKLLLFSSPGEAP
FT                   NTPSSSEEFSPPNGSLFIESPQLPQRNHTRDTKHTMEMRSMLARDSARSSHSIKKEDES
FT                   SQSSTCVVDTTTKGCSEETTPWKARVSPSLVRGLLAVSLAVNALFTSAYLYQSLR"
FT   gene            complement(1972688..1983626)
FT                   /locus_tag="mCG_17395"
FT                   /note="gene_id=mCG17395.2"
FT   mRNA            complement(join(1972688..1973005,1973477..1973826,
FT                   1975111..1975287,1976638..1976832,1977411..1977531,
FT                   1983416..1983626))
FT                   /locus_tag="mCG_17395"
FT                   /product="mCG17395, transcript variant mCT12520"
FT                   /note="gene_id=mCG17395.2 transcript_id=mCT12520.2 created
FT                   on 26-DEC-2002"
FT   CDS             complement(join(1972783..1973005,1973477..1973826,
FT                   1975111..1975287,1976638..1976832,1977411..1977531,
FT                   1983416..1983528))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17395"
FT                   /product="mCG17395, isoform CRA_a"
FT                   /note="gene_id=mCG17395.2 transcript_id=mCT12520.2
FT                   protein_id=mCP19367.2 isoform=CRA_a"
FT                   /protein_id="EDL14875.1"
FT                   /translation="MEGVSALLASCPTAGLAGGLGVTACAAAGVVLYRIARRVKPTHTM
FT                   VNCWFCNHDTLVPYGNRNCWDCPHCEQYNGFQENGDYNKPIPAQYMEHLNHVVSSVPSP
FT                   RDPAQPQQWVSSQVLLCRRCSHHQTTKIKQLAAFTPREEGRYDEEIEVYRHHLEQMYKL
FT                   CRPCQAAVEYYIKHQNRQLRALLLSHQFRRREADQAHGQSFSSSAVKAPFQVILLRALA
FT                   FLACAFLLFTTLYGPSEPFTPGAALPPALPPGGNSSAASDNTTSQAEGWQQLLGLLPEH
FT                   ATEKLHEAWAFGQSHQTSIVAVGLLTCLLAMLLAGRIRLRRIDAFSTCLWALLLGLHLA
FT                   EHYLQAASPGWLDTLKFSTTSLCCLVGFTAAVATRKSTGPRRFRPRRSEKQQ"
FT   mRNA            complement(join(1974365..1975287,1976638..1976832,
FT                   1977411..1977531,1983416..>1983579))
FT                   /locus_tag="mCG_17395"
FT                   /product="mCG17395, transcript variant mCT190864"
FT                   /note="gene_id=mCG17395.2 transcript_id=mCT190864.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1974708..1975287,1976638..>1976723))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17395"
FT                   /product="mCG17395, isoform CRA_b"
FT                   /note="gene_id=mCG17395.2 transcript_id=mCT190864.0
FT                   protein_id=mCP111825.0 isoform=CRA_b"
FT                   /protein_id="EDL14876.1"
FT                   /translation="AARSCCAEGAATTRPPRSSSWLLSHHGRRAATMRRLRCTATTWSR
FT                   CTSCAARARRPSSTTSNTRTASCVPCFSATSSGVGRLTRPMGRSEAVGHLGVGCRGGRW
FT                   SGSWALVWGIVQCAKTPFLGNSCLVAPCCHQLDAVFLRVSRMVVWLLLACSEAALLTLY
FT                   FLDTLYSFLMAASQFGNPSTGALVAAVGTKGGAEMLARGYTHNAHQCQGSDPDVRYSV"
FT   gap             1988215..1988365
FT                   /estimated_length=151
FT   gene            complement(1989766..2021470)
FT                   /gene="5730438N18Rik"
FT                   /locus_tag="mCG_141690"
FT                   /note="gene_id=mCG141690.0"
FT   mRNA            complement(join(1989766..1989909,1989991..1990702,
FT                   1994813..1995093,1998168..1998234,1999562..1999662,
FT                   2001837..2001914,2008185..2008364,2021229..2021470))
FT                   /gene="5730438N18Rik"
FT                   /locus_tag="mCG_141690"
FT                   /product="RIKEN cDNA 5730438N18"
FT                   /note="gene_id=mCG141690.0 transcript_id=mCT176344.0
FT                   created on 27-NOV-2002"
FT   gap             1989910..1989990
FT                   /estimated_length=81
FT   CDS             complement(join(1990503..1990702,1994813..1995093,
FT                   1998168..1998234,1999562..1999662,2001837..2001914,
FT                   2008185..2008364,2021229..2021284))
FT                   /codon_start=1
FT                   /gene="5730438N18Rik"
FT                   /locus_tag="mCG_141690"
FT                   /product="RIKEN cDNA 5730438N18"
FT                   /note="gene_id=mCG141690.0 transcript_id=mCT176344.0
FT                   protein_id=mCP99266.0"
FT                   /protein_id="EDL14877.1"
FT                   /translation="MATGTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLA
FT                   LRTVYYPQVHLGTISGAGMVRPTSVTPGLLQVLKSILEKEGPKSLFRGLGPNLVGVAPS
FT                   RAVYFACYSKAKEQFNGIFVPNSNTVHILSAGSAAFVTNTLMNPIWMVKTRMQLERKVR
FT                   GCKQMNTLQCARRVYQTEGVRGFYRGLTASYAGISETIICFAIYESLKKCLKDAPIVSS
FT                   TDGAEKSSSGFFGLMAAAAVSKGCASCIAYPHEVIRTRLREEGSKYRSFVQTARLVFRE
FT                   EGYLAFYRGLFAQLIRQIPNTAIVLSTYEFIVYLLGERA"
FT   gap             2003818..2003897
FT                   /estimated_length=80
FT   gap             2012793..2013608
FT                   /estimated_length=816
FT   gap             2014849..2015291
FT                   /estimated_length=443
FT   gap             2016642..2016661
FT                   /estimated_length=20
FT   gap             2019543..2020811
FT                   /estimated_length=1269
FT   gap             2048674..2048693
FT                   /estimated_length=20
FT   gap             2067127..2067146
FT                   /estimated_length=20
FT   gap             2068369..2068388
FT                   /estimated_length=20
FT   gap             2069665..2069684
FT                   /estimated_length=20
FT   gap             2094034..2094080
FT                   /estimated_length=47
FT   gap             2120247..2120266
FT                   /estimated_length=20
FT   gap             2121806..2121943
FT                   /estimated_length=138
FT   gap             2128533..2128552
FT                   /estimated_length=20
FT   gap             2129625..2129644
FT                   /estimated_length=20
FT   gap             2137712..2138162
FT                   /estimated_length=451
FT   gene            complement(2147034..2205787)
FT                   /gene="Spsb1"
FT                   /locus_tag="mCG_17401"
FT                   /note="gene_id=mCG17401.1"
FT   mRNA            complement(join(2147034..2149093,2157156..2157997,
FT                   2205603..2205787))
FT                   /gene="Spsb1"
FT                   /locus_tag="mCG_17401"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 1"
FT                   /note="gene_id=mCG17401.1 transcript_id=mCT12764.1 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(2148966..2149093,2157156..2157849))
FT                   /codon_start=1
FT                   /gene="Spsb1"
FT                   /locus_tag="mCG_17401"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 1"
FT                   /note="gene_id=mCG17401.1 transcript_id=mCT12764.1
FT                   protein_id=mCP19380.1"
FT                   /protein_id="EDL14878.1"
FT                   /translation="MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPP
FT                   VSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITW
FT                   AMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPA
FT                   FLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEI
FT                   RMRYLNGLDPEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ"
FT   gap             2173679..2173728
FT                   /estimated_length=50
FT   gap             2175768..2175839
FT                   /estimated_length=72
FT   gap             2189372..2189467
FT                   /estimated_length=96
FT   gap             2192486..2192702
FT                   /estimated_length=217
FT   gap             2204198..2204344
FT                   /estimated_length=147
FT   gap             2211053..2211072
FT                   /estimated_length=20
FT   gap             2213437..2213456
FT                   /estimated_length=20
FT   gap             2214981..2215000
FT                   /estimated_length=20
FT   gap             2216150..2216169
FT                   /estimated_length=20
FT   gap             2229453..2230201
FT                   /estimated_length=749
FT   gene            complement(2232850..2262420)
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /note="gene_id=mCG17411.2"
FT   mRNA            complement(join(2232850..2236319,2237456..2237725,
FT                   2248092..2248209,2249357..2249993,2262190..2262420))
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /product="hexose-6-phosphate dehydrogenase (glucose
FT                   1-dehydrogenase), transcript variant mCT12732"
FT                   /note="gene_id=mCG17411.2 transcript_id=mCT12732.2 created
FT                   on 26-DEC-2002"
FT   mRNA            complement(join(2234854..2236319,2237456..2237725,
FT                   2248092..2248209,2249357..2249993,2256638..2256828))
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /product="hexose-6-phosphate dehydrogenase (glucose
FT                   1-dehydrogenase), transcript variant mCT178512"
FT                   /note="gene_id=mCG17411.2 transcript_id=mCT178512.0 created
FT                   on 26-DEC-2002"
FT   CDS             complement(join(2234956..2236319,2237456..2237725,
FT                   2248092..2248209,2249357..2249993,2262190..2262194))
FT                   /codon_start=1
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /product="hexose-6-phosphate dehydrogenase (glucose
FT                   1-dehydrogenase), isoform CRA_a"
FT                   /note="gene_id=mCG17411.2 transcript_id=mCT12732.2
FT                   protein_id=mCP19372.1 isoform=CRA_a"
FT                   /protein_id="EDL14879.1"
FT                   /translation="MKHTGIWKMLLAAMCLALLGCLQAQELKGHVSIILLGATGDLAKK
FT                   YLWQGLFQLYLDEAGKGHSFSFHGAALTAPQQGQKLMDKALESLSCPKDLVPSRCDELK
FT                   GQFLQLSQYHQLKTVEDYQTLNKDIETQVQQDGLWEAGRIFYFSVPPFAYADIARNINS
FT                   SCRPHPGAWLRVVFEKPFGHDHLSAQQLASELGSFFQEEEMYRVDHYLGKQAVAQILPF
FT                   RDQNRKALDGLWNRHHVERVEIILKETIDAEGRASFYEEYGVIRDTLQNHLTEILTLVA
FT                   MELPLNISSSAAVLQHKLWAFQALRGLQKSSAILGQYQAYSGQVRRELQKPDGFQSLTP
FT                   TFAGVLVHIDNLRWEGVPFILMSGKALDERVGYVRIVFKNRAYCTQSERHWVPEQSRCL
FT                   PQQIIFYIGHGELGHPAILVSRNLFKPSLPTQKWKEVQDQPGLRLFGRPLSDYYAYRPV
FT                   REQDAYSTLLSHIFHCRKESFITTENLLASWVFWTPLLDSLAFEVPRPYPGGAENGQLL
FT                   DFEFSGGQLTFSQQQLEVLIPDLGSVPKPSDFQVLGARYRQSPLITAWPEELISKLASD
FT                   IEAAAVQAVRHFGKFHLALSGGSSPIALFQQLATGHYSFPWAHTHLWLVDERCVPLSDP
FT                   DSNFQGLQAHLLQHVRVPYYNIHPMPVHLHQRLCAEEDQGAQTYASEISALVANSSFDL
FT                   VLLGMGTDGHTASLFPQSPTGLDGDQLVVLTESPFRPHQRMSLSLPLINRAKKVAVLVM
FT                   GRTKREITTLVSRVGHEPKKWPISGVVPLSGQLVWYMDYEAFLG"
FT   CDS             complement(join(2234956..2236319,2237456..2237725,
FT                   2248092..2248209,2249357..2249974))
FT                   /codon_start=1
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /product="hexose-6-phosphate dehydrogenase (glucose
FT                   1-dehydrogenase), isoform CRA_b"
FT                   /note="gene_id=mCG17411.2 transcript_id=mCT178512.0
FT                   protein_id=mCP101434.0 isoform=CRA_b"
FT                   /protein_id="EDL14880.1"
FT                   /translation="MLLAAMCLALLGCLQAQELKGHVSIILLGATGDLAKKYLWQGLFQ
FT                   LYLDEAGKGHSFSFHGAALTAPQQGQKLMDKALESLSCPKDLVPSRCDELKGQFLQLSQ
FT                   YHQLKTVEDYQTLNKDIETQVQQDGLWEAGRIFYFSVPPFAYADIARNINSSCRPHPGA
FT                   WLRVVFEKPFGHDHLSAQQLASELGSFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKAL
FT                   DGLWNRHHVERVEIILKETIDAEGRASFYEEYGVIRDTLQNHLTEILTLVAMELPLNIS
FT                   SSAAVLQHKLWAFQALRGLQKSSAILGQYQAYSGQVRRELQKPDGFQSLTPTFAGVLVH
FT                   IDNLRWEGVPFILMSGKALDERVGYVRIVFKNRAYCTQSERHWVPEQSRCLPQQIIFYI
FT                   GHGELGHPAILVSRNLFKPSLPTQKWKEVQDQPGLRLFGRPLSDYYAYRPVREQDAYST
FT                   LLSHIFHCRKESFITTENLLASWVFWTPLLDSLAFEVPRPYPGGAENGQLLDFEFSGGQ
FT                   LTFSQQQLEVLIPDLGSVPKPSDFQVLGARYRQSPLITAWPEELISKLASDIEAAAVQA
FT                   VRHFGKFHLALSGGSSPIALFQQLATGHYSFPWAHTHLWLVDERCVPLSDPDSNFQGLQ
FT                   AHLLQHVRVPYYNIHPMPVHLHQRLCAEEDQGAQTYASEISALVANSSFDLVLLGMGTD
FT                   GHTASLFPQSPTGLDGDQLVVLTESPFRPHQRMSLSLPLINRAKKVAVLVMGRTKREIT
FT                   TLVSRVGHEPKKWPISGVVPLSGQLVWYMDYEAFLG"
FT   gap             2244166..2244321
FT                   /estimated_length=156
FT   gap             2260376..2260421
FT                   /estimated_length=46
FT   gap             2286611..2286706
FT                   /estimated_length=96
FT   gap             2313120..2313139
FT                   /estimated_length=20
FT   gap             2314957..2314976
FT                   /estimated_length=20
FT   gap             2334168..2334433
FT                   /estimated_length=266
FT   gene            2342786..2359759
FT                   /gene="Gpr157"
FT                   /locus_tag="mCG_55380"
FT                   /note="gene_id=mCG55380.2"
FT   mRNA            join(2342786..2343560,2354163..2354376,2356972..2357169,
FT                   2357604..2359759)
FT                   /gene="Gpr157"
FT                   /locus_tag="mCG_55380"
FT                   /product="G protein-coupled receptor 157"
FT                   /note="gene_id=mCG55380.2 transcript_id=mCT55563.1 created
FT                   on 11-FEB-2003"
FT   CDS             join(2343178..2343560,2354163..2354376,2356972..2357169,
FT                   2357604..2357801)
FT                   /codon_start=1
FT                   /gene="Gpr157"
FT                   /locus_tag="mCG_55380"
FT                   /product="G protein-coupled receptor 157"
FT                   /note="gene_id=mCG55380.2 transcript_id=mCT55563.1
FT                   protein_id=mCP25789.0"
FT                   /db_xref="GOA:Q148S2"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR022343"
FT                   /db_xref="MGI:MGI:2442046"
FT                   /db_xref="UniProtKB/TrEMBL:Q148S2"
FT                   /protein_id="EDL14881.1"
FT                   /translation="MPSPAPPTELLPWERAVVLLSCALSALGSGLLVATHALWPDLRSR
FT                   ARRLLLFLSLADLLSAASYFYGVLQDFAGTSWDCVLQGALSTFANTSSFFWTVAIALYL
FT                   YLSIVRTTRGPSTDHLIWAFHLISWGVPLAITVAAVSLKKIGYDASDVSVGWCWINLEA
FT                   EDRVLWMLLTGKLWEMLAYILLPLLYLLVRKHINRAHQALSEYRPICEGRQLQRGSSTS
FT                   TADKKLVLIPLIFICLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFV
FT                   LCTRAVRTRLFSLCCCCPRPSTQSPPGAPTPPKIGESQESRRTPEVPST"
FT   gap             2352063..2352082
FT                   /estimated_length=20
FT   gap             2360551..2360711
FT                   /estimated_length=161
FT   gene            complement(2369256..2374249)
FT                   /locus_tag="mCG_147511"
FT                   /note="gene_id=mCG147511.0"
FT   mRNA            complement(join(2369256..2371507,2374031..2374249))
FT                   /locus_tag="mCG_147511"
FT                   /product="mCG147511"
FT                   /note="gene_id=mCG147511.0 transcript_id=mCT187774.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2370662..2370940)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147511"
FT                   /product="mCG147511"
FT                   /note="gene_id=mCG147511.0 transcript_id=mCT187774.0
FT                   protein_id=mCP109470.0"
FT                   /protein_id="EDL14882.1"
FT                   /translation="MAVACNHVDPNSICSEDDLTFPVLRVLGLCLSPLVEEWRGAGDSS
FT                   VCSDSALTGRCFMRHTGVGRAHTQPLSPSHTATPSDFRAKDTVFSWE"
FT   gap             2371912..2372249
FT                   /estimated_length=338
FT   gene            2374715..2397918
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /note="gene_id=mCG130718.1"
FT   mRNA            join(2374715..2374922,2375027..2375420,2376056..2376137,
FT                   2380951..2381049,2381488..2381648,2384363..2384487,
FT                   2391276..2391428,2393584..2393709,2393794..2393981,
FT                   2394093..2394203,2394922..2395023,2396341..2396416,
FT                   2396963..2397090,2397188..2397918)
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 5, transcript variant mCT132043"
FT                   /note="gene_id=mCG130718.1 transcript_id=mCT132043.1
FT                   created on 27-NOV-2002"
FT   mRNA            join(2376079..2376137,2380951..2381049,2381488..2381648,
FT                   2384363..2384487,2391276..2391382,2394093..2394203,
FT                   2394922..2395023,2396341..2396416,2396963..2397090,
FT                   2397188..2397918)
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 5, transcript variant mCT176343"
FT                   /note="gene_id=mCG130718.1 transcript_id=mCT176343.0
FT                   created on 27-NOV-2002"
FT   CDS             join(2376108..2376137,2380951..2381049,2381488..2381648,
FT                   2384363..2384487,2391276..2391428,2393584..2393709,
FT                   2393794..2393981,2394093..2394203,2394922..2395023,
FT                   2396341..2396416,2396963..2397090,2397188..2397394)
FT                   /codon_start=1
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 5, isoform CRA_a"
FT                   /note="gene_id=mCG130718.1 transcript_id=mCT132043.1
FT                   protein_id=mCP76669.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WV38"
FT                   /db_xref="InterPro:IPR002442"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1928369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV38"
FT                   /protein_id="EDL14883.1"
FT                   /translation="MEEKHQEETGELTLVLALATLIAAFGSSFQYGYNVAAVNSPSEFM
FT                   QQFYNDTYYDRNEENIESFTLTLLWSLTVSMFPFGGFIGSLMVGTLVNKLGRKGALLFN
FT                   NIFSILPAILMGCSQIAQSFELIIISRLLVGICAGISSNVVPMYLGELAPKNLRGALGV
FT                   VPQLFITVGILVAQLFGLRSLLANEDGWPVLLGLTGVPAGLQLLLLPFFPESPRYLLIQ
FT                   KKDEAAAERALQTLRGWKDVHLEMEEIRKEDEAEKAAGFISVWKLFTMQSLRWQLISMI
FT                   VLMAGQQLSGVNAIYYYADQIYLSAGVKSDDVQYVTAGTGAVNVFMTILTIFVVELWGR
FT                   RFLLLVGFSTCLIACLVLTAALALQNTISWMPYISIVCVIVYVIGHALGPSPIPALLIT
FT                   EIFLQSSRPAAYMIGGSVHWLSNFTVGLIFPFIQMGLGPYSFIIFATICFLTTIYIFMV
FT                   VPETKGRTFIEINQIFTMKNKVSDVYPKKEEELGALPHAILEQ"
FT   CDS             join(2376108..2376137,2380951..2381049,2381488..2381648,
FT                   2384363..2384487,2391276..2391382,2394093..2394203,
FT                   2394922..2395023,2396341..2396416,2396963..2397090,
FT                   2397188..2397394)
FT                   /codon_start=1
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 5, isoform CRA_b"
FT                   /note="gene_id=mCG130718.1 transcript_id=mCT176343.0
FT                   protein_id=mCP99265.0 isoform=CRA_b"
FT                   /protein_id="EDL14884.1"
FT                   /translation="MEEKHQEETGELTLVLALATLIAAFGSSFQYGYNVAAVNSPSEFM
FT                   QQFYNDTYYDRNEENIESFTLTLLWSLTVSMFPFGGFIGSLMVGTLVNKLGRKGALLFN
FT                   NIFSILPAILMGCSQIAQSFELIIISRLLVGICAGISSNVVPMYLGELAPKNLRGALGV
FT                   VPQLFITVGILIYYYADQIYLSAGVKSDDVQYVTAGTGAVNVFMTILTIFVVELWGRRF
FT                   LLLVGFSTCLIACLVLTAALALQNTISWMPYISIVCVIVYVIGHALGPSPIPALLITEI
FT                   FLQSSRPAAYMIGGSVHWLSNFTVGLIFPFIQMGLGPYSFIIFATICFLTTIYIFMVVP
FT                   ETKGRTFIEINQIFTMKNKVSDVYPKKEEELGALPHAILEQ"
FT   gap             2385592..2385662
FT                   /estimated_length=71
FT   gap             2386440..2387114
FT                   /estimated_length=675
FT   gap             2393374..2393393
FT                   /estimated_length=20
FT   gene            <2403121..>2422733
FT                   /locus_tag="mCG_17184"
FT                   /note="gene_id=mCG17184.2"
FT   mRNA            join(<2403121..2403171,2403630..2403728,2406259..2406419,
FT                   2408802..2408926,2411652..2411804,2412296..2412421,
FT                   2412689..2412879,2414231..2414341,2417545..2417646,
FT                   2419456..2419531,2420703..2420830,2422515..>2422733)
FT                   /locus_tag="mCG_17184"
FT                   /product="mCG17184"
FT                   /note="gene_id=mCG17184.2 transcript_id=mCT16164.2 created
FT                   on 26-DEC-2002"
FT   CDS             join(2403121..2403171,2403630..2403728,2406259..2406419,
FT                   2408802..2408926,2411652..2411804,2412296..2412421,
FT                   2412689..2412879,2414231..2414341,2417545..2417646,
FT                   2419456..2419531,2420703..2420830,2422515..2422733)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17184"
FT                   /product="mCG17184"
FT                   /note="gene_id=mCG17184.2 transcript_id=mCT16164.2
FT                   protein_id=mCP2742.2"
FT                   /protein_id="EDL14885.1"
FT                   /translation="MEDKEIGTPLPLPHSEARLQPTLVLTTLSAAFGSVFQYGYNIAVI
FT                   NTPHKVLKSFYNDTHFERHGTFMDESTLLLLWSCTVSMFPLGGLLGSLVVGLMVNKWGR
FT                   KGTLLINNVFAITSAVLMGVSKVARAFELIILSRVLVGICAGIAYSTLPMYLGELAPQN
FT                   LRGALGTMTEVFVIIGVLLAQIFSLQAILGNATGWPILLALTGVPAVIQLLSLPFFPES
FT                   PRYTLIEKGDEETARQALRRLRGQNYNVEAEMEEMRTEERTEQAEGRLSVLNLFTFRPL
FT                   RWQLISIVVLMAGQQLSGINAVNYYADVIYTSAGVDPTQSQYVTLGSGVINLVMTLVSA
FT                   VIIERLGRRILLLSGYAICCSACLVLTVALLLQSTAPELSYLSIVCVFSYIVGHSIGPS
FT                   PVPSVVRTEIVLQSSRTAAFTVDGAVHWLTNFIVGLTFPSIQVAIGAYSFLVFAGVCIL
FT                   TAAYIYVVIPETKGRTFVEINCAFAKRNGVEFPEEKEVATAKPHTPSLPTKETAF"
FT   gap             2405036..2405056
FT                   /estimated_length=21
FT   gap             2416137..2416574
FT                   /estimated_length=438
FT   gap             2421106..2421342
FT                   /estimated_length=237
FT   gap             2424332..2424856
FT                   /estimated_length=525
FT   gap             2430748..2430770
FT                   /estimated_length=23
FT   gap             2434232..2434822
FT                   /estimated_length=591
FT   gap             2435422..2438722
FT                   /estimated_length=3301
FT   gene            complement(2441070..2455745)
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /note="gene_id=mCG17185.2"
FT   mRNA            complement(join(2441070..2441560,2443504..2443627,
FT                   2446868..2447025,2448122..2448191,2450478..2450570,
FT                   2451740..2451888,2452521..2452703,2455471..2455745))
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /product="carbonic anhydrase 6, transcript variant
FT                   mCT16165"
FT                   /note="gene_id=mCG17185.2 transcript_id=mCT16165.2 created
FT                   on 27-NOV-2002"
FT   mRNA            complement(join(2441070..2441560,2443504..2443627,
FT                   2446868..2447025,2448122..2448191,2450478..2450570,
FT                   2451740..2451888,2452521..>2452892))
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /product="carbonic anhydrase 6, transcript variant
FT                   mCT190887"
FT                   /note="gene_id=mCG17185.2 transcript_id=mCT190887.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2441457..2441560,2443504..2443627,
FT                   2446868..2447025,2448122..2448191,2450478..2450570,
FT                   2451740..2451888,2452521..2452703,2455471..2455543))
FT                   /codon_start=1
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /product="carbonic anhydrase 6, isoform CRA_b"
FT                   /note="gene_id=mCG17185.2 transcript_id=mCT16165.2
FT                   protein_id=mCP2745.2 isoform=CRA_b"
FT                   /db_xref="GOA:P18761"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018428"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="MGI:MGI:1333786"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18761"
FT                   /protein_id="EDL14887.1"
FT                   /translation="MRALVSVVSLFFLGIQAHSDWSYSGDDGVGESQWSEQYPSCGGER
FT                   QSPIDVKTEEVMFNPSLKPLSLVNYEKENLEFTMTNNGHTVSIDLPPSMYLETSDGTEF
FT                   ISKAFHFHWGGRDWELSGSEHTIDGIRSIMEAHFVHFNKEYGTYENAKDQKNGLAVLAV
FT                   LFKIDEYAENTYYSDIISALKNIEKPGETTTLKDTTIRNLLPKDVHHYYTYPGSLTTPP
FT                   CTENVQWFVLRDKVTLSKAQVVTIENSVMDHNNNTIQNGYRSTQPNNHRVVEANFLNVQ
FT                   DMYSSYHLYLKNMQKEILQPKKQKKTKKNRHFWSRK"
FT   CDS             complement(join(2441457..2441560,2443504..2443627,
FT                   2446868..2447025,2448122..2448191,2450478..2450570,
FT                   2451740..2451888,2452521..>2452779))
FT                   /codon_start=1
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /product="carbonic anhydrase 6, isoform CRA_a"
FT                   /note="gene_id=mCG17185.2 transcript_id=mCT190887.0
FT                   protein_id=mCP111824.0 isoform=CRA_a"
FT                   /protein_id="EDL14886.1"
FT                   /translation="KPLREKPQRRLSGAALSWAPLFPVAGDDGVGESQWSEQYPSCGGE
FT                   RQSPIDVKTEEVMFNPSLKPLSLVNYEKENLEFTMTNNGHTVSIDLPPSMYLETSDGTE
FT                   FISKAFHFHWGGRDWELSGSEHTIDGIRSIMEAHFVHFNKEYGTYENAKDQKNGLAVLA
FT                   VLFKIDEYAENTYYSDIISALKNIEKPGETTTLKDTTIRNLLPKDVHHYYTYPGSLTTP
FT                   PCTENVQWFVLRDKVTLSKAQVVTIENSVMDHNNNTIQNGYRSTQPNNHRVVEANFLNV
FT                   QDMYSSYHLYLKNMQKEILQPKKQKKTKKNRHFWSRK"
FT   gap             2442943..2443289
FT                   /estimated_length=347
FT   gap             2471218..2471545
FT                   /estimated_length=328
FT   gene            2482317..2482721
FT                   /pseudo
FT                   /locus_tag="mCG_50526"
FT                   /note="gene_id=mCG50526.2"
FT   mRNA            2482317..2482721
FT                   /pseudo
FT                   /locus_tag="mCG_50526"
FT                   /note="gene_id=mCG50526.2 transcript_id=mCT50709.1 created
FT                   on 23-DEC-2002"
FT   gap             2483429..2483488
FT                   /estimated_length=60
FT   gap             2484277..2484724
FT                   /estimated_length=448
FT   gene            2491374..2503337
FT                   /locus_tag="mCG_17183"
FT                   /note="gene_id=mCG17183.2"
FT   mRNA            join(2491374..2491763,2493907..2494000,2495471..2495566,
FT                   2496548..2496606,2498430..2498499,2498666..2498799,
FT                   2499555..2499777,2501032..2501229,2501913..2502114,
FT                   2502293..2502401,2502523..2502581,2502948..2503337)
FT                   /locus_tag="mCG_17183"
FT                   /product="mCG17183"
FT                   /note="gene_id=mCG17183.2 transcript_id=mCT16163.1 created
FT                   on 27-NOV-2002"
FT   CDS             join(2493916..2494000,2495471..2495566,2496548..2496606,
FT                   2498430..2498499,2498666..2498799,2499555..2499777,
FT                   2501032..2501229,2501913..2502114,2502293..2502401,
FT                   2502523..2502581,2502948..2503017)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17183"
FT                   /product="mCG17183"
FT                   /note="gene_id=mCG17183.2 transcript_id=mCT16163.1
FT                   protein_id=mCP2747.1"
FT                   /db_xref="GOA:Q5FW97"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FW97"
FT                   /protein_id="EDL14888.1"
FT                   /translation="MSILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYE
FT                   ALELRDNDKTRFMGKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKS
FT                   KFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKL
FT                   AMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKE
FT                   ALELLKTAIAKAGYTDQVVIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYK
FT                   SFVQNYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCL
FT                   LLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPC
FT                   RSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAK"
FT   gap             2500097..2500116
FT                   /estimated_length=20
FT   gap             2524928..2525375
FT                   /estimated_length=448
FT   gap             2526245..2526411
FT                   /estimated_length=167
FT   gap             2529160..2530770
FT                   /estimated_length=1611
FT   gap             2552920..2552948
FT                   /estimated_length=29
FT   gene            complement(2569454..2569858)
FT                   /pseudo
FT                   /locus_tag="mCG_50522"
FT                   /note="gene_id=mCG50522.2"
FT   mRNA            complement(2569454..2569858)
FT                   /pseudo
FT                   /locus_tag="mCG_50522"
FT                   /note="gene_id=mCG50522.2 transcript_id=mCT50705.2 created
FT                   on 11-FEB-2003"
FT   gap             2588061..2588080
FT                   /estimated_length=20
FT   gap             2602936..2603057
FT                   /estimated_length=122
FT   gap             2611904..2611923
FT                   /estimated_length=20
FT   gap             2622835..2622988
FT                   /estimated_length=154
FT   gap             2636450..2636477
FT                   /estimated_length=28
FT   gene            <2661183..2878397
FT                   /locus_tag="mCG_130721"
FT                   /note="gene_id=mCG130721.1"
FT   mRNA            join(<2661183..2661507,2686381..2686451,2694199..2694324,
FT                   2723534..2723639,2725134..2725230,2732229..2732333,
FT                   2754577..2754625,2763366..2763490,2764475..2764574,
FT                   2788418..2788516,2826666..2826746,2867285..2867447,
FT                   2868418..2868510,2868978..2869177,2870160..2870321,
FT                   2870575..2870688,2870912..2872266,2872376..2872598,
FT                   2873191..2873914,2874841..2874987,2875460..2875640,
FT                   2875891..2878397)
FT                   /locus_tag="mCG_130721"
FT                   /product="mCG130721"
FT                   /note="gene_id=mCG130721.1 transcript_id=mCT132046.2
FT                   created on 04-APR-2003"
FT   CDS             join(2661183..2661507,2686381..2686451,2694199..2694324,
FT                   2723534..2723639,2725134..2725230,2732229..2732333,
FT                   2754577..2754625,2763366..2763490,2764475..2764574,
FT                   2788418..2788516,2826666..2826746,2867285..2867447,
FT                   2868418..2868510,2868978..2869177,2870160..2870321,
FT                   2870575..2870688,2870912..2872266,2872376..2872598,
FT                   2873191..2873914,2874841..2874987,2875460..2875640,
FT                   2875891..2875924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_130721"
FT                   /product="mCG130721"
FT                   /note="gene_id=mCG130721.1 transcript_id=mCT132046.2
FT                   protein_id=mCP76686.2"
FT                   /protein_id="EDL14889.1"
FT                   /translation="MTADKDKDKDKEKDRDRDRDRERDKRDKARESENARPRRSCTLEG
FT                   GAKNYAESDHSEDEDNDNNSATTEESNKKSRKKPPKKKSRYERTDTGEITSYITEDDVV
FT                   YRPGDCVYIESRRPNTPYFICSIQDFKLVHSSQACCRSPAPAFCDPPACSLPVAPQPPQ
FT                   HLSEAGRGPGGSKRDHLLMNVKWYYRQSEVPDSVYQHLVQDRHNENDSGRELVITDPVI
FT                   KNRELFISDYVDTYHAAALRGKCNISHFSDIFAAREFKARVDSFFYILGYNPETRRLNS
FT                   TQGEIRVGPSHQAKLPDLQPFPSPDGDTVTQHEELVWMPGVSDCDLLMYLRAARSMAAF
FT                   AGMCDGGSTEDGCVAASRDDTTLNALNTLHESSYDAGKALQRLVKKPVPKLIEKCWTED
FT                   EVKRFVKGLRQYGKNFFRIRKELLPSKETGELITFYYYWKKTPEAASSRAHRRHRRQAV
FT                   FRRIKTRTASTPVNTPSRPPSSEFLDLSSASEDDFDSEDSEQELKGYACRHCFTTTSKD
FT                   WHHGGRENILLCTDCRIHFKKYGELPPIEKPVDPPPFMFKPVKEEDDGLSGKHSMRTRR
FT                   SRGSMSTLRSGRKKQPTSPDGRASPINEDIRSSGRNSPSAASTSSNDSKAETVKKSAKK
FT                   VKEEAASPLKSTKRQREKVASDTEDTDRITSKKTKTQEISRPNSPSEGEGESSDSRSVN
FT                   DEGSSDPKDIDQDNRSTSPSIPSPQDNESDSDSSAQQQMLQAQPPALQAPSGAASAPST
FT                   APPGTPQLPTQGPTPSATAVPPQGSPATSQPPNQTQSTVAPAAHTHIQQAPTLHPPRLP
FT                   SPHPPLQPMTAPPSQSSAQPHPQPSLHGQGPPGPHSLQTGPLLQHPGPPQPFGLPSQPS
FT                   QGQGPLGPSPAAAHPHSTIQLPASQSALQPQQPPREQPLPPAPLAMPHIKPPPTTPIPQ
FT                   LPAPQAHKHPPHLSGPSPFSLNANLPPPPALKPLSSLCTHHPPSAHPPPLQLMPQSQPL
FT                   PSSPAQPPGLTQSQSLPPPAASHPTTGLHQVPSQSPFPQHPFVPGGPPPITPPSCPPTS
FT                   TPPAGPSSSSQPPCSAAVSSGGSVPGAPSCPLPAVQIKEEALDEAEEPESPPPPPRSPS
FT                   PEPTVVDTPSHASQSARFYKHLDRGYNSCARTDLYFMPLAGSKLAKKREEAIEKAKREA
FT                   EQKAREEREREKEKEKEREREREREREAERAAQKASSSAHEGRLSDPQLSGPGHMRPSF
FT                   EPPPTTIAAVPPYIGPDTPALRTLSEYARPHVMSPTNRNHPFYMPLNPTDPLLAYHMPG
FT                   LYNVDPTIRERELREREIREREIRERELRERMKPGFEVKPPELDPLHPATNPMEHFARH
FT                   SALTIPPAAGPHPFASFHPGLNPLERERLALAGPQLRPEMSYPDRLAAERIHAERMASL
FT                   TSDPLARLQMFNVTPHHHQHSHIHSHLHLHQQDPLHQGSAGPVHPLVDPLTAGPHLARF
FT                   PYPPGTLPNPLLGQPPHEHEMLRHPVFGTPYPRDLPGAIPPPMSAAHQLQAMHAQSAEL
FT                   QRLAMEQQWLHGHPHMHGGHLPSQEDYYSRLKKEGDKQL"
FT   gap             2714629..2714764
FT                   /estimated_length=136
FT   gap             2733843..2733989
FT                   /estimated_length=147
FT   gap             2749229..2749825
FT                   /estimated_length=597
FT   gap             2781146..2781396
FT                   /estimated_length=251
FT   gap             2787277..2787586
FT                   /estimated_length=310
FT   gap             2790502..2790521
FT                   /estimated_length=20
FT   gap             2804305..2804324
FT                   /estimated_length=20
FT   gap             2806094..2806113
FT                   /estimated_length=20
FT   gene            2820596..2829937
FT                   /locus_tag="mCG_147508"
FT                   /note="gene_id=mCG147508.0"
FT   mRNA            join(2820596..2823496,2829813..2829937)
FT                   /locus_tag="mCG_147508"
FT                   /product="mCG147508"
FT                   /note="gene_id=mCG147508.0 transcript_id=mCT187771.0
FT                   created on 13-JAN-2004"
FT   CDS             join(2823322..2823496,2829813..2829856)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147508"
FT                   /product="mCG147508"
FT                   /note="gene_id=mCG147508.0 transcript_id=mCT187771.0
FT                   protein_id=mCP109468.0"
FT                   /protein_id="EDL14890.1"
FT                   /translation="MNPGSRTDIIRHLDGKVGWALTSGLKEAWAPSCRVKRYFFFFFFF
FT                   GLVSFLFVFFRDGGFLCVALAVLELTL"
FT   gap             2825544..2825902
FT                   /estimated_length=359
FT   gap             2830528..2830872
FT                   /estimated_length=345
FT   gap             2837354..2837374
FT                   /estimated_length=21
FT   gene            complement(2885909..2908058)
FT                   /gene="Slc45a1"
FT                   /locus_tag="mCG_17186"
FT                   /note="gene_id=mCG17186.2"
FT   mRNA            complement(join(2885909..2886253,2887374..2887579,
FT                   2889789..2889965,2891363..2891516,2894435..2895171,
FT                   2898426..2898650,2899308..2899400,2899967..2900387,
FT                   2907952..2908058))
FT                   /gene="Slc45a1"
FT                   /locus_tag="mCG_17186"
FT                   /product="solute carrier family 45, member 1"
FT                   /note="gene_id=mCG17186.2 transcript_id=mCT16166.2 created
FT                   on 26-DEC-2002"
FT   CDS             complement(join(2885987..2886253,2887374..2887579,
FT                   2889789..2889965,2891363..2891516,2894435..2895171,
FT                   2898426..2898650,2899308..2899400,2899967..2900363))
FT                   /codon_start=1
FT                   /gene="Slc45a1"
FT                   /locus_tag="mCG_17186"
FT                   /product="solute carrier family 45, member 1"
FT                   /note="gene_id=mCG17186.2 transcript_id=mCT16166.2
FT                   protein_id=mCP2748.2"
FT                   /protein_id="EDL14891.1"
FT                   /translation="MIPPASSTPPGEAVIPSVAPQDFWRSPISSYSGSVTGHISHRANN
FT                   FKRHPKRRKYIRPSPPPPPNTPCPIELVDFGDLHPQRSFWELLFNGCILFGIEFSYAME
FT                   TAYVTPVLLQMGLPDQLYSLVWFISPILGFLLQPLLGAWSDRCTSRFGRRRPFILVLAI
FT                   GALLGLSLLLNGRDIGMALADTATNHKWGILLTVCGVVLMDFSADSADNPSHAYMMDVC
FT                   GPVDQDRGLNIHALMAGLGGGFGYVVGGIHWDKTSFGRALGGQLRVIYVFTAITLSVTT
FT                   VLTLISIPERPLRPLGEKRTAMKSPSLPLPPSPPVLLEEGAGDALPSTTATSLYASFSS
FT                   PISPPSPLTPKYGSFISRDSSLTGINEFASSFGTSNIDSVLIDCFTAGHDNYLALPSSV
FT                   PRQAISVSFPRAPDGFYCQERGLERREGPLTLGSDGDVLRVGSLDTSKPRASGILKRPQ
FT                   TLALPDVAGGNGPETSRRRNVTFSQQVANILLNGVKYESELTGSSEQSEQPLSLRHLCS
FT                   TIYNMPKALRNLCVNHFLGWLSFEGMLLFYTDFMGEVVFQGDPKAPHTSEAYQKYNSGV
FT                   TMGCWGMCIYAFSAAFYSAILEKLEECLSVRTLYFIAYLAFGLGTGLATLSRNLYVVLS
FT                   LCTTYGILFSTLCTLPYSLLCDYYQSKKFAGSSADGTRRGMGVDISLLSCQYFLAQILV
FT                   SLVLGPLTSAVGSANGVMYFSSLVSFLGCLYSSLCVTYEIPSVDAADEERQPLLLNV"
FT   gap             2895575..2896016
FT                   /estimated_length=442
FT   gap             2897931..2897950
FT                   /estimated_length=20
FT   gap             2899134..2899286
FT                   /estimated_length=153
FT   gap             2909900..2910224
FT                   /estimated_length=325
FT   gap             2915398..2915417
FT                   /estimated_length=20
FT   gap             2934033..2934052
FT                   /estimated_length=20
FT   gap             2942410..2942429
FT                   /estimated_length=20
FT   gap             2950250..2950292
FT                   /estimated_length=43
FT   gap             2967102..2967129
FT                   /estimated_length=28
FT   gap             2971664..2972490
FT                   /estimated_length=827
FT   gap             2975820..2975839
FT                   /estimated_length=20
FT   gap             2979040..2979080
FT                   /estimated_length=41
FT   gap             2983479..2983849
FT                   /estimated_length=371
FT   gap             2985902..2986964
FT                   /estimated_length=1063
FT   gap             3006595..3006681
FT                   /estimated_length=87
FT   gap             3010066..3010163
FT                   /estimated_length=98
FT   gap             3014460..3014479
FT                   /estimated_length=20
FT   gap             3018158..3019091
FT                   /estimated_length=934
FT   gap             3031885..3031904
FT                   /estimated_length=20
FT   gap             3035275..3035742
FT                   /estimated_length=468
FT   gap             3036400..3036419
FT                   /estimated_length=20
FT   gap             3041106..3041125
FT                   /estimated_length=20
FT   gap             3046219..3046454
FT                   /estimated_length=236
FT   gap             3047966..3048154
FT                   /estimated_length=189
FT   gap             3049634..3049716
FT                   /estimated_length=83
FT   gene            complement(3056681..3119426)
FT                   /locus_tag="mCG_147512"
FT                   /note="gene_id=mCG147512.0"
FT   mRNA            complement(join(3056681..3056702,3118372..3119426))
FT                   /locus_tag="mCG_147512"
FT                   /product="mCG147512"
FT                   /note="gene_id=mCG147512.0 transcript_id=mCT187775.0
FT                   created on 13-JAN-2004"
FT   gap             3059236..3061885
FT                   /estimated_length=2650
FT   gap             3078360..3078540
FT                   /estimated_length=181
FT   gene            <3082308..>3096348
FT                   /locus_tag="mCG_145229"
FT                   /note="gene_id=mCG145229.0"
FT   mRNA            join(<3082308..3082536,3088740..3088975,3096054..>3096348)
FT                   /locus_tag="mCG_145229"
FT                   /product="mCG145229"
FT                   /note="gene_id=mCG145229.0 transcript_id=mCT184653.0
FT                   created on 05-JUN-2003"
FT   gap             3083265..3083500
FT                   /estimated_length=236
FT   gene            complement(3084991..3111556)
FT                   /locus_tag="mCG_1027359"
FT                   /note="gene_id=mCG1027359.1"
FT   mRNA            complement(join(3084991..3085249,3106453..3106575,
FT                   3111433..3111556))
FT                   /locus_tag="mCG_1027359"
FT                   /product="mCG1027359"
FT                   /note="gene_id=mCG1027359.1 transcript_id=mCT145063.1
FT                   created on 14-FEB-2003"
FT   CDS             complement(join(3085081..3085249,3106453..3106541))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027359"
FT                   /product="mCG1027359"
FT                   /note="gene_id=mCG1027359.1 transcript_id=mCT145063.1
FT                   protein_id=mCP76841.1"
FT                   /protein_id="EDL14894.1"
FT                   /translation="MVFPACNPSNLELEEEGLRVQSILGYICLKWNLKTELMTYGAKST
FT                   AKRVIPKLDVLCVQAKWIFSILHGRSKATTGALKRRSFGI"
FT   CDS             join(<3088965..3088975,3096054..>3096348)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145229"
FT                   /product="mCG145229"
FT                   /note="gene_id=mCG145229.0 transcript_id=mCT184653.0
FT                   protein_id=mCP105931.0"
FT                   /protein_id="EDL14893.1"
FT                   /translation="EEASGANQERENRGEPVRSCSCGMFTPSQPNRAPHAQTPPPPART
FT                   HKSQMEKPLTKLKHTNWALNFYWKCPLPASLVRYCVGVGCTTKRKFFLSEQINHLEL"
FT   gap             3098719..3098738
FT                   /estimated_length=20
FT   gene            3103755..3104231
FT                   /pseudo
FT                   /locus_tag="mCG_1027347"
FT                   /note="gene_id=mCG1027347.1"
FT   mRNA            3103755..3104231
FT                   /pseudo
FT                   /locus_tag="mCG_1027347"
FT                   /note="gene_id=mCG1027347.1 transcript_id=mCT145051.1
FT                   created on 29-JAN-2003"
FT   gap             3108754..3110627
FT                   /estimated_length=1874
FT   gene            3111698..3125368
FT                   /gene="Errfi1"
FT                   /locus_tag="mCG_1312"
FT                   /note="gene_id=mCG1312.2"
FT   mRNA            join(3111698..3111878,3121557..3121751,3121846..3121922,
FT                   3122798..3125368)
FT                   /gene="Errfi1"
FT                   /locus_tag="mCG_1312"
FT                   /product="ERBB receptor feedback inhibitor 1"
FT                   /note="gene_id=mCG1312.2 transcript_id=mCT8615.2 created on
FT                   27-NOV-2002"
FT   gap             3111924..3112011
FT                   /estimated_length=88
FT   CDS             complement(3118868..3118984)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147512"
FT                   /product="mCG147512"
FT                   /note="gene_id=mCG147512.0 transcript_id=mCT187775.0
FT                   protein_id=mCP109471.0"
FT                   /protein_id="EDL14892.1"
FT                   /translation="MLQCLQLYPSPHNCKTSSTFQFIKKLTAKIHLCMSVNI"
FT   CDS             join(3121630..3121751,3121846..3121922,3122798..3123984)
FT                   /codon_start=1
FT                   /gene="Errfi1"
FT                   /locus_tag="mCG_1312"
FT                   /product="ERBB receptor feedback inhibitor 1"
FT                   /note="gene_id=mCG1312.2 transcript_id=mCT8615.2
FT                   protein_id=mCP21724.2"
FT                   /db_xref="GOA:Q3TK48"
FT                   /db_xref="InterPro:IPR015116"
FT                   /db_xref="InterPro:IPR021619"
FT                   /db_xref="MGI:MGI:1921405"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TK48"
FT                   /protein_id="EDL14895.1"
FT                   /translation="MSTAGVAAQDIRVPLKTGFLHNGQALGNMKSCWGSHSEFENNFLN
FT                   IDPITMAYNLNSPAQEHLTTVGCAARSAPGSGHFFAECGPSPRSSLPPLVISPSESSGQ
FT                   REEDQVMCGFKKLSVNGVCTSTPPLTPIKSCPSPFPCAALCDRGSRPLPPLPISEDLCV
FT                   DEADSEVELLTTSSDTDLLLEDSAPSDFKYDAPGRRSFRGCGQINYAYFDSPTVSVADL
FT                   SCASDQNRVVPDPNPPPPQSHRRLRRSHSGPAGSFNKPAIRISSCTHRASPSSDEDKPE
FT                   VPPRVPIPPRPAKPDYRRWSAEVTSNTYSDEDRPPKVPPREPLSRSNSRTPSPKSLPSY
FT                   LNGVMPPTQSFAPDPKYVSSKALQRQSSEGSANKVPCILPIIENGKKVSSTHYYLLPER
FT                   PPYLDKYEKYFKEAEETNPSTQIQPLPAACGMASATEKLASRMKIDMGSHGKRKHLSYV
FT                   VSP"
FT   gap             3138687..3138706
FT                   /estimated_length=20
FT   gap             3143330..3143595
FT                   /estimated_length=266
FT   gap             3148331..3148676
FT                   /estimated_length=346
FT   gene            complement(3153691..3170982)
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /note="gene_id=mCG1310.2"
FT   mRNA            complement(join(3153691..3154020,3157563..3157649,
FT                   3160370..3160439,3161807..3161866,3163598..3163699,
FT                   3164882..3164987,3166347..3166414))
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7, transcript variant mCT8613"
FT                   /note="gene_id=mCG1310.2 transcript_id=mCT8613.1 created on
FT                   27-NOV-2002"
FT   mRNA            complement(join(3153784..3154020,3157563..3157649,
FT                   3160370..3160439,3161807..3161866,3163598..3163699,
FT                   3164882..3164987,3170878..3170982))
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7, transcript variant mCT176345"
FT                   /note="gene_id=mCG1310.2 transcript_id=mCT176345.0 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(3153860..3154020,3157563..3157649,
FT                   3160370..3160439,3161807..3161866,3163598..3163699,
FT                   3164882..3164971))
FT                   /codon_start=1
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7, isoform CRA_a"
FT                   /note="gene_id=mCG1310.2 transcript_id=mCT176345.0
FT                   protein_id=mCP99267.0 isoform=CRA_a"
FT                   /protein_id="EDL14896.1"
FT                   /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQ
FT                   CSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAA
FT                   ICAGPTALLAHEVGFGCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFE
FT                   FALAIVEALVGKDMANQVKAPLVLKD"
FT   CDS             complement(join(3153860..3154020,3157563..3157649,
FT                   3160370..3160439,3161807..3161866,3163598..3163699,
FT                   3164882..3164971))
FT                   /codon_start=1
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7, isoform CRA_a"
FT                   /note="gene_id=mCG1310.2 transcript_id=mCT8613.1
FT                   protein_id=mCP21736.1 isoform=CRA_a"
FT                   /protein_id="EDL14897.1"
FT                   /translation="MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQ
FT                   CSRDVMICPDTSLEDAKTQGPYDVVVLPGGNLGAQNLSESPMVKEILKEQESRKGLIAA
FT                   ICAGPTALLAHEVGFGCKVTTHPLAKDKMMNGSHYSYSESRVEKDGLILTSRGPGTSFE
FT                   FALAIVEALVGKDMANQVKAPLVLKD"
FT   gene            3176746..3202631
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /note="gene_id=mCG1309.2"
FT   mRNA            join(3176746..3176818,3186354..3186478,3187265..3187369,
FT                   3188844..3188981,3189569..3189638,3190824..3190948,
FT                   3191959..3192093,3201310..3202631)
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, transcript variant mCT194205"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT194205.0 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3181852..3181971,3186354..3186478,3187265..3187369,
FT                   3188844..3188981,3189569..3189638,3190824..3190948,
FT                   3191959..3192093,3201310..3202631)
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, transcript variant mCT8612"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT8612.2 created on
FT                   19-MAR-2004"
FT   mRNA            join(3184082..3184618,3186354..3186478,3187265..3187369,
FT                   3188844..3188981,3189569..3189638,3190824..3190948,
FT                   3191959..3192093,3201310..3202631)
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, transcript variant mCT187772"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT187772.1 created
FT                   on 19-MAR-2004"
FT   CDS             join(3186379..3186478,3187265..3187369,3188844..3188981,
FT                   3189569..3189638,3190824..3190948,3191959..3192093,
FT                   3201310..3201407)
FT                   /codon_start=1
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, isoform CRA_a"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT187772.1
FT                   protein_id=mCP109467.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U3R1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020413"
FT                   /db_xref="MGI:MGI:1101059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3R1"
FT                   /protein_id="EDL14898.1"
FT                   /translation="MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCK
FT                   SCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKD
FT                   CRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVV
FT                   SFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIF
FT                   KQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL"
FT   CDS             join(3186379..3186478,3187265..3187369,3188844..3188981,
FT                   3189569..3189638,3190824..3190948,3191959..3192093,
FT                   3201310..3201407)
FT                   /codon_start=1
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, isoform CRA_a"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT194205.0
FT                   protein_id=mCP115234.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U3R1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020413"
FT                   /db_xref="MGI:MGI:1101059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3R1"
FT                   /protein_id="EDL14899.1"
FT                   /translation="MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCK
FT                   SCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKD
FT                   CRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVV
FT                   SFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIF
FT                   KQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL"
FT   CDS             join(3186379..3186478,3187265..3187369,3188844..3188981,
FT                   3189569..3189638,3190824..3190948,3191959..3192093,
FT                   3201310..3201407)
FT                   /codon_start=1
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, isoform CRA_a"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT8612.2
FT                   protein_id=mCP21725.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U3R1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020413"
FT                   /db_xref="MGI:MGI:1101059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3R1"
FT                   /protein_id="EDL14900.1"
FT                   /translation="MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCK
FT                   SCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKD
FT                   CRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVV
FT                   SFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIF
FT                   KQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL"
FT   gap             3219943..3219962
FT                   /estimated_length=20
FT   gap             3249312..3249331
FT                   /estimated_length=20
FT   gene            3252306..3257020
FT                   /gene="Uts2"
FT                   /locus_tag="mCG_1308"
FT                   /note="gene_id=mCG1308.1"
FT   mRNA            join(3252306..3252444,3254247..3254357,3255351..3255394,
FT                   3256777..3257020)
FT                   /gene="Uts2"
FT                   /locus_tag="mCG_1308"
FT                   /product="urotensin 2"
FT                   /note="gene_id=mCG1308.1 transcript_id=mCT8611.0 created on
FT                   27-NOV-2002"
FT   CDS             join(3252342..3252444,3254247..3254357,3255351..3255394,
FT                   3256777..3256890)
FT                   /codon_start=1
FT                   /gene="Uts2"
FT                   /locus_tag="mCG_1308"
FT                   /product="urotensin 2"
FT                   /note="gene_id=mCG1308.1 transcript_id=mCT8611.0
FT                   protein_id=mCP21716.1"
FT                   /db_xref="GOA:Q541G7"
FT                   /db_xref="InterPro:IPR001483"
FT                   /db_xref="MGI:MGI:1346329"
FT                   /db_xref="UniProtKB/TrEMBL:Q541G7"
FT                   /protein_id="EDL14901.1"
FT                   /translation="MDRVPFCCLLFIGLLNPLLSLPVTDTGERTLQLPVLEEDALRALE
FT                   ELERMALLQTLRQTMGTEAGESPGEAGPSTETPTPRGSMRKAFAGQNSNTVLSRLLART
FT                   RKQHKQHGAAPECFWKYCI"
FT   gene            complement(3259922..>3299749)
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /note="gene_id=mCG1307.1"
FT   mRNA            complement(join(3259922..3261169,3263438..3263588,
FT                   3264460..3264643,3265622..3265717,3267460..3268151,
FT                   3268761..3268988,3273118..3273285,3273437..3273552,
FT                   3274071..3274206,3279629..3279758,3280291..3280419,
FT                   3281332..3281437,3283969..3284125,3284356..3284462,
FT                   3287133..3287211,3289077..3289216,3293109..3293157,
FT                   3296467..3296668,3297836..3297951,3298719..3298864,
FT                   3299268..>3299749))
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /product="period homolog 3 (Drosophila), transcript variant
FT                   mCT190876"
FT                   /note="gene_id=mCG1307.1 transcript_id=mCT190876.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3259922..3261169,3263438..3263588,
FT                   3264460..3264643,3265615..3265717,3267460..3268151,
FT                   3268761..3268988,3273118..3273285,3273437..3273552,
FT                   3274071..3274206,3279629..3279758,3280291..3280419,
FT                   3281332..3281437,3283969..3284125,3284356..3284462,
FT                   3287133..3287211,3289077..3289216,3293109..3293157,
FT                   3296467..3296668,3297836..3297951,3298719..3298864,
FT                   3299268..3299749))
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /product="period homolog 3 (Drosophila), transcript variant
FT                   mCT8610"
FT                   /note="gene_id=mCG1307.1 transcript_id=mCT8610.2 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(3261086..3261169,3263438..3263588,
FT                   3264460..3264643,3265615..3265717,3267460..3268151,
FT                   3268761..3268988,3273118..3273285,3273437..3273552,
FT                   3274071..3274206,3279629..3279758,3280291..3280419,
FT                   3281332..3281437,3283969..3284125,3284356..3284462,
FT                   3287133..3287211,3289077..3289216,3293109..3293157,
FT                   3296467..3296668,3297836..3297951,3298719..3298864,
FT                   3299268..3299392))
FT                   /codon_start=1
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /product="period homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG1307.1 transcript_id=mCT8610.2
FT                   protein_id=mCP21697.2 isoform=CRA_b"
FT                   /protein_id="EDL14903.1"
FT                   /translation="MDPCGDPAVLGGDCPQTRGPGLQGASGQEGPLQGTCVDSSHSEHE
FT                   DRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSLGPRGA
FT                   HQADVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKS
FT                   VHFVDLLAPQDVRAFYAHTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGDREKRH
FT                   YSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFL
FT                   EVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCT
FT                   QNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAEL
FT                   QEQIHKLLLQPVHASASSGYGSLGSSGSQEQHVSITSSSESSGHCPEEGQHEQMTLQQV
FT                   YASVNKIKNVGQQLYIESMARSSVKPVAETCVEPQGGDEQKDFSSSQTLKNKSTTDTGS
FT                   GGNLQQEQPSSSYQQMNCIDSVIRYLTSYSLPALKRKCISCTNTSSSSEEAKPIPEVDS
FT                   SQRDTEQLLDIRKQETTGPSTDIEGGAARTLSTAALSVASGISQCSCSSTSGHAPPLQS
FT                   ESVAVACKPWALRTKASHLAAGGFKHVGLTAAVLSAHTQKEEQNYVDRFREKILTSPYG
FT                   CYLQQESRNRAQYSCVQAGSTAKHSRCAGSERQKHKRKKLPAPVDTSSPGAHLCPHVTG
FT                   LLPDEQHWGPSASPSPLGAGLAFPSALVVPSQTPYLLPSFPLQDMASQGVGVSAAWGAA
FT                   AGCPPLSAGPQAVAAFPSAYVDTLMTIFLHNAPLFPLWPPSFSPYPSLGAAGSSELAPL
FT                   VPAMAPNPEPTTSGHSQRRVEENWEAHSEELPFISSRSSSPLQLNLLQEEMPAPSESAD
FT                   AVRRGAGPDAKHHCVTGPSGSRSRHCTSGELATATAQQECPSAAASGSSASSIYFSSTD
FT                   YASEVSENRQRPQDRQRDEALPGAAEESIWRMIERTPECVLMTYQVPERGREEVLKQDL
FT                   EKLQSMEQQQPLFSPAQREELAKVRSWIHSHTAPQEGHLQSCVACEDRGSVGDTAEVLE
FT                   QHPAEDTS"
FT   CDS             complement(join(3264509..3264643,3265622..3265717,
FT                   3267460..3268151,3268761..3268988,3273118..3273285,
FT                   3273437..3273552,3274071..3274206,3279629..3279758,
FT                   3280291..3280419,3281332..3281437,3283969..3284125,
FT                   3284356..3284462,3287133..3287211,3289077..3289216,
FT                   3293109..3293157,3296467..3296668,3297836..3297951,
FT                   3298719..3298864,3299268..>3299407))
FT                   /codon_start=1
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /product="period homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG1307.1 transcript_id=mCT190876.0
FT                   protein_id=mCP111812.0 isoform=CRA_a"
FT                   /protein_id="EDL14902.1"
FT                   /translation="GLPGGMDPCGDPAVLGGDCPQTRGPGLQGASGQEGPLQGTCVDSS
FT                   HSEHEDRNRMSEELIMVVQEMKKYFPAERHTKPSTLDALNYALRCVHSVQANSDFFQSL
FT                   GPRGAHQADVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKR
FT                   GFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNNWTQRASQYECAPAKPFFCRICGGGD
FT                   REKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTP
FT                   GCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSP
FT                   VRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDK
FT                   DIAELQEQIHKLLLQPVHASASSGYGSLGSSGSQEQHVSITSSSESSGHCPEEGQHEQM
FT                   TLQQVYASVNKIKNVGQQLYIESMARSSVKPVAETCVEPQGGDEQKDFSSSQTLKNKST
FT                   TDTGSGGNLQQEQPSSSYQQMNCIDSVIRYLTSYSLPALKRKCISCTNTSSSSEEAKPI
FT                   PEVDSSQRDTEQLLDIRKQETTGPSTDIEGGAARTLSTAALSVASGISQCSCSSTSGHA
FT                   PPLQSESVAVACKPWALRTKASHLAAGGFKHVGLTAAVLSAHTQKEEQNYVDRFREKIL
FT                   TSPYGCYLQQESRNRAQYSCVQAGSTAKHSRCAGSERQKHKRKKLPAPVDTSSPGAHLC
FT                   PHVTGLLPDEQHWGPSASPSPLGAGLAFPSALVVPSQTPYLLPSFPLQDMASQGVGVSA
FT                   AWGAAAGCPPLSAGPQAVAAFPSAYVDTLMTIFLHNAPLFPLWPPSFSPYPSLGAAGSS
FT                   ELAPLVPAMAPNPEPTTSGHSQRRVEENWEAHSEELPFISSRSSSPLQLNLLQEEMPAP
FT                   SESADAVRRGAGPDAKHHCVTGPSGSRSRHCTSGELATATAQQECPSAAEAVPAVYTSV
FT                   ALTMLLKSLKTDRGHRIDRETKPFPGRLKSPSGE"
FT   gap             3293763..3293838
FT                   /estimated_length=76
FT   gene            complement(3302992..3313158)
FT                   /gene="Vamp3"
FT                   /locus_tag="mCG_1306"
FT                   /note="gene_id=mCG1306.2"
FT   mRNA            complement(join(3302992..3304212,3305144..3305195,
FT                   3306068..3306226,3311224..3311305,3313136..3313158))
FT                   /gene="Vamp3"
FT                   /locus_tag="mCG_1306"
FT                   /product="vesicle-associated membrane protein 3"
FT                   /note="gene_id=mCG1306.2 transcript_id=mCT8609.1 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(3304196..3304212,3305144..3305195,
FT                   3306068..3306226,3311224..3311305,3313136..3313137))
FT                   /codon_start=1
FT                   /gene="Vamp3"
FT                   /locus_tag="mCG_1306"
FT                   /product="vesicle-associated membrane protein 3"
FT                   /note="gene_id=mCG1306.2 transcript_id=mCT8609.1
FT                   protein_id=mCP21692.1"
FT                   /protein_id="EDL14904.1"
FT                   /translation="MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQ
FT                   KLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS"
FT   gene            complement(3314787..3714788)
FT                   /locus_tag="mCG_142030"
FT                   /note="gene_id=mCG142030.0"
FT   mRNA            complement(join(3314787..3318118,3331042..3331116,
FT                   3333039..3333232,3335811..3335882,3336754..3337000,
FT                   3337665..3337852,3338526..3338597,3339443..3339689,
FT                   3340349..3340536,3344339..3344862,3345225..3345540,
FT                   3346221..3346299,3346675..3346871,3349489..3349640,
FT                   3392332..3392466,3399103..3399229,3404700..3406552,
FT                   3409320..3409460,3424743..3424896,3551263..3551334,
FT                   3714625..3714788))
FT                   /locus_tag="mCG_142030"
FT                   /product="mCG142030"
FT                   /note="gene_id=mCG142030.0 transcript_id=mCT178503.0
FT                   created on 26-DEC-2002"
FT   CDS             complement(join(3318055..3318118,3331042..3331116,
FT                   3333039..3333232,3335811..3335882,3336754..3337000,
FT                   3337665..3337852,3338526..3338597,3339443..3339689,
FT                   3340349..3340536,3344339..3344862,3345225..3345540,
FT                   3346221..3346299,3346675..3346871,3349489..3349640,
FT                   3392332..3392466,3399103..3399229,3404700..3406552,
FT                   3409320..3409460,3424743..3424896,3551263..3551334,
FT                   3714625..3714744))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142030"
FT                   /product="mCG142030"
FT                   /note="gene_id=mCG142030.0 transcript_id=mCT178503.0
FT                   protein_id=mCP101425.0"
FT                   /protein_id="EDL14905.1"
FT                   /translation="MILYNRKKVKYRKDGYCWKKRKDGKTTREDHMKLKVQGVECLYGC
FT                   YVHSSIIPTFHRRCYWLLQNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWT
FT                   KEELIGQLKPMFHGIKWTCSNGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTGSLG
FT                   AGSSVHHKCNSAKHRIISPKVEPRAGGYGGHSEVQHNDVSEGKHEPSHGRSTSREKRNG
FT                   KVAKPALLHQNSTEVSSTNQVEVPDTTQSSPVSISSGLNSDPDMVDSPVVTGVSSMAVA
FT                   SVMGGLSQSATVFMSEVTNEAVYTMSPTAGPNHHLLSPDASQGLVLAVSSDGHKFAFPT
FT                   TGSSDSLSMLPANVSEELVLSTTLDGGRKIPETAMNFDPDCFLNNPKQGQTYGGGGLKA
FT                   EMVSTNIRHSPPAERSFGFTSVLTKEIKTEDTSFEQQMAKEAAYSSSAAAAASSSLTLT
FT                   AAGSSLLPSGGGLSPSTTLEQMDFSAIDSNKDYASSFSQTGHSPHIHQTPSPSFFLQDA
FT                   SKPLPLEQNTHSSLSESGAAFVMPTVKTEASSQTSSCSGHVETRIESTSSLHLMQFQAN
FT                   FQAMAAEGEVTMETSQAAEGNEVLLKSGELQACGSEHYLQPETNGVIRSAGGVPLLPSN
FT                   VVQGLYPVAQPSLGNSSNMELSLDHFDISFSNQFSDLINDFISVEGGSGTIYGHQLVSG
FT                   DSAALSQSEDGARAPFTQAEMCIPCCSPQQGSLQLSSAEGGPSTMAYMHVAEVVSAASA
FT                   QGALGMLQQSGRVFMVTDYSPEWSYPEGGVKVLITGPWQEASNNYSCLFDQISVPASLI
FT                   QPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKARALPTLPSSQHDWLSLDDNQF
FT                   RMSILERLEQMERRMAEMTGSQQHKQASGGGGSGSGSGSGAGGGQAQCASGAGTLGSCF
FT                   ESRVVVVCEKMMSRACWAKSKHLIHSKTFRGMTLLHLAAAQGYATLIQTLIKWRTKHAD
FT                   SIDLELEVDPLNVDHFSCTPLMWACALGHLEAAVVLYKWDRRAISIPDSLGRLPLGIAR
FT                   SRGHVKLAECLEHLQRDEQAQLGQASRIHCAPSEEPTTDSWMAQWQREAMSPPEIPKGV
FT                   TVIASTNPELRRPRSEPSNYYSTEGHKDYPAPKKHKLNPESFQARQEKLLCTALSLEQP
FT                   NIRKQSPRSKQPSPETISPSEGVREYSREAAPPTPETAASQASASQPVVKWSAKDLYIG
FT                   VSTVQVTGNPKGTSVVKDAAPSQVRPREPMSVLMLANREVVNTEMGAYRDRTEHEDCPQ
FT                   PMDDIQVNMMTLAEHIIEATPDRIKQENFVPMESSALERTDPATISSTMSWLASYLADA
FT                   DRLPSAAHIRSAYTEPLTPSSNASLSPAGSPVSEVAFEKPSLPSAADWSEFLSASTSEK
FT                   VESELAQLTLSDHEQRELYEAARLVQTAFRKYKGRPLREQQEVAAAVIQRCYRKYKQVN
FT                   MMTLAEHIIEATPDRIKQENFVPMESSALERTDPATISSTMSWLASYLADADRLPSAAH
FT                   IRSAYTEPLTPSSNASLSPAGSPVNEVAFEKPSLPSAADWSEFLSASTSEKVESELAQL
FT                   TLSDHEQRELYEAARLVQTAFRKYKGRPLREQQEVAAAVIQRCYRKYKQYALYKKMTQA
FT                   AILIQSKFRSYYEQKRFQQSRRAAVLIQNFYRSYKKCGRRRPARRTAVIVQQKLRSSLL
FT                   TKKQDQAARKIMRFLRRCRHRVKELKKAKELEDIQQHPLAM"
FT   gap             3327422..3327441
FT                   /estimated_length=20
FT   gap             3328629..3328648
FT                   /estimated_length=20
FT   gap             3329667..3330169
FT                   /estimated_length=503
FT   gap             3331293..3331312
FT                   /estimated_length=20
FT   gap             3332371..3332390
FT                   /estimated_length=20
FT   gap             3338032..3338051
FT                   /estimated_length=20
FT   gap             3377829..3377976
FT                   /estimated_length=148
FT   gap             3401687..3401888
FT                   /estimated_length=202
FT   gap             3406794..3407059
FT                   /estimated_length=266
FT   gap             3413488..3413558
FT                   /estimated_length=71
FT   gap             3415231..3415372
FT                   /estimated_length=142
FT   gap             3441160..3441205
FT                   /estimated_length=46
FT   gap             3443614..3443678
FT                   /estimated_length=65
FT   gap             3471542..3471576
FT                   /estimated_length=35
FT   gap             3477163..3477182
FT                   /estimated_length=20
FT   gap             3487577..3487899
FT                   /estimated_length=323
FT   gap             3488862..3489208
FT                   /estimated_length=347
FT   gap             3491018..3491190
FT                   /estimated_length=173
FT   gap             3499771..3499790
FT                   /estimated_length=20
FT   gap             3545635..3545765
FT                   /estimated_length=131
FT   gap             3560834..3560853
FT                   /estimated_length=20
FT   gap             3591930..3592090
FT                   /estimated_length=161
FT   gap             3636761..3636780
FT                   /estimated_length=20
FT   gene            3637663..3640746
FT                   /locus_tag="mCG_1027405"
FT                   /note="gene_id=mCG1027405.1"
FT   mRNA            join(3637663..3637724,3639751..3640746)
FT                   /locus_tag="mCG_1027405"
FT                   /product="mCG1027405"
FT                   /note="gene_id=mCG1027405.1 transcript_id=mCT145109.1
FT                   created on 16-DEC-2002"
FT   CDS             3640362..3640487
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027405"
FT                   /product="mCG1027405"
FT                   /note="gene_id=mCG1027405.1 transcript_id=mCT145109.1
FT                   protein_id=mCP76768.1"
FT                   /protein_id="EDL14906.1"
FT                   /translation="MVLELSRGRPSGKFHFHFRGRHLTYHSFPYESNLKILLEAW"
FT   gap             3682264..3682370
FT                   /estimated_length=107
FT   gap             3706460..3706479
FT                   /estimated_length=20
FT   gap             3710176..3710222
FT                   /estimated_length=47
FT   gap             3725297..3725316
FT                   /estimated_length=20
FT   gap             3726646..3726665
FT                   /estimated_length=20
FT   gap             3727767..3727786
FT                   /estimated_length=20
FT   gap             3729396..3729415
FT                   /estimated_length=20
FT   gap             3747044..3747554
FT                   /estimated_length=511
FT   gap             3759281..3759306
FT                   /estimated_length=26
FT   gap             3775970..3775989
FT                   /estimated_length=20
FT   gap             3782459..3782478
FT                   /estimated_length=20
FT   gap             3786404..3786423
FT                   /estimated_length=20
FT   gap             3802116..3802135
FT                   /estimated_length=20
FT   gap             3807257..3807434
FT                   /estimated_length=178
FT   gap             3814203..3815257
FT                   /estimated_length=1055
FT   gap             3837293..3837803
FT                   /estimated_length=511
FT   gap             3847424..3847580
FT                   /estimated_length=157
FT   gap             3848774..3848793
FT                   /estimated_length=20
FT   gap             3853035..3853404
FT                   /estimated_length=370
FT   gap             3854844..3854863
FT                   /estimated_length=20
FT   gap             3883777..3883842
FT                   /estimated_length=66
FT   gap             3888323..3891047
FT                   /estimated_length=2725
FT   gap             3892184..3892203
FT                   /estimated_length=20
FT   gap             3894611..3894630
FT                   /estimated_length=20
FT   gap             3906272..3906355
FT                   /estimated_length=84
FT   gap             3907323..3907508
FT                   /estimated_length=186
FT   gap             3915473..3915492
FT                   /estimated_length=20
FT   gap             3945862..3947604
FT                   /estimated_length=1743
FT   gap             3954889..3954908
FT                   /estimated_length=20
FT   gap             3956562..3957739
FT                   /estimated_length=1178
FT   gap             3969676..3969695
FT                   /estimated_length=20
FT   gene            complement(4062142..>4105909)
FT                   /locus_tag="mCG_1027353"
FT                   /note="gene_id=mCG1027353.1"
FT   mRNA            complement(join(4062142..4062297,4062348..4062431,
FT                   4100473..4100591,4105871..>4105909))
FT                   /locus_tag="mCG_1027353"
FT                   /product="mCG1027353"
FT                   /note="gene_id=mCG1027353.1 transcript_id=mCT145057.1
FT                   created on 16-DEC-2002"
FT   CDS             complement(join(4062423..4062431,4100473..4100591,
FT                   4105871..>4105907))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027353"
FT                   /product="mCG1027353"
FT                   /note="gene_id=mCG1027353.1 transcript_id=mCT145057.1
FT                   protein_id=mCP76815.1"
FT                   /protein_id="EDL14907.1"
FT                   /translation="TYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLECLPKCSSLPKER
FT                   HRWNTNERS"
FT   gap             4082030..4082138
FT                   /estimated_length=109
FT   gap             4096329..4096545
FT                   /estimated_length=217
FT   gap             4102288..4102716
FT                   /estimated_length=429
FT   gap             4115473..4130572
FT                   /estimated_length=15100
FT   gap             4155402..4156229
FT                   /estimated_length=828
FT   gap             4162710..4162729
FT                   /estimated_length=20
FT   gap             4171293..4171502
FT                   /estimated_length=210
FT   gap             4192414..4192433
FT                   /estimated_length=20
FT   gap             4198035..4198058
FT                   /estimated_length=24
FT   gene            4198202..4246364
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /note="gene_id=mCG4084.2"
FT   mRNA            join(4198202..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4234254..4234376,
FT                   4235265..4235338,4237888..4238077,4238168..4238253,
FT                   4238605..4238721,4241359..4241514,4242408..4242477,
FT                   4243681..4243738,4243853..4243995,4244327..4244456,
FT                   4245112..4246364)
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   transcript variant mCT2701"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT2701.2 created on
FT                   27-DEC-2002"
FT   mRNA            join(<4198237..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4234254..4234376,
FT                   4235265..4235338,4237888..4238077,4238168..4241093)
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   transcript variant mCT190850"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT190850.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4198248..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4237888..4238077)
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   transcript variant mCT178514"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT178514.0 created
FT                   on 27-DEC-2002"
FT   CDS             join(<4198253..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4234254..4234376,
FT                   4235265..4235338,4237888..4238077,4238168..4238257)
FT                   /codon_start=1
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT190850.0
FT                   protein_id=mCP111862.0 isoform=CRA_c"
FT                   /protein_id="EDL14910.1"
FT                   /translation="KVAKMATALSEEELDNEDYYSLLNVRREASSEELKAAYRRLCMLY
FT                   HPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYDIYGKRGLEMEGWEVVERKRTP
FT                   AEIREEFERLQREREERRLQQRTNPKGTISVGVDATDLFDRYDEEYEDVSGSGFPQIEI
FT                   NKMHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFALRRVTSAKGWGELEFGAGDL
FT                   QGPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPGLTTVLARNLDKNTVGYLQWRWGIQ
FT                   SAMNTSIVRDTKTCHFTVALQLGIPHSFALISYQHKFQDDDQTRVKGSLK"
FT   mRNA            join(<4198256..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4235265..4235338,
FT                   4237888..4238077,4238168..>4238204)
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   transcript variant mCT190849"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT190849.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4198256..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4235265..4235338,
FT                   4237888..4238077,4238168..>4238204)
FT                   /codon_start=1
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT190849.0
FT                   protein_id=mCP111861.0 isoform=CRA_b"
FT                   /protein_id="EDL14909.1"
FT                   /translation="VAKMATALSEEELDNEDYYSLLNVRREASSEELKAAYRRLCMLYH
FT                   PDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYDIYGKRGLEMEGWEVVERKRTPA
FT                   EIREEFERLQREREERRLQQRTNPKGTISVGVDATDLFDRYDEEYEDVSGSGFPQIEIN
FT                   KMHISQSIELEFGAGDLQGPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPGLTTVLAR
FT                   NLDKNTVGYLQWRWGIQSAMNTSIVRDTKTCHFTVALQLGIPHSFALISY"
FT   CDS             join(4198265..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4234254..4234376,
FT                   4235265..4235338,4237888..4238077,4238168..4238253,
FT                   4238605..4238721,4241359..4241514,4242408..4242477,
FT                   4243681..4243738,4243853..4243995,4244327..4244456,
FT                   4245112..4245137)
FT                   /codon_start=1
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT2701.2
FT                   protein_id=mCP21711.2 isoform=CRA_d"
FT                   /protein_id="EDL14911.1"
FT                   /translation="MATALSEEELDNEDYYSLLNVRREASSEELKAAYRRLCMLYHPDK
FT                   HRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYDIYGKRGLEMEGWEVVERKRTPAEIR
FT                   EEFERLQREREERRLQQRTNPKGTISVGVDATDLFDRYDEEYEDVSGSGFPQIEINKMH
FT                   ISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFALRRVTSAKGWGELEFGAGDLQGPL
FT                   FGLKLFRNLTPRCFVTTNCALQFSSRGIRPGLTTVLARNLDKNTVGYLQWRWGIQSAMN
FT                   TSIVRDTKTCHFTVALQLGIPHSFALISYQHKFQDDDQTRVKGSLKAGFFGTIVEYGAE
FT                   RKISRHSVLGAAVSIGVPQGVSLKVKLNRASQTYFFPIHLTDQLLPSAVFYATVGPLVV
FT                   YLAVHRLIIRPYLRAQKEKELEKQRENTASDILQKKQEAEAAVRLMQESVRRIIEAEES
FT                   RMGLIIVNAWYGKFVNDKSRKNEKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDP
FT                   CVGEEKSLRVLYQFRGVLHQVMVPDSEALRIPKQSHRIDTDG"
FT   CDS             join(4198265..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4237888..4238049)
FT                   /codon_start=1
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT178514.0
FT                   protein_id=mCP101436.0 isoform=CRA_a"
FT                   /protein_id="EDL14908.1"
FT                   /translation="MATALSEEELDNEDYYSLLNVRREASSEELKAAYRRLCMLYHPDK
FT                   HRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYDIYGKRGLEMEGWEVVERKRTPAEIR
FT                   EEFERLQREREERRLQQRTNPKLCDDKLCSAVFIPWDPAWPDHCASSEPGQEHCGLPAV
FT                   ALGYPVSHEHQHRPGH"
FT   gap             4198395..4198777
FT                   /estimated_length=383
FT   gap             4202712..4202731
FT                   /estimated_length=20
FT   gap             4210548..4210621
FT                   /estimated_length=74
FT   gene            complement(4247045..4253462)
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /note="gene_id=mCG4089.2"
FT   mRNA            complement(join(4247045..4247761,4248044..4248145,
FT                   4250078..4250270,4253242..4253462))
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /product="THAP domain containing, apoptosis associated
FT                   protein 3, transcript variant mCT2682"
FT                   /note="gene_id=mCG4089.2 transcript_id=mCT2682.2 created on
FT                   20-DEC-2002"
FT   mRNA            complement(join(4247048..4247761,4250078..4250270,
FT                   4253242..>4253330))
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /product="THAP domain containing, apoptosis associated
FT                   protein 3, transcript variant mCT190861"
FT                   /note="gene_id=mCG4089.2 transcript_id=mCT190861.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(4247474..4247761,4250078..4250270,
FT                   4253242..>4253330))
FT                   /codon_start=1
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /product="THAP domain containing, apoptosis associated
FT                   protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG4089.2 transcript_id=mCT190861.0
FT                   protein_id=mCP111864.0 isoform=CRA_a"
FT                   /protein_id="EDL14912.1"
FT                   /translation="GPISEMPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLREWVLN
FT                   IGRADFKPKQHTVICSEHFRPECFSAFGNRKNLKHNAVPTVFAFQNPTEVLPDREAMEA
FT                   TEAAGLPASPLGLKRPLPGQPSDHSYALSDLDTLKKKLFLTLKENKRLRKRLKAQRLLL
FT                   RRTCGRLRAYREGQPGPRARRPAQGS"
FT   CDS             complement(join(4247474..4247761,4248044..4248145,
FT                   4250078..4250270,4253242..4253315))
FT                   /codon_start=1
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /product="THAP domain containing, apoptosis associated
FT                   protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG4089.2 transcript_id=mCT2682.2
FT                   protein_id=mCP21742.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q52KE1"
FT                   /db_xref="InterPro:IPR006612"
FT                   /db_xref="InterPro:IPR026520"
FT                   /db_xref="MGI:MGI:1917126"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KE1"
FT                   /protein_id="EDL14913.1"
FT                   /translation="MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLREWVLNIGRAD
FT                   FKPKQHTVICSEHFRPECFSAFGNRKNLKHNAVPTVFAFQNPTEVCPEVGAGGDSSGRN
FT                   MDTTLEELQPPTPEGPVQQVLPDREAMEATEAAGLPASPLGLKRPLPGQPSDHSYALSD
FT                   LDTLKKKLFLTLKENKRLRKRLKAQRLLLRRTCGRLRAYREGQPGPRARRPAQGS"
FT   gap             4251938..4251957
FT                   /estimated_length=20
FT   gap             4255859..4255878
FT                   /estimated_length=20
FT   gene            complement(4255879..>4260595)
FT                   /gene="Phf13"
FT                   /locus_tag="mCG_4082"
FT                   /note="gene_id=mCG4082.2"
FT   mRNA            complement(join(4255879..4256188,4256479..4257001,
FT                   4258399..4258500,4260260..>4260595))
FT                   /gene="Phf13"
FT                   /locus_tag="mCG_4082"
FT                   /product="PHD finger protein 13"
FT                   /note="gene_id=mCG4082.2 transcript_id=mCT2727.2 created on
FT                   25-APR-2003"
FT   CDS             complement(join(4255962..4256188,4256479..4257001,
FT                   4258399..>4258500))
FT                   /codon_start=1
FT                   /gene="Phf13"
FT                   /locus_tag="mCG_4082"
FT                   /product="PHD finger protein 13"
FT                   /note="gene_id=mCG4082.2 transcript_id=mCT2727.2
FT                   protein_id=mCP21708.2"
FT                   /protein_id="EDL14914.1"
FT                   /translation="EYSPTCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPA
FT                   NSTAGTIDSDGWDTGFSDITPSVPDRCFSHLQPSLLQRAKPSNYLLDRKTTDKLKKKKR
FT                   RKRRDSDIPVKEGFRESLLKLEAADPYVETPSSPTMQDIPQASADPCSGWDSDTPSSGS
FT                   CATVSPDQVTEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMK
FT                   PFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSKFDIRRSNRSRMGSRKLF
FT                   LD"
FT   gap             4259551..4260257
FT                   /estimated_length=707
FT   gap             4263548..4263699
FT                   /estimated_length=152
FT   gap             4266141..4266160
FT                   /estimated_length=20
FT   gap             4269423..4269442
FT                   /estimated_length=20
FT   gene            complement(4272288..4275150)
FT                   /locus_tag="mCG_147513"
FT                   /note="gene_id=mCG147513.0"
FT   mRNA            complement(4272288..4275150)
FT                   /locus_tag="mCG_147513"
FT                   /product="mCG147513"
FT                   /note="gene_id=mCG147513.0 transcript_id=mCT187776.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(4274243..4274473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147513"
FT                   /product="mCG147513"
FT                   /note="gene_id=mCG147513.0 transcript_id=mCT187776.0
FT                   protein_id=mCP109472.0"
FT                   /protein_id="EDL14915.1"
FT                   /translation="MTRSCGSQGRPSASGTASINTQTSRSLRGRGLLGRSASNLAHLTL
FT                   LFPALRSESQPPTPAPFLPSGGSSRLQLTLR"
FT   gene            <4274472..4283207
FT                   /locus_tag="mCG_4080"
FT                   /note="gene_id=mCG4080.2"
FT   mRNA            join(<4274472..4275492,4277829..4278234,4279836..4279908,
FT                   4280864..4283207)
FT                   /locus_tag="mCG_4080"
FT                   /product="mCG4080"
FT                   /note="gene_id=mCG4080.2 transcript_id=mCT2732.2 created on
FT                   20-DEC-2002"
FT   CDS             join(4274472..4275492,4277829..4278234,4279836..4279908,
FT                   4280864..4281157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4080"
FT                   /product="mCG4080"
FT                   /note="gene_id=mCG4080.2 transcript_id=mCT2732.2
FT                   protein_id=mCP21765.2"
FT                   /db_xref="GOA:Q3U410"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR011705"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR015916"
FT                   /db_xref="InterPro:IPR017096"
FT                   /db_xref="MGI:MGI:1919288"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3U410"
FT                   /protein_id="EDL14916.1"
FT                   /translation="MERPAPLAVLPFSDPAHALSLLRGLSQLRAERKFLDVTLEAAGGR
FT                   DFPAHRAVLAAASPYFRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSYTGRVAVSGD
FT                   NAEPLLRAADLLQFPAVKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILR
FT                   HVGELGAEQLERLPLARLLRYLRDDGLCVPKEEAAYQLALRWVRADPPRRAPHWPQLLE
FT                   AVRLPFVRRFYLLAHVEAEPLVARCPPCLRLLREARDFQAARYDRHDRGPCPRMRPRPS
FT                   TGLAEILVLVGGCDQDCDELVTVDCYNPQTGQWRYLAEFPDHLGGGYSIVALGNDIYVT
FT                   GGSDGSRLYDCVWRYNSSVNEWTEVAPMLKAREYHSSSVLDGLLYVVAADSTERYDHAT
FT                   DSWEALQPMTYPMDNCSTTACRGRLYAIGSLAGKETMVIQCYDPDTDLWSLVNCGQLPP
FT                   WSFAPKTVTLNGLMYFVRDDSAEVDVYNPTKDEWDKIPSMNQVHVGGSLAVLGGKLYVS
FT                   GGYDNTFELSDVVEAYDPETRAWSVVGRLPEPTFWHGSVSIFRQFMPQTPAGGRGFELN
FT                   SGSNDVDAGYHRLPQNPEELH"
FT   gene            complement(4285302..>4293433)
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /note="gene_id=mCG4092.3"
FT   mRNA            complement(join(4285302..4285649,4285719..4285807,
FT                   4286073..4286237,4286308..4286444,4286818..4286972,
FT                   4287071..4287157,4287556..4287648,4288225..4288336,
FT                   4291539..4291780,4292149..4292820,4293304..4293420))
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, transcript
FT                   variant mCT2665"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT2665.1 created on
FT                   02-DEC-2002"
FT   mRNA            complement(join(4285303..4285649,4285719..4285807,
FT                   4286073..4286233,4286308..4286444,4286818..4287157,
FT                   4287556..4287648,4288225..4288336,4291539..4291780,
FT                   4292149..4292820,4293304..4293422))
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, transcript
FT                   variant mCT176829"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT176829.0 created
FT                   on 02-DEC-2002"
FT   mRNA            complement(join(4285304..4285649,4285719..4285807,
FT                   4286073..4286237,4286308..4286444,4286818..4286972,
FT                   4287071..4287157,4287556..4287763,4288225..4288336,
FT                   4291539..4292820,4293304..>4293433))
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, transcript
FT                   variant mCT190889"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT190889.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(4285353..4285649,4285719..4285807,
FT                   4286073..4286237,4286308..4286444,4286818..4286972,
FT                   4287071..4287157,4287556..4287648,4288225..4288336,
FT                   4291539..4291780,4292149..4292817))
FT                   /codon_start=1
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, isoform CRA_b"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT2665.1
FT                   protein_id=mCP21755.2 isoform=CRA_b"
FT                   /protein_id="EDL14918.1"
FT                   /translation="MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLA
FT                   CCSHFFQRIYGDGTGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAAKELRV
FT                   PEAVELCQSFQPQTSVGQAQSGLGQPASQDVKSHLKEPTDLDEEEVFRTLSLASVDQEP
FT                   RDTEQPQLGTPAQSTTAFLCGKLTQALKPSPSEDKESEDCKEPPRPFEAGGAPLQGESN
FT                   EWEVVVQVEDDRDGDYVSEPETVLTRRKSKVIRKPCAAEPALGAGSLTAEPTDSRKGAA
FT                   VPVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSE
FT                   QVFTCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKP
FT                   HACPTCAKCFLSRTELQLHEAFKHRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPY
FT                   VCEFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCE
FT                   FCEQRFTEKGPLLRHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTEC
FT                   GYKFTRQAHLRRHMEIHDRVENYNPRQRKLRNLIIEDEKMVVVALQPPADLEVGSAEVI
FT                   VESLTQGGLASQLPSQRLCSEESFASPGVLEPSLIITAAVPEDCDT"
FT   CDS             complement(join(4285353..4285649,4285719..4285807,
FT                   4286073..4286237,4286308..4286444,4286818..4286972,
FT                   4287071..4287157,4287556..4287763,4288225..>4288238))
FT                   /codon_start=1
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, isoform CRA_a"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT190889.0
FT                   protein_id=mCP111865.0 isoform=CRA_a"
FT                   /protein_id="EDL14917.1"
FT                   /translation="TAQNSIPYPRQTLTSSVWKPLQRLPSQAEALPDAGPACPSHCQVF
FT                   TCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHAC
FT                   PTCAKCFLSRTELQLHEAFKHRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPYVCE
FT                   FCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEFCE
FT                   QRFTEKGPLLRHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYK
FT                   FTRQAHLRRHMEIHDRVENYNPRQRKLRNLIIEDEKMVVVALQPPADLEVGSAEVIVES
FT                   LTQGGLASQLPSQRLCSEESFASPGVLEPSLIITAAVPEDCDT"
FT   CDS             complement(join(4286183..4286233,4286308..4286444,
FT                   4286818..4287157,4287556..4287648,4288225..4288336,
FT                   4291539..4291780,4292149..4292817))
FT                   /codon_start=1
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, isoform CRA_c"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT176829.0
FT                   protein_id=mCP99751.0 isoform=CRA_c"
FT                   /protein_id="EDL14919.1"
FT                   /translation="MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLA
FT                   CCSHFFQRIYGDGTGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAAKELRV
FT                   PEAVELCQSFQPQTSVGQAQSGLGQPASQDVKSHLKEPTDLDEEEVFRTLSLASVDQEP
FT                   RDTEQPQLGTPAQSTTAFLCGKLTQALKPSPSEDKESEDCKEPPRPFEAGGAPLQGESN
FT                   EWEVVVQVEDDRDGDYVSEPETVLTRRKSKVIRKPCAAEPALGAGSLTAEPTDSRKGAA
FT                   VPVECPTCHKKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSE
FT                   QVFTCSVCQETFRRRMELRLHMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLHGAPKP
FT                   HAVSASQGWGSGGSGTAQSCPHLDVLPLPVSPTCSAPLVPSASCLGRSYSCTRLLSIVE
FT                   KSSLCVRNAGTGPRAATDCRCTSRPSTGMKGLMSVSSAAMPSPRRPTSTCTCAHTPARS
FT                   LSSATSVGRPSAPKFGQAQPHPHGREAFQL"
FT   gene            complement(4293675..4304337)
FT                   /gene="Tas1r1"
FT                   /locus_tag="mCG_4091"
FT                   /note="gene_id=mCG4091.1"
FT   mRNA            complement(join(4293675..4294758,4296544..4296664,
FT                   4297081..4297293,4297673..4298434,4300370..4300676,
FT                   4303962..4304337))
FT                   /gene="Tas1r1"
FT                   /locus_tag="mCG_4091"
FT                   /product="taste receptor, type 1, member 1"
FT                   /note="gene_id=mCG4091.1 transcript_id=mCT2666.1 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(4293827..4294758,4296544..4296664,
FT                   4297081..4297293,4297673..4298434,4300370..4300676,
FT                   4303962..4304155))
FT                   /codon_start=1
FT                   /gene="Tas1r1"
FT                   /locus_tag="mCG_4091"
FT                   /product="taste receptor, type 1, member 1"
FT                   /note="gene_id=mCG4091.1 transcript_id=mCT2666.1
FT                   protein_id=mCP21752.2"
FT                   /db_xref="GOA:Q3U5H1"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1927505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U5H1"
FT                   /protein_id="EDL14920.1"
FT                   /translation="MLFWAAHLLLSLQLAVAYCWAFSCQRTESSPGFSLPGDFLLAGLF
FT                   SLHADCLQVRHRPLVTSCDRSDSFNGHGYHLFQAMRFTVEEINNSTALLPNITLGYELY
FT                   DVCSESSNVYATLRVLAQQGTGHLEMQRDLRNHSSKVVALIGPDNTDHAVTTAALLSPF
FT                   LMPLVSYEASSVILSGKRKFPSFLRTIPSDKYQVEVIVRLLQSFGWVWISLVGSYGDYG
FT                   QLGVQALEELATPRGICVAFKDVVPLSAQAGDPRMQRMMLRLARARTTVVVVFSNRHLA
FT                   GVFFRSVVLANLTGKVWIASEDWAISTYITNVPGIQGIGTVLGVAIQQRQVPGLKEFEE
FT                   SYVQAVMGAPRTCPEGSWCGTNQLCRECHAFTTWNMPELGAFSMSAAYNVYEAVYAVAH
FT                   GLHQLLGCTSGTCARGPVYPWQLLQQIYKVNFLLHKKTVAFDDKGDPLGYYDIIAWDWN
FT                   GPEWTFEVIGSASLSPVHLDINKTKIQWHGKNNQVPVSVCTRDCLEGHHRLVMGSHHCC
FT                   FECMPCEAGTFLNTSELHTCQPCGTEEWAPEGSSACFSRTVEFLGWHEPISLVLLAANT
FT                   LLLLLLIGTAGLFAWRLHTPVVRSAGGRLCFLMLGSLVAGSCSLYSFFGKPTVPACLLR
FT                   QPLFSLGFAIFLSCLTIRSFQLVIIFKFSTKVPTFYHTWAQNHGAGIFVIVSSTVHLFL
FT                   CLTWLAMWTPRPTREYQRFPHLVILECTEVNSVGFLVAFAHNILLSISTFVCSYLGKEL
FT                   PENYNEAKCVTFSLLLHFVSWIAFFTMSSIYQGSYLPAVNVLAGLATLSGGFSGYFLPK
FT                   CYVILCRPELNNTEHFQASIQDYTRRCGTT"
FT   gap             4295149..4295197
FT                   /estimated_length=49
FT   gap             4302161..4302336
FT                   /estimated_length=176
FT   gene            4305089..4327198
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /note="gene_id=mCG4087.2"
FT   mRNA            join(4305089..4305577,4306817..4307036,4307287..4307414,
FT                   4311465..4311600,4311718..4311805,4312317..4312414,
FT                   4316305..4316466,4317528..4317828,4318368..4318479,
FT                   4321675..4321852,4323495..4323628,4326957..4327198)
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /product="nucleolar protein 9, transcript variant mCT2684"
FT                   /note="gene_id=mCG4087.2 transcript_id=mCT2684.2 created on
FT                   02-DEC-2002"
FT   CDS             join(4305125..4305577,4306817..4307036,4307287..4307414,
FT                   4311465..4311600,4311718..4311805,4312317..4312414,
FT                   4316305..4316466,4317528..4317828,4318368..4318479,
FT                   4321675..4321852,4323495..4323628,4326957..4326962)
FT                   /codon_start=1
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /product="nucleolar protein 9, isoform CRA_b"
FT                   /note="gene_id=mCG4087.2 transcript_id=mCT2684.2
FT                   protein_id=mCP21713.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TZX8"
FT                   /db_xref="InterPro:IPR010655"
FT                   /db_xref="MGI:MGI:1921285"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TZX8"
FT                   /protein_id="EDL14922.1"
FT                   /translation="MAESEVLHRRAPSRSSWLRVRKARPHLLLSRRGRRRFGVLTRVEL
FT                   RRLRRRLLRAHALGGDWKQVAPAGAHVAVKCKLRARSRPAPRSPPTPSVPPAPCTASAT
FT                   CSLLNPRNHSTPQSRAGRPVRKVSPNVTQPVRDLGSGRVLMMLPPGEGFTFSGICRVTC
FT                   VYGQLEVYGHIINQGQPPQDVFSVYTHSYLTINGVPYAEPEKSEKAIRREIRALLKPYT
FT                   KLDDRNWVVRYFPPLGSIMILERMQSRFVDFLKTYKCSSYVLLQENAPVRVNSEFTTLK
FT                   KIGIRRQKRKKAICLSESGLCALEELVSVSCDGCPVILLCGACDIGKSTFNRILINQLL
FT                   NSIPGVDYLECDLGQTEFTPPGCVALLTITEPLLGPPYTHQRKPQRMVYYGKMNCYNDY
FT                   ENYIDIVKYVFRDYKREFPLIINTMGWVSDNGLRLLVDLIRVLSPNYVVQLYSDRCKFT
FT                   PTLTSEYVELTDGLYTKSKIKRYRGFEIPEFGDNLEFTYEEKESSPLPVFTGHVLLSVH
FT                   SEFLSSKNEKNRAKYNRIFRDLAVLGYLSQLMLPVPESLSPLHSLTPYQVPFSAVAIRV
FT                   LHADVAPTHILYAVNASWVGLCRIVDDMKGYTRGPILLAQNPICDCLGFGICRGIDMDK
FT                   RTYHILTPLPPEELKTVNCLLVGSISIPHCIFQNQL"
FT   mRNA            join(<4305133..4305577,4306817..4307036,4307287..4307414,
FT                   4311465..4311600,4312317..4312414,4316305..4316466,
FT                   4317528..4317828,4318368..4318479,4321675..4321852,
FT                   4323495..4323628,4324045..4325728)
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /product="nucleolar protein 9, transcript variant
FT                   mCT190857"
FT                   /note="gene_id=mCG4087.2 transcript_id=mCT190857.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4311557..4311600,4312317..4312414,4316305..4316466,
FT                   4317528..4317828,4318368..4318479,4321675..4321852,
FT                   4323495..4323628,4324045..4324179)
FT                   /codon_start=1
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /product="nucleolar protein 9, isoform CRA_a"
FT                   /note="gene_id=mCG4087.2 transcript_id=mCT190857.0
FT                   protein_id=mCP111863.0 isoform=CRA_a"
FT                   /protein_id="EDL14921.1"
FT                   /translation="EWPLCPGRVSQRVLCIPGVDYLECDLGQTEFTPPGCVALLTITEP
FT                   LLGPPYTHQRKPQRMVYYGKMNCYNDYENYIDIVKYVFRDYKREFPLIINTMGWVSDNG
FT                   LRLLVDLIRVLSPNYVVQLYSDRCKFTPTLTSEYVELTDGLYTKSKIKRYRGFEIPEFG
FT                   DNLEFTYEEKESSPLPVFTGHVLLSVHSEFLSSKNEKNRAKYNRIFRDLAVLGYLSQLM
FT                   LPVPESLSPLHSLTPYQVPFSAVAIRVLHADVAPTHILYAVNASWVGLCRIVDDMKGYT
FT                   RGPILLAQNPICDCLGFGICRGIDMDKRTYHILTPLPPEELKTVNCLLVGSISIPHCIF
FT                   QNQPGPEGSVPYVTTDYNLNIPGATEKIGEREYGKAFPRHKLRQRRK"
FT   gap             4320524..4321003
FT                   /estimated_length=480
FT   gap             4322947..4323055
FT                   /estimated_length=109
FT   gap             4329676..4329712
FT                   /estimated_length=37
FT   gap             4338734..4339144
FT                   /estimated_length=411
FT   gap             4346581..4346642
FT                   /estimated_length=62
FT   gap             4352456..4352863
FT                   /estimated_length=408
FT   gap             4363660..4363679
FT                   /estimated_length=20
FT   gene            <4374351..4381300
FT                   /gene="Plekhg5"
FT                   /locus_tag="mCG_145231"
FT                   /note="gene_id=mCG145231.0"
FT   mRNA            join(<4374351..4374455,4374593..4374712,4378023..4378155,
FT                   4378238..4378353,4378434..4378615,4379713..4380483,
FT                   4380745..4381300)
FT                   /gene="Plekhg5"
FT                   /locus_tag="mCG_145231"
FT                   /product="pleckstrin homology domain containing, family G
FT                   (with RhoGef domain) member 5"
FT                   /note="gene_id=mCG145231.0 transcript_id=mCT184655.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4374351..4374455,4374593..4374712,4378023..4378155,
FT                   4378238..4378353,4378434..4378615,4379713..4380483,
FT                   4380745..4380754)
FT                   /codon_start=1
FT                   /gene="Plekhg5"
FT                   /locus_tag="mCG_145231"
FT                   /product="pleckstrin homology domain containing, family G
FT                   (with RhoGef domain) member 5"
FT                   /note="gene_id=mCG145231.0 transcript_id=mCT184655.0
FT                   protein_id=mCP105932.0"
FT                   /protein_id="EDL14923.1"
FT                   /translation="NTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFLHLDL
FT                   TAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERTKVIRP
FT                   PLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASSQALCRSWVDTIYNAQNQLQQ
FT                   LRAQLSAQEHPGSQHLQSLEEEEDEQEEEGEESGTSAASSPTILRKSSNSLDSEHCTSD
FT                   GSTETLAMVVVEPGATLSSPEFEGGPVSSQSDESSLSNTASSVTPTSELLPLGPVDGRS
FT                   CSMDSAYGTLSPTSLQDFVAPHPVVEPAPVPQTPSPQPSPRLRRRTPVQLLPRPPRLLK
FT                   SKSEASLLQLLSGTPAARGVPPAPSRSLSELCLISVAPGVRTQRPLQEGGPGWNGPGMC
FT                   DPCHGPQLSESENRPSHMTGGPADSARRRCREMPSGTMSRVQSEPPSGVSAQHRKLTLA
FT                   QLYRIRTTLLLNSTLTASEV"
FT   gene            4381849..4386034
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /note="gene_id=mCG4090.2"
FT   mRNA            join(4381849..4382029,4382500..4382638,4382846..4382980,
FT                   4383293..4383457,4383555..4383609,4384162..4384217,
FT                   4384316..4384414,4384605..4384642,4385075..4385258,
FT                   4385426..4386034)
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 25, transcript variant mCT2672"
FT                   /note="gene_id=mCG4090.2 transcript_id=mCT2672.2 created on
FT                   03-DEC-2002"
FT   CDS             join(4381994..4382029,4382500..4382638,4382846..4382980,
FT                   4383293..4383457,4383555..4383609,4384162..4384217,
FT                   4384316..4384414,4384605..4384642,4385075..4385258,
FT                   4385426..4385754)
FT                   /codon_start=1
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 25, isoform CRA_b"
FT                   /note="gene_id=mCG4090.2 transcript_id=mCT2672.2
FT                   protein_id=mCP21748.1 isoform=CRA_b"
FT                   /db_xref="GOA:B1AWN9"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR022329"
FT                   /db_xref="MGI:MGI:1934667"
FT                   /db_xref="UniProtKB/TrEMBL:B1AWN9"
FT                   /protein_id="EDL14925.1"
FT                   /translation="MEARLLRGCVVEPLFLPLLLLLLLLLGGQGQGGMSGRCDCASESQ
FT                   KRYGPFCCRGCPKGHYMKAPCAEPCGNSTCLPCPSDTFLTRDNHFKTDCTRCQVCDEEA
FT                   LQVTLENCSAKSDTHCGCQSGWCVDCSTEPCGKSSPFSCVPCGATTPVHEAPTPRPCLP
FT                   GFYIRGNDCTSCPTGFSSVCPKACTAVCGWKQMFWVQVLLGVAFLFGAILICAYCRWQP
FT                   CKAVVTADTAGTETLASPQTAHLSASDSAHTLLAPPSSTGKICTTVQLVGNNWTPGLSQ
FT                   TQEVVCGQASQPWDQLPNRTLGTPLASPLSPAPPAGSPAAVLQPGPQLYDVMDAVPARR
FT                   WKEFVRTLGLREAEIEAVEVEICRFRDQQYEMLKRWRQQQPAGLGAIYAALERMGLEGC
FT                   AEDLRSRLQRGP"
FT   mRNA            join(4382258..4382638,4382846..4382980,4383293..4383457,
FT                   4384316..4384414,4384605..4384642,4385075..4385258,
FT                   4385426..4386019)
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 25, transcript variant mCT176828"
FT                   /note="gene_id=mCG4090.2 transcript_id=mCT176828.0 created
FT                   on 03-DEC-2002"
FT   CDS             join(4382425..4382638,4382846..4382980,4383293..4383457,
FT                   4384316..4384414,4384605..4384642,4385075..4385258,
FT                   4385426..4385754)
FT                   /codon_start=1
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 25, isoform CRA_a"
FT                   /note="gene_id=mCG4090.2 transcript_id=mCT176828.0
FT                   protein_id=mCP99750.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VD70"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR022329"
FT                   /db_xref="MGI:MGI:1934667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VD70"
FT                   /protein_id="EDL14924.1"
FT                   /translation="MEELPRRERSPPGAATPGSTARVLQPLFLPLLLLLLLLLGGQGQG
FT                   GMSGRCDCASESQKRYGPFCCRGCPKGHYMKAPCAEPCGNSTCLPCPSDTFLTRDNHFK
FT                   TDCTRCQVCDEEALQVTLENCSAKSDTHCGCQSGWCVDCSTEPCGKSSPFSCVPCGATT
FT                   PVHEAPTPLFWVQVLLGVAFLFGAILICAYCRWQPCKAVVTADTAGTETLASPQTAHLS
FT                   ASDSAHTLLAPPSSTGKICTTVQLVGNNWTPGLSQTQEVVCGQASQPWDQLPNRTLGTP
FT                   LASPLSPAPPAGSPAAVLQPGPQLYDVMDAVPARRWKEFVRTLGLREAEIEAVEVEICR
FT                   FRDQQYEMLKRWRQQQPAGLGAIYAALERMGLEGCAEDLRSRLQRGP"
FT   gene            complement(<4387036..4401633)
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /note="gene_id=mCG4085.2"
FT   mRNA            complement(join(<4387036..4387180,4389532..4389543,
FT                   4389629..4389708,4393982..4394245,4394321..4394466,
FT                   4396686..4396878,4396969..4397211,4400078..4400391,
FT                   4401432..4401633))
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /product="espin, transcript variant mCT176827"
FT                   /note="gene_id=mCG4085.2 transcript_id=mCT176827.0 created
FT                   on 05-DEC-2002"
FT   CDS             complement(join(4387036..4387180,4389532..4389543,
FT                   4389629..4389708,4393982..4394245,4394321..4394466,
FT                   4396686..4396878,4396969..4397211,4400078..4400391,
FT                   4401432..4401597))
FT                   /codon_start=1
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /product="espin, isoform CRA_a"
FT                   /note="gene_id=mCG4085.2 transcript_id=mCT176827.0
FT                   protein_id=mCP99749.0 isoform=CRA_a"
FT                   /protein_id="EDL14926.1"
FT                   /translation="MDLEAKQLDSGMSSPNTTMSVQPMTFDLGSPTSTFSNYDSCSSSH
FT                   SSSKGQRSNRGARAADLQSYMDMLNPEKSLPRGKLGKPSPPPPSTTTTTKLPSPPPPPP
FT                   PPPPSFPPPPPPTGTQPPPPSPGYPAPNPPVGLHLNNIYMQTKNKLRHVEVDSLKEPSS
FT                   GDGHSGLHRQDSGLLRQDSELLHRQELLRHSTGLRRQDSDRKQRSFSKQPSTGDYYRQL
FT                   GRSPGEPLAARPGMAHSEEAALLPGNHVHNGCSADSKASRELPPPPPPPPLPEALSSPP
FT                   PAPPLPIEGAGAACGQRRSSSSTGSTKSFNMMSPTGDNSELLAEIKAGKSLKPTPQSKG
FT                   LTTVFSGSGQPASQPESPQPLVSPAPSRARSPTPPASGSQPLLNGSVVPAPPATPAPGV
FT                   HLDVEALIPTLDEQGRPIPEWKRQVMVRKLQQKMQEEEEQRRKEEEEEARLASLPAWRR
FT                   DILRKKLEEEREQKRKEEERQKLEEIQRAKEQSEKLRTLGYDEAKLAPWQRQVILKKGE
FT                   IPK"
FT   mRNA            complement(join(<4387036..4387180,4389532..4389543,
FT                   4389629..4389708,4393982..4394466,4394683..>4394722))
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /product="espin, transcript variant mCT2704"
FT                   /note="gene_id=mCG4085.2 transcript_id=mCT2704.2 created on
FT                   05-DEC-2002"
FT   CDS             complement(join(4387036..4387180,4389532..4389543,
FT                   4389629..4389708,4393982..4394466,4394683..4394722))
FT                   /codon_start=1
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /product="espin, isoform CRA_b"
FT                   /note="gene_id=mCG4085.2 transcript_id=mCT2704.2
FT                   protein_id=mCP21710.2 isoform=CRA_b"
FT                   /protein_id="EDL14927.1"
FT                   /translation="MNSQGPLGGGRIPSTKSFNMMSPTGDNSELLAEIKAGKSLKPTPQ
FT                   SKGLTTVFSGSGQPASQVGTGRVPRPGSQCLPSAQPYCFSRQPESPQPLVSPAPSRARS
FT                   PTPPASGSQPLLNGSVVPAPPATPAPGVHLDVEALIPTLDEQGRPIPEWKRQVMVRKLQ
FT                   QKMQEEEEQRRKEEEEEARLASLPAWRRDILRKKLEEEREQKRKEEERQKLEEIQRAKE
FT                   QSEKLRTLGYDEAKLAPWQRQVILKKGEIPK"
FT   gap             4407488..4408831
FT                   /estimated_length=1344
FT   gap             4409338..4410273
FT                   /estimated_length=936
FT   gene            4421740..4423252
FT                   /pseudo
FT                   /locus_tag="mCG_131423"
FT                   /note="gene_id=mCG131423.0"
FT   mRNA            join(4421740..4421814,4422049..4422403,4422610..4423252)
FT                   /pseudo
FT                   /locus_tag="mCG_131423"
FT                   /note="gene_id=mCG131423.0 transcript_id=mCT132758.0
FT                   created on 27-DEC-2002"
FT   gene            4424559..>4426239
FT                   /gene="Hes2"
FT                   /locus_tag="mCG_4081"
FT                   /note="gene_id=mCG4081.2"
FT   mRNA            join(4424559..4424680,4425356..4425403,4425495..4425590,
FT                   4425819..4425918,4426007..>4426239)
FT                   /gene="Hes2"
FT                   /locus_tag="mCG_4081"
FT                   /product="hairy and enhancer of split 2 (Drosophila)"
FT                   /note="gene_id=mCG4081.2 transcript_id=mCT2726.1 created on
FT                   06-DEC-2002"
FT   CDS             join(4425359..4425403,4425495..4425590,4425819..4425918,
FT                   4426007..4426239)
FT                   /codon_start=1
FT                   /gene="Hes2"
FT                   /locus_tag="mCG_4081"
FT                   /product="hairy and enhancer of split 2 (Drosophila)"
FT                   /note="gene_id=mCG4081.2 transcript_id=mCT2726.1
FT                   protein_id=mCP21701.0"
FT                   /db_xref="GOA:O54792"
FT                   /db_xref="InterPro:IPR003650"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:1098624"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54792"
FT                   /protein_id="EDL14928.1"
FT                   /translation="MRLPRRVEDAAELRKNLKPLLEKRRRARINESLSQLKGLVLPLLG
FT                   AETSRSSKLEKADILEMTVRFLQEQPATLYSSAAPGPLNSYLEGYRACLARLARVLPAC
FT                   SVLEPAVSARLLEHLRQRTVSDDSPSLTLPPAPAPAPSPPVPPPGSSGLWRPW"
FT   gene            4443824..4538100
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /note="gene_id=mCG12307.2"
FT   mRNA            join(4443824..4444030,4472195..4472312,4483959..4484115,
FT                   4489294..4489385,4495990..4496104,4503937..4504023,
FT                   4519393..4519509,4527091..4527275,4537721..4538100)
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /product="acyl-CoA thioesterase 7, transcript variant
FT                   mCT15578"
FT                   /note="gene_id=mCG12307.2 transcript_id=mCT15578.2 created
FT                   on 06-DEC-2002"
FT   CDS             join(4443861..4444030,4472195..4472312,4483959..4484115,
FT                   4489294..4489385,4495990..4496104,4503937..4504023,
FT                   4519393..4519509,4527091..4527275,4537721..4537819)
FT                   /codon_start=1
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /product="acyl-CoA thioesterase 7, isoform CRA_a"
FT                   /note="gene_id=mCG12307.2 transcript_id=mCT15578.2
FT                   protein_id=mCP21695.2 isoform=CRA_a"
FT                   /protein_id="EDL14929.1"
FT                   /translation="MAPPLPSSSMAPPRLIHSGTGLLDTCSQIPPPPPSSAVAAKMSGP
FT                   TTDTPAAIQICRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALA
FT                   RVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQVHVMSENILTGTKKLTNKATLWYVP
FT                   LSLKNVDKVLEVPPIVYLRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEPNTV
FT                   SYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHD
FT                   KIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDNSQKRYRAASAFFTYVSLNQEGKP
FT                   MPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHTEPQP"
FT   mRNA            join(<4451896..4452075,4472195..4472312,4483959..4484115,
FT                   4489294..4489385,4495990..4496104,4503937..4504023,
FT                   4519393..4519509,4527091..4527275,4537721..4538094)
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /product="acyl-CoA thioesterase 7, transcript variant
FT                   mCT190855"
FT                   /note="gene_id=mCG12307.2 transcript_id=mCT190855.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4451897..4452075,4472195..4472312,4483959..4484115,
FT                   4489294..4489385,4495990..4496104,4503937..4504023,
FT                   4519393..4519509,4527091..4527275,4537721..4537819)
FT                   /codon_start=1
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /product="acyl-CoA thioesterase 7, isoform CRA_b"
FT                   /note="gene_id=mCG12307.2 transcript_id=mCT190855.0
FT                   protein_id=mCP111809.0 isoform=CRA_b"
FT                   /protein_id="EDL14930.1"
FT                   /translation="AMKLLVGTLRLWEVGRQVAFSSLTPGQECSGLRKTFWAAMRAVRT
FT                   RADHQKLGHCVTMGRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVA
FT                   ALARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQVHVMSENILTGTKKLTNKATLW
FT                   YVPLSLKNVDKVLEVPPIVYLRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEP
FT                   NTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAIN
FT                   FHDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDNSQKRYRAASAFFTYVSLNQE
FT                   GKPMPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHTEPQP"
FT   gap             4455039..4455154
FT                   /estimated_length=116
FT   gap             4463129..4463685
FT                   /estimated_length=557
FT   gap             4468683..4468702
FT                   /estimated_length=20
FT   gap             4478894..4478913
FT                   /estimated_length=20
FT   gap             4498458..4498477
FT                   /estimated_length=20
FT   gap             4518887..4518906
FT                   /estimated_length=20
FT   gap             4540324..4540667
FT                   /estimated_length=344
FT   gene            4545279..4551605
FT                   /gene="Gpr153"
FT                   /locus_tag="mCG_12300"
FT                   /note="gene_id=mCG12300.2"
FT   mRNA            join(4545279..4545747,4546112..4546541,4548032..4548224,
FT                   4548637..4548821,4549124..4551605)
FT                   /gene="Gpr153"
FT                   /locus_tag="mCG_12300"
FT                   /product="G protein-coupled receptor 153"
FT                   /note="gene_id=mCG12300.2 transcript_id=mCT15571.2 created
FT                   on 18-DEC-2002"
FT   CDS             join(4545392..4545747,4546112..4546541,4548032..4548224,
FT                   4548637..4548821,4549124..4549855)
FT                   /codon_start=1
FT                   /gene="Gpr153"
FT                   /locus_tag="mCG_12300"
FT                   /product="G protein-coupled receptor 153"
FT                   /note="gene_id=mCG12300.2 transcript_id=mCT15571.2
FT                   protein_id=mCP21665.2"
FT                   /protein_id="EDL14931.1"
FT                   /translation="MSDERRLPSSAVGWLACGGLSLLANAWGILSVGAKQKKWKPLEFL
FT                   LCTLAATHMLNVAVPIATYAVVQLRRQRPDYEWNEGLCKVFVSTFYTLTLATCFSVTSI
FT                   SYHRMWMVRWPVNYRLSNAKKQAVHTVMGIWMVSFILSALPAVGWHDTSERFYTHGCRF
FT                   IVAEIGLGFGVCFLLLVGGSVAMGMVCTAIALFQTLATQVGHRADRRTFTVPTIVVEDA
FT                   QGKRRSSIDGSEPARTSLQITGLVATIVVIYDCLMGFPVLVVSFSSLRADASAPWMALC
FT                   VLWCSVTQALLLPLFLWTCDRYRADLKAVWEKCVALMANDEDSDNETSLEGSISPDMVL
FT                   ERSLDYSYGGDFVALDRMAKYELSALEGGLPQLYPLRPLQEDRMQYLQGAGRHRCGFPG
FT                   GQPCFSPAGCSQVPPTRRFSHDDADVWAAVPLPTFLPRWSSGEDLAALAHLMLPAGSDR
FT                   RRGSLLAFAEDAPPFRPRRRSAESLLSLQPSSLDGGPRHAQDSPPGSPRRRPGPGARSA
FT                   SVSLLPDAFALTAFEREPQALRRVPAPAQPFPAARDSAEPAEVPTPPGGRTQRSQGRRA
FT                   ARTHVGPLQSSLSASWGEPGGLHAAGCGSISSFLSSPSESSGYVTLHSDSLGSAS"
FT   gene            complement(<4553154..>4554326)
FT                   /gene="Hes3"
FT                   /locus_tag="mCG_12306"
FT                   /note="gene_id=mCG12306.1"
FT   mRNA            complement(join(<4553154..4553518,4553889..4553970,
FT                   4554051..4554146,4554267..>4554326))
FT                   /gene="Hes3"
FT                   /locus_tag="mCG_12306"
FT                   /product="hairy and enhancer of split 3 (Drosophila)"
FT                   /note="gene_id=mCG12306.1 transcript_id=mCT15577.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(4553154..4553518,4553889..4553970,
FT                   4554051..4554146,4554267..4554326))
FT                   /codon_start=1
FT                   /gene="Hes3"
FT                   /locus_tag="mCG_12306"
FT                   /product="hairy and enhancer of split 3 (Drosophila)"
FT                   /note="gene_id=mCG12306.1 transcript_id=mCT15577.1
FT                   protein_id=mCP21679.1"
FT                   /protein_id="EDL14932.1"
FT                   /translation="MGTEPTSRDSLGGPASSFRKISKPLMEKKRRARINVSLEQLRSLL
FT                   ERHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPSGVDYPSGFQGGLRGVSQR
FT                   LRPGEGDSGLRCPLLLQRREGSTTDSANPQATSVLNPCLPAIWAPSRAAGGSHSPQSPL
FT                   PLPGGLLESSTDVVAPHPASNCQAESTRPGFRVWRPW"
FT   gene            <4564021..4574367
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /note="gene_id=mCG12314.2"
FT   mRNA            join(<4564021..4564285,4565402..4565490,4565854..4565962,
FT                   4566388..4566557,4567254..4567471,4569739..4573836)
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /product="isoprenylcysteine carboxyl methyltransferase,
FT                   transcript variant mCT190888"
FT                   /note="gene_id=mCG12314.2 transcript_id=mCT190888.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4564028..4564285,4565402..4565490,4566388..4566557,
FT                   4567254..4567471,4569739..4574367)
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /product="isoprenylcysteine carboxyl methyltransferase,
FT                   transcript variant mCT15584"
FT                   /note="gene_id=mCG12314.2 transcript_id=mCT15584.1 created
FT                   on 18-DEC-2002"
FT   CDS             join(4564091..4564285,4565402..4565490,4566388..4566557,
FT                   4567254..4567471,4569739..4569921)
FT                   /codon_start=1
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /product="isoprenylcysteine carboxyl methyltransferase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12314.2 transcript_id=mCT15584.1
FT                   protein_id=mCP21689.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U4N2"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="InterPro:IPR025770"
FT                   /db_xref="MGI:MGI:1888594"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4N2"
FT                   /protein_id="EDL14933.1"
FT                   /translation="MAGCAARVPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLA
FT                   LYVAGLNALLLLLYRPPRYQIAIRACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFH
FT                   YSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWIEFTLENIFWPELKQITWLSATG
FT                   LLMVVFGECLRKAAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIG
FT                   TQVMLCNPICGVVYALTVWRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKGVK
FT                   VEL"
FT   CDS             <4572698..4573351
FT                   /codon_start=1
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /product="isoprenylcysteine carboxyl methyltransferase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12314.2 transcript_id=mCT190888.0
FT                   protein_id=mCP111811.0 isoform=CRA_b"
FT                   /protein_id="EDL14934.1"
FT                   /translation="VETVHTSHSQSHSLGCKREEMDLWHHPQLFISASKLSWLQPPSPL
FT                   EGREVVFLMDGEWLMAALGIAGSKAKCWHWMLPSTCQRPERGSPGLGTLGEMLDCILGD
FT                   GRLRSRDVGGGRSGHPSDIPRMAVSISPGTMSIIPAGSGRWLFSAAVDWRLFYLYGCSR
FT                   NRGQQNWLAEAFRYYKGSHVLGFPQMEELSGDWFVCLQASEWRFLCGEPVPYRK"
FT   gene            complement(4573951..4585636)
FT                   /locus_tag="mCG_12305"
FT                   /note="gene_id=mCG12305.2"
FT   mRNA            complement(join(4573951..4574333,4575555..4575620,
FT                   4578115..4578232,4578503..4578554,4578802..4578987,
FT                   4579121..4579307,4579918..4580015,4580095..4580163,
FT                   4580610..4580678,4580768..4580840,4581774..4581820,
FT                   4582124..4582249,4582335..4582410,4582483..4582564,
FT                   4582651..4582802,4584401..4584525,4585000..4585636))
FT                   /locus_tag="mCG_12305"
FT                   /product="mCG12305"
FT                   /note="gene_id=mCG12305.2 transcript_id=mCT15576.2 created
FT                   on 27-DEC-2002"
FT   CDS             complement(join(4574144..4574333,4575555..4575620,
FT                   4578115..4578232,4578503..4578554,4578802..4578987,
FT                   4579121..4579307,4579918..4580015,4580095..4580163,
FT                   4580610..4580678,4580768..4580840,4581774..4581820,
FT                   4582124..4582249,4582335..4582410,4582483..4582564,
FT                   4582651..4582714))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12305"
FT                   /product="mCG12305"
FT                   /note="gene_id=mCG12305.2 transcript_id=mCT15576.2
FT                   protein_id=mCP21685.2"
FT                   /protein_id="EDL14935.1"
FT                   /translation="MFARHDIVALGQRSRDVIQKCTLHSEPYIMFSTDKKSLLCIRCFR
FT                   DMQGESRAHCVDLESAYVQGCERLEQAVLAVKALQTATKEAIALLQSMVEEVRHSAAEE
FT                   EAAIHALFGSMQDRMAERKALLLQTVQSQYEEKDKAFKEQLTHLASLLPTLQVHLVICS
FT                   SFLSLASKAEFLDLGYELMERLQGIVTRPHRLRPAQSSKIASDHRAEFARCLEPLLLLG
FT                   PRREVSTVGGANTLSGGSSPMVLKTPSCPSPVGKMSGSPVQKPSPHRFISTKVLLAEGE
FT                   DTPFTEHCRHYEDSYRGLQVEVQNLKDQVQELHRDLTKHHSLIKAEIMGDILRRSLLLD
FT                   TQIASEYASLEGRRAIFQEIWEDSYQRVATQQEIYEAQLRDLLQLRQENAYLTIVTKQI
FT                   TPYIRSIARVKERLEPRFQVPVDEHAEHGQNMYDETPGRTDPGCTTEKRDKASEPNGSS
FT                   WSLSSLPEGPSLKNQDHLRPKLEAGDEGWRAGSGSKGACYQA"
FT   gene            4592572..4600781
FT                   /locus_tag="mCG_12304"
FT                   /note="gene_id=mCG12304.1"
FT   mRNA            join(4592572..4592606,4594192..4594296,4596715..4596839,
FT                   4598991..4600781)
FT                   /locus_tag="mCG_12304"
FT                   /product="mCG12304"
FT                   /note="gene_id=mCG12304.1 transcript_id=mCT15575.1 created
FT                   on 30-NOV-2004"
FT   CDS             join(4592595..4592606,4594192..4594296,4596715..4596839,
FT                   4598991..4599135)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12304"
FT                   /product="mCG12304"
FT                   /note="gene_id=mCG12304.1 transcript_id=mCT15575.1
FT                   protein_id=mCP21677.2"
FT                   /db_xref="GOA:Q4VAG4"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="MGI:MGI:99262"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAG4"
FT                   /protein_id="EDL14936.1"
FT                   /translation="MAPVKKLVAKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQE
FT                   RIKVNGKAGNLGGGVVTIERSKSKITVTSEVPFSKRYLKYLTKKYLKKNNLRDWLRVVA
FT                   NSKESYELRYFQINQDEEEEEDED"
FT   gap             4604838..4605879
FT                   /estimated_length=1042
FT   gene            4608188..4654126
FT                   /locus_tag="mCG_131426"
FT                   /note="gene_id=mCG131426.1"
FT   mRNA            join(4608188..4608264,4614541..4614668,4620146..4620334,
FT                   4622686..4622804,4623225..4623463,4625103..4625224,
FT                   4626331..4626487,4627207..4627373,4627464..4627685,
FT                   4629528..4629734,4629918..4630129,4632770..4632901,
FT                   4633004..4633112,4633925..4634116,4634472..4634672,
FT                   4637054..4637191,4637277..4637398,4638127..4638300,
FT                   4638633..4638774,4639995..4640126,4640881..4640998,
FT                   4641626..4641750,4642685..4642916,4643129..4643239,
FT                   4643518..4643690,4644165..4644339,4644727..4644819,
FT                   4645007..4645095,4645279..4645412,4645914..4646058,
FT                   4646369..4646528,4646997..4647076,4647696..4647828,
FT                   4648884..4648961,4649441..4649578,4649819..4649927,
FT                   4650673..4650805,4651034..4651229,4651982..4652145,
FT                   4652498..4652551,4653464..4654126)
FT                   /locus_tag="mCG_131426"
FT                   /product="mCG131426"
FT                   /note="gene_id=mCG131426.1 transcript_id=mCT132761.1
FT                   created on 16-DEC-2002"
FT   CDS             join(4608192..4608264,4614541..4614668,4620146..4620334,
FT                   4622686..4622804,4623225..4623463,4625103..4625224,
FT                   4626331..4626487,4627207..4627373,4627464..4627685,
FT                   4629528..4629734,4629918..4630129,4632770..4632901,
FT                   4633004..4633112,4633925..4634116,4634472..4634672,
FT                   4637054..4637191,4637277..4637398,4638127..4638300,
FT                   4638633..4638774,4639995..4640126,4640881..4640998,
FT                   4641626..4641750,4642685..4642916,4643129..4643239,
FT                   4643518..4643690,4644165..4644339,4644727..4644819,
FT                   4645007..4645095,4645279..4645412,4645914..4646058,
FT                   4646369..4646528,4646997..4647076,4647696..4647828,
FT                   4648884..4648961,4649441..4649578,4649819..4649927,
FT                   4650673..4650805,4651034..4651229,4651982..4652145,
FT                   4652498..4652551,4653464..4653514)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131426"
FT                   /product="mCG131426"
FT                   /note="gene_id=mCG131426.1 transcript_id=mCT132761.1
FT                   protein_id=mCP76889.1"
FT                   /protein_id="EDL14937.1"
FT                   /translation="MSAIHRGSLSCLPKDMLLRLALLSKEEDGGLEGFEDFFPAEPVSL
FT                   PKKKPKKLKESKSSKGKRKKKEGSNDEMSDNEEDLEEKSESEGSDYSPTKKKKKKLKEK
FT                   KEKKEKKEKRKKRGEDEDDNDDGGLKEPKSSGQLMAEWGLDDVDYLFSEDDYHTLTNYK
FT                   AFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPFKGSSAAAAAAAVAAAVETVT
FT                   IAPPLAISPQQVPQTLPIRKAKTKEGKGPGVRKKNKGAKDSKKKGRGKRVAGLKFRFGG
FT                   ISKRKKGSSSEEDEREDSDLDNASIHSSSVRSECSAALGKKNKRRRKKKRSRASRGRGL
FT                   FRVDDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCE
FT                   KEGIQWEPKDDDEEEEEGGCEEEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPL
FT                   PEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFVVGLPGPEVEPGMPPPRPLEGI
FT                   PEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGDEDGKS
FT                   EKRKNKDPLYAKMEERFYRYGIKPEWMMVHRILNHSFDKKGDIHYLIKWKDLPYDQCTW
FT                   EIDEIDIPYYDNLKQAYWGHRELMLGEDARLPKRLVKKGKKLKDDKQEKPPDTPIVDPT
FT                   VKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSL
FT                   YKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKESRSVIRENEFSFEDNA
FT                   IRGGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIEWACLVVDEAHRLKNNQSKFF
FT                   RVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKK
FT                   LHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGN
FT                   QVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLR
FT                   DEGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCF
FT                   LLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVE
FT                   ERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKDDVEGMMSQGQR
FT                   PTTPIPDIQSTKGGSLTAGAKKKHGSTPPGDNKDVEDSSVIHYDDAAISKLLDRNQDAT
FT                   DDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREVIKQEENVDPDYWEKLLRHHYEQQQ
FT                   EDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQS
FT                   GRRQSRRQLKSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSH
FT                   WLVRDLRGKSEKEFRAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSL
FT                   VRKKVQEFEHVNGKYSTPDLVPEGAEGKKPGEVISSDPNTPVPASPAQLPPAPLGLTDK
FT                   MEAQLGYTDEKESGMQKPKKSLEIQTLPTALDRVEGEDKHQSSDSKDRAREERTEEVEK
FT                   AQGSPEQPLKEEVLPDKEPIPDKPELSLGHSGDFRPDDPKTEEKEPGETQQNGDREEDE
FT                   EGKKEDKNGKFKFMFNIADGGFTELHTLWQNEERAAVSSGKIYEIWHRRHDYWLLAGIV
FT                   THGYARWQDIQNDPRYMILNEPFKSEIHKGNYLEMKNKFLARRFKLLEQALVIEEQLRR
FT                   AAYLNMTQDPNHPAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEEL
FT                   LSDMKADVTRLPSMLSRIPPVAARLQMSERSILSRLTNRAGDPTIQQTSSRRRDFPLFQ
FT                   RSFPAEPSHLPNPRGREKLQPF"
FT   gap             4625473..4625518
FT                   /estimated_length=46
FT   gap             4636134..4636153
FT                   /estimated_length=20
FT   gene            complement(<4659586..4742997)
FT                   /gene="Kcnab2"
FT                   /locus_tag="mCG_12303"
FT                   /note="gene_id=mCG12303.2"
FT   mRNA            complement(join(<4659586..4659675,4660293..4660381,
FT                   4660841..4660961,4661480..4661574,4661676..4661796,
FT                   4663307..4663392,4667498..4667584,4668475..4668518,
FT                   4669586..4669630,4671151..4671195,4673703..4673782,
FT                   4678561..4678598,4679393..4679436,4701378..4701419,
FT                   4702401..4702533,4742925..4742997))
FT                   /gene="Kcnab2"
FT                   /locus_tag="mCG_12303"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 2"
FT                   /note="gene_id=mCG12303.2 transcript_id=mCT15574.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(4659586..4659675,4660293..4660381,
FT                   4660841..4660961,4661480..4661574,4661676..4661796,
FT                   4663307..4663392,4667498..4667584,4668475..4668518,
FT                   4669586..4669630,4671151..4671195,4673703..4673782,
FT                   4678561..4678598,4679393..4679436,4701378..4701419,
FT                   4702401..4702477))
FT                   /codon_start=1
FT                   /gene="Kcnab2"
FT                   /locus_tag="mCG_12303"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 2"
FT                   /note="gene_id=mCG12303.2 transcript_id=mCT15574.1
FT                   protein_id=mCP21667.0"
FT                   /protein_id="EDL14938.1"
FT                   /translation="MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKS
FT                   GLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIK
FT                   KKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPN
FT                   TPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQR
FT                   EKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEE
FT                   GRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVL
FT                   PKLSSSIVHEIDSILGNKPYSKKDYRS"
FT   gap             4701299..4701318
FT                   /estimated_length=20
FT   gap             4740393..4740550
FT                   /estimated_length=158
FT   gene            4742228..4828716
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /note="gene_id=mCG12308.2"
FT   mRNA            join(4742228..4742281,4749941..4750121,4754424..4754576,
FT                   4762349..4762521,4763849..4763913,4764604..4764759,
FT                   4768546..4768676,4772033..4772214,4773027..4773153,
FT                   4783750..4783932,4789901..4790027,4801550..4801611,
FT                   4802823..4802939,4803415..4803563,4803660..4803851,
FT                   4804463..4804650,4809939..4810099,4812586..4812766,
FT                   4817442..4817567,4820160..4820365,4821111..4821337,
FT                   4821853..4822039,4822626..4822709,4824862..4825018,
FT                   4825212..4825297,4825798..4825883,4826712..4826883,
FT                   4827108..4827287,4827540..4827683,4828172..4828716)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT185776"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT185776.0 created
FT                   on 17-JUN-2003"
FT   mRNA            join(4743666..4743963,4749941..4750121,4754424..4754576,
FT                   4762349..4762521,4763849..4763913,4764604..4764759,
FT                   4768546..4768676,4772033..4772214,4773027..4773153,
FT                   4783750..4783932,4789901..4790027,4801550..4801611,
FT                   4802823..4802939,4803415..4803563,4803660..4803851,
FT                   4804463..4804650,4809939..4810099,4812586..4812766,
FT                   4817442..4817567,4820160..4820365,4821111..4821337,
FT                   4821853..4822039,4822626..4822709,4824862..4825018,
FT                   4825212..4825297,4825798..4825883,4826712..4826883,
FT                   4827108..4827287,4827540..4827683,4828172..4828716)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT177663"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT177663.1 created
FT                   on 17-JUN-2003"
FT   mRNA            join(4743666..4743963,4749986..4750121,4754424..4754576,
FT                   4762349..4762521,4763849..4763913,4764604..4764759,
FT                   4768546..4768649,4772033..4772224,4773040..4773153,
FT                   4783750..4783932,4789901..4790027,4803416..4803563,
FT                   4803660..4803851,4804463..4804650,4809939..4810099,
FT                   4812586..4812766,4817442..4817567,4820160..4820365,
FT                   4821111..4821337,4821853..4822039,4822626..4822709,
FT                   4824862..4825018,4825212..4825297,4825798..4825883,
FT                   4826712..4826883,4827108..4827287,4827540..4827683,
FT                   4828172..4828716)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT15579"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT15579.3 created
FT                   on 17-JUN-2003"
FT   mRNA            join(<4743666..4743963,4749986..4750121,4754424..4754576,
FT                   4762349..4762521,4763849..4763913,4764604..4764759,
FT                   4768546..4768649,4772033..4772224,4773040..4773153,
FT                   4783750..4783932,4789901..4790027,4803415..4803563,
FT                   4803660..4803851,4804463..4804650,4809939..4810099,
FT                   4812586..4812766,4817442..4817567,4820160..4820365,
FT                   4821111..4821337,4821853..4822039,4822626..4822709,
FT                   4824862..4825018,4825212..4825297,4825798..4825883,
FT                   4826712..4826883,4827108..4827287,4827540..4827683,
FT                   4828172..4828668)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT190856"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT190856.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4743666..4743963,4749941..4750121,4754424..4754576,
FT                   4754765..4754896,4755144..4755375,4755815..4756127)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT177662"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT177662.1 created
FT                   on 17-JUN-2003"
FT   gap             4747004..4747057
FT                   /estimated_length=54
FT   CDS             join(4749987..4750121,4754424..4754576,4762349..4762521,
FT                   4763849..4763913,4764604..4764759,4768546..4768676,
FT                   4772033..4772214,4773027..4773153,4783750..4783932,
FT                   4789901..4790027,4801550..4801611,4802823..4802939,
FT                   4803415..4803563,4803660..4803851,4804463..4804650,
FT                   4809939..4810099,4812586..4812766,4817442..4817567,
FT                   4820160..4820365,4821111..4821337,4821853..4822039,
FT                   4822626..4822709,4824862..4825018,4825212..4825297,
FT                   4825798..4825883,4826712..4826883,4827108..4827287,
FT                   4827540..4827683,4828172..4828312)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT177663.1
FT                   protein_id=mCP100584.1 isoform=CRA_a"
FT                   /db_xref="GOA:P59240"
FT                   /db_xref="MGI:MGI:2384210"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59240"
FT                   /protein_id="EDL14939.1"
FT                   /translation="MGDWHRAFTQNTLVPPHPQRARQLGKESTAFQCILKWLDGPLIKQ
FT                   GILDMLSELECHLRVTLFDVTYKHFFGRTWKTTVKPTNQPSKQPPRITFNEPLYFHTTL
FT                   SHPSIVAVVEVVTEGRKRDGTLQLLSCGFGILRIFGNKPESPTSAAQDKRLRLYHGTPR
FT                   ALLHPLLQDPIEQNKFMRLMENCSLQYTLKPHPPLEPAFHLLPENLLVSGFQQIPGLLP
FT                   PHGDTGDALRKPRFQKPTTWHLDDLFFTLYPSLEKFEEELVQLLISDREGVGLLDSGTL
FT                   EVLERRLHVCVHNGLGFVQRPQVVVLVPEMDVALTRSASFSRKISASSKNSSGNQALVL
FT                   RSHLRLPEMVSHPAFAIVFQLEYVFNSPSGADGGASSPTSISSVACMHMVRWAVWNPDL
FT                   EVGPGKVTLPLQGGVQQNPSRCLVYKVPSASMSSEEVKQVESGTIQFQFSLSSDGPTEH
FT                   ANGPRVGRRSSRKMPASPSGTPAPAARDLAATQDSPVGPGLSLSQLTASPLSPALQSSS
FT                   KPPLQPPDSSQSPEGPQLQAESVLESRVSHLEADLSQPASLQGTPAVEHLQELPFTPLH
FT                   APIVVGAQTRSSRSQLSRAAMVLLQSSGFPEILDASQQPVEAVNPIDPVRFNPQKEESD
FT                   CLRGNEIVLQFLAFSRAAQDCPGTPWPQTVYFTFQFYRFPPETTPRLQLVKLDGTGKSG
FT                   SGSLSHILVPINKDGSFDAGSPGLQLRYMVDPGFLKPGEQRWFAHYLAAQTLQVDVWDG
FT                   DSLLLIGSAGVQMKHLLRQGRPAVQVSHELEVVATEYEQEMMAVSGDVAGFGSVKPIGV
FT                   HTVVKGRLHLTLANVGHACEPRARGSNLLPPSRSRVISNDGASFFSGGSLLIPGGPKRK
FT                   RVVQAQRLADVDSELAAMLLTHTRAGQGPQAAGQEADAVHKRKLERMRLVRLQEAGGDS
FT                   DSRRISLLAQHSVRAQHSRDLQVIDAYRERTKAESIAGVLSQAITTHHTLYATLGTAEF
FT                   FEFALKNPHNTQHTVAIEIDSPELSIILDSQEWRYFKEATGLHTPLEEDMFHLRGSLAP
FT                   QLYLRPRETAHIPLKFQSFSVGPLAPTQAPAEVITEKDAESGPLWKCSAMPTKHAKVLF
FT                   RVETGQLIAVLCLTVEPQPHVVDQVFRFYHPELTFLKKAIRLPPWHTLPGAPVGMPGED
FT                   PPVHVRCSDPNVICEAQNVGPGEPRDVFLKVASGPSPEIKDFFVVIYADRWLAVPVQTW
FT                   QVCLHSLQRVDVSCVAGQLTRLSLVLRGTQTVRKVRAFTSHPQELKTDPAGVFVLPPHG
FT                   VQDLHVGVRPRRAGSRFVHLNLVDIDYHQLVASWLVCLSCRQPLISKAFEITMAAGDEK
FT                   GTNKRITYTNPYPSRRTYRLHSDRPELLRFKEDSFQVAGGETYTIGLRFLPSGSAGQEE
FT                   ILIYINDHEDKNEETFCVKVLYQ"
FT   CDS             join(4749987..4750121,4754424..4754576,4762349..4762521,
FT                   4763849..4763913,4764604..4764759,4768546..4768676,
FT                   4772033..4772214,4773027..4773153,4783750..4783932,
FT                   4789901..4790027,4801550..4801611,4802823..4802939,
FT                   4803415..4803563,4803660..4803851,4804463..4804650,
FT                   4809939..4810099,4812586..4812766,4817442..4817567,
FT                   4820160..4820365,4821111..4821337,4821853..4822039,
FT                   4822626..4822709,4824862..4825018,4825212..4825297,
FT                   4825798..4825883,4826712..4826883,4827108..4827287,
FT                   4827540..4827683,4828172..4828312)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT185776.0
FT                   protein_id=mCP107034.0 isoform=CRA_a"
FT                   /db_xref="GOA:P59240"
FT                   /db_xref="MGI:MGI:2384210"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59240"
FT                   /protein_id="EDL14940.1"
FT                   /translation="MGDWHRAFTQNTLVPPHPQRARQLGKESTAFQCILKWLDGPLIKQ
FT                   GILDMLSELECHLRVTLFDVTYKHFFGRTWKTTVKPTNQPSKQPPRITFNEPLYFHTTL
FT                   SHPSIVAVVEVVTEGRKRDGTLQLLSCGFGILRIFGNKPESPTSAAQDKRLRLYHGTPR
FT                   ALLHPLLQDPIEQNKFMRLMENCSLQYTLKPHPPLEPAFHLLPENLLVSGFQQIPGLLP
FT                   PHGDTGDALRKPRFQKPTTWHLDDLFFTLYPSLEKFEEELVQLLISDREGVGLLDSGTL
FT                   EVLERRLHVCVHNGLGFVQRPQVVVLVPEMDVALTRSASFSRKISASSKNSSGNQALVL
FT                   RSHLRLPEMVSHPAFAIVFQLEYVFNSPSGADGGASSPTSISSVACMHMVRWAVWNPDL
FT                   EVGPGKVTLPLQGGVQQNPSRCLVYKVPSASMSSEEVKQVESGTIQFQFSLSSDGPTEH
FT                   ANGPRVGRRSSRKMPASPSGTPAPAARDLAATQDSPVGPGLSLSQLTASPLSPALQSSS
FT                   KPPLQPPDSSQSPEGPQLQAESVLESRVSHLEADLSQPASLQGTPAVEHLQELPFTPLH
FT                   APIVVGAQTRSSRSQLSRAAMVLLQSSGFPEILDASQQPVEAVNPIDPVRFNPQKEESD
FT                   CLRGNEIVLQFLAFSRAAQDCPGTPWPQTVYFTFQFYRFPPETTPRLQLVKLDGTGKSG
FT                   SGSLSHILVPINKDGSFDAGSPGLQLRYMVDPGFLKPGEQRWFAHYLAAQTLQVDVWDG
FT                   DSLLLIGSAGVQMKHLLRQGRPAVQVSHELEVVATEYEQEMMAVSGDVAGFGSVKPIGV
FT                   HTVVKGRLHLTLANVGHACEPRARGSNLLPPSRSRVISNDGASFFSGGSLLIPGGPKRK
FT                   RVVQAQRLADVDSELAAMLLTHTRAGQGPQAAGQEADAVHKRKLERMRLVRLQEAGGDS
FT                   DSRRISLLAQHSVRAQHSRDLQVIDAYRERTKAESIAGVLSQAITTHHTLYATLGTAEF
FT                   FEFALKNPHNTQHTVAIEIDSPELSIILDSQEWRYFKEATGLHTPLEEDMFHLRGSLAP
FT                   QLYLRPRETAHIPLKFQSFSVGPLAPTQAPAEVITEKDAESGPLWKCSAMPTKHAKVLF
FT                   RVETGQLIAVLCLTVEPQPHVVDQVFRFYHPELTFLKKAIRLPPWHTLPGAPVGMPGED
FT                   PPVHVRCSDPNVICEAQNVGPGEPRDVFLKVASGPSPEIKDFFVVIYADRWLAVPVQTW
FT                   QVCLHSLQRVDVSCVAGQLTRLSLVLRGTQTVRKVRAFTSHPQELKTDPAGVFVLPPHG
FT                   VQDLHVGVRPRRAGSRFVHLNLVDIDYHQLVASWLVCLSCRQPLISKAFEITMAAGDEK
FT                   GTNKRITYTNPYPSRRTYRLHSDRPELLRFKEDSFQVAGGETYTIGLRFLPSGSAGQEE
FT                   ILIYINDHEDKNEETFCVKVLYQ"
FT   CDS             join(4749987..4750121,4754424..4754576,4762349..4762521,
FT                   4763849..4763913,4764604..4764759,4768546..4768649,
FT                   4772033..4772224,4773040..4773153,4783750..4783932,
FT                   4789901..4790027,4803416..4803563,4803660..4803851,
FT                   4804463..4804650,4809939..4810099,4812586..4812766,
FT                   4817442..4817567,4820160..4820365,4821111..4821337,
FT                   4821853..4822039,4822626..4822709,4824862..4825018,
FT                   4825212..4825297,4825798..4825883,4826712..4826883,
FT                   4827108..4827287,4827540..4827683,4828172..4828312)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT15579.3
FT                   protein_id=mCP21703.3 isoform=CRA_c"
FT                   /protein_id="EDL14942.1"
FT                   /translation="MGDWHRAFTQNTLVPPHPQRARQLGKESTAFQCILKWLDGPLIKQ
FT                   GILDMLSELECHLRVTLFDVTYKHFFGRTWKTTVKPTNQPSKQPPRITFNEPLYFHTTL
FT                   SHPSIVAVVEVVTEGRKRDGTLQLLSCGFGILRIFGNKPESPTSAAQDKRLRLYHGTPR
FT                   ALLHPLLQDPIEQNKFMRLMENCSLQYTLKPHPPLEPAFHLLPENLLVSGFQQIPGLLP
FT                   PHGDTGDALRKPRFQKPTTWHLDDLFFTLYPSLEKFEEELGVGLLDSGTLEVLERRLHV
FT                   CVHNGLGFVQRPQVVVLVPEMDVALTRSASFSRKISASSKNRYLPALVLRSHLRLPEMV
FT                   SHPAFAIVFQLEYVFNSPSGADGGASSPTSISSVACMHMVRWAVWNPDLEVGPGKVTLP
FT                   LQGGVQQNPSRCLVYKVPSASMSSEEVKQVESGTIQFQFSLSSDGPTEHANGPRVGRRS
FT                   SRKMPASPSESVLESRVSHLEADLSQPASLQGTPAVEHLQELPFTPLHAPIVVGAQTRS
FT                   SRSQLSRAAMVLLQSSGFPEILDASQQPVEAVNPIDPVRFNPQKEESDCLRGNEIVLQF
FT                   LAFSRAAQDCPGTPWPQTVYFTFQFYRFPPETTPRLQLVKLDGTGKSGSGSLSHILVPI
FT                   NKDGSFDAGSPGLQLRYMVDPGFLKPGEQRWFAHYLAAQTLQVDVWDGDSLLLIGSAGV
FT                   QMKHLLRQGRPAVQVSHELEVVATEYEQEMMAVSGDVAGFGSVKPIGVHTVVKGRLHLT
FT                   LANVGHACEPRARGSNLLPPSRSRVISNDGASFFSGGSLLIPGGPKRKRVVQAQRLADV
FT                   DSELAAMLLTHTRAGQGPQAAGQEADAVHKRKLERMRLVRLQEAGGDSDSRRISLLAQH
FT                   SVRAQHSRDLQVIDAYRERTKAESIAGVLSQAITTHHTLYATLGTAEFFEFALKNPHNT
FT                   QHTVAIEIDSPELSIILDSQEWRYFKEATGLHTPLEEDMFHLRGSLAPQLYLRPRETAH
FT                   IPLKFQSFSVGPLAPTQAPAEVITEKDAESGPLWKCSAMPTKHAKVLFRVETGQLIAVL
FT                   CLTVEPQPHVVDQVFRFYHPELTFLKKAIRLPPWHTLPGAPVGMPGEDPPVHVRCSDPN
FT                   VICEAQNVGPGEPRDVFLKVASGPSPEIKDFFVVIYADRWLAVPVQTWQVCLHSLQRVD
FT                   VSCVAGQLTRLSLVLRGTQTVRKVRAFTSHPQELKTDPAGVFVLPPHGVQDLHVGVRPR
FT                   RAGSRFVHLNLVDIDYHQLVASWLVCLSCRQPLISKAFEITMAAGDEKGTNKRITYTNP
FT                   YPSRRTYRLHSDRPELLRFKEDSFQVAGGETYTIGLRFLPSGSAGQEEILIYINDHEDK
FT                   NEETFCVKVLYQ"
FT   CDS             join(4749987..4750121,4754424..4754576,4754765..4754779)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT177662.1
FT                   protein_id=mCP100585.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9D4S3"
FT                   /db_xref="MGI:MGI:2384210"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4S3"
FT                   /protein_id="EDL14943.1"
FT                   /translation="MGDWHRAFTQNTLVPPHPQRARQLGKESTAFQCILKWLDGPLIKQ
FT                   GILDMLSELECHLRVTLFDVTYKHFFGRTWKTTVKPTNQPSKQPPRITFNEGCGT"
FT   gap             4752218..4752341
FT                   /estimated_length=124
FT   gap             4756964..4756983
FT                   /estimated_length=20
FT   gap             4774234..4774319
FT                   /estimated_length=86
FT   CDS             join(<4789947..4790027,4803415..4803563,4803660..4803851,
FT                   4804463..4804650,4809939..4810099,4812586..4812766,
FT                   4817442..4817567,4820160..4820365,4821111..4821337,
FT                   4821853..4822039,4822626..4822709,4824862..4825018,
FT                   4825212..4825297,4825798..4825883,4826712..4826883,
FT                   4827108..4827287,4827540..4827683,4828172..4828312)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT190856.0
FT                   protein_id=mCP111810.0 isoform=CRA_b"
FT                   /protein_id="EDL14941.1"
FT                   /translation="AQTAPQSMPTAPGWGVGPPGRCRHPLQESVLESRVSHLEADLSQP
FT                   ASLQGTPAVEHLQELPFTPLHAPIVVGAQTRSSRSQLSRAAMVLLQSSGFPEILDASQQ
FT                   PVEAVNPIDPVRFNPQKEESDCLRGNEIVLQFLAFSRAAQDCPGTPWPQTVYFTFQFYR
FT                   FPPETTPRLQLVKLDGTGKSGSGSLSHILVPINKDGSFDAGSPGLQLRYMVDPGFLKPG
FT                   EQRWFAHYLAAQTLQVDVWDGDSLLLIGSAGVQMKHLLRQGRPAVQVSHELEVVATEYE
FT                   QEMMAVSGDVAGFGSVKPIGVHTVVKGRLHLTLANVGHACEPRARGSNLLPPSRSRVIS
FT                   NDGASFFSGGSLLIPGGPKRKRVVQAQRLADVDSELAAMLLTHTRAGQGPQAAGQEADA
FT                   VHKRKLERMRLVRLQEAGGDSDSRRISLLAQHSVRAQHSRDLQVIDAYRERTKAESIAG
FT                   VLSQAITTHHTLYATLGTAEFFEFALKNPHNTQHTVAIEIDSPELSIILDSQEWRYFKE
FT                   ATGLHTPLEEDMFHLRGSLAPQLYLRPRETAHIPLKFQSFSVGPLAPTQAPAEVITEKD
FT                   AESGPLWKCSAMPTKHAKVLFRVETGQLIAVLCLTVEPQPHVVDQVFRFYHPELTFLKK
FT                   AIRLPPWHTLPGAPVGMPGEDPPVHVRCSDPNVICEAQNVGPGEPRDVFLKVASGPSPE
FT                   IKDFFVVIYADRWLAVPVQTWQVCLHSLQRVDVSCVAGQLTRLSLVLRGTQTVRKVRAF
FT                   TSHPQELKTDPAGVFVLPPHGVQDLHVGVRPRRAGSRFVHLNLVDIDYHQLVASWLVCL
FT                   SCRQPLISKAFEITMAAGDEKGTNKRITYTNPYPSRRTYRLHSDRPELLRFKEDSFQVA
FT                   GGETYTIGLRFLPSGSAGQEEILIYINDHEDKNEETFCVKVLYQ"
FT   gap             4794125..4794177
FT                   /estimated_length=53
FT   gap             4831832..4832106
FT                   /estimated_length=275
FT   gap             4835839..4836339
FT                   /estimated_length=501
FT   gap             4844496..4844515
FT                   /estimated_length=20
FT   gap             4850509..4850528
FT                   /estimated_length=20
FT   gap             4851845..4851864
FT                   /estimated_length=20
FT   gap             4855337..4855356
FT                   /estimated_length=20
FT   gap             4856514..4860324
FT                   /estimated_length=3811
FT   gap             4867818..4868805
FT                   /estimated_length=988
FT   gene            <4888595..4892820
FT                   /locus_tag="mCG_145230"
FT                   /note="gene_id=mCG145230.1"
FT   mRNA            join(<4888595..4890976,4891522..4892820)
FT                   /locus_tag="mCG_145230"
FT                   /product="mCG145230"
FT                   /note="gene_id=mCG145230.1 transcript_id=mCT184654.1
FT                   created on 15-JUL-2003"
FT   CDS             <4889540..4889875
FT                   /codon_start=1
FT                   /locus_tag="mCG_145230"
FT                   /product="mCG145230"
FT                   /note="gene_id=mCG145230.1 transcript_id=mCT184654.1
FT                   protein_id=mCP105934.0"
FT                   /protein_id="EDL14944.1"
FT                   /translation="GPVLSESSEHGSVCVCVCVCVCVVSQGSVVGNINTGGRMLSGHRA
FT                   LHLHCGATLLTRGILHTICPGCLQLGGGACSNIFDVMTPSADPVTSFCQEFPCIGRQPS
FT                   ALSLFHP"
FT   gap             4890977..4891521
FT                   /estimated_length=545
FT   gap             4896338..4896357
FT                   /estimated_length=20
FT   gap             4909010..4910195
FT                   /estimated_length=1186
FT   gap             4916141..4917039
FT                   /estimated_length=899
FT   gap             4917963..4918207
FT                   /estimated_length=245
FT   gene            complement(4941066..4941406)
FT                   /pseudo
FT                   /locus_tag="mCG_1027364"
FT                   /note="gene_id=mCG1027364.1"
FT   mRNA            complement(4941066..4941406)
FT                   /pseudo
FT                   /locus_tag="mCG_1027364"
FT                   /note="gene_id=mCG1027364.1 transcript_id=mCT145068.1
FT                   created on 13-FEB-2003"
FT   gap             4945661..4945680
FT                   /estimated_length=20
FT   gap             4954846..4954865
FT                   /estimated_length=20
FT   gap             4957482..4957501
FT                   /estimated_length=20
FT   gene            4961159..4963975
FT                   /locus_tag="mCG_1027416"
FT                   /note="gene_id=mCG1027416.1"
FT   mRNA            join(4961159..4961461,4962554..4962743,4963744..4963975)
FT                   /locus_tag="mCG_1027416"
FT                   /product="mCG1027416"
FT                   /note="gene_id=mCG1027416.1 transcript_id=mCT145120.1
FT                   created on 13-MAR-2003"
FT   CDS             join(4961285..4961461,4962554..4962724)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027416"
FT                   /product="mCG1027416"
FT                   /note="gene_id=mCG1027416.1 transcript_id=mCT145120.1
FT                   protein_id=mCP76924.1"
FT                   /db_xref="MGI:MGI:2685679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V423"
FT                   /protein_id="EDL14945.1"
FT                   /translation="MLGLLLPYLPARTALIILDLTGHQLTLVSAAAGAARRGMGAGAWT
FT                   LSHLCTPVSGIPHPDSVLHPEWKPAGVLRAAPALTFSWRRMQCGGRPRLATVSDGKGDP
FT                   EVSLSPSLSPS"
FT   gap             4966311..4966737
FT                   /estimated_length=427
FT   gap             4972383..4972402
FT                   /estimated_length=20
FT   gap             4981035..4981054
FT                   /estimated_length=20
FT   gap             4995325..4995425
FT                   /estimated_length=101
FT   gap             4996383..4996774
FT                   /estimated_length=392
FT   gap             5011469..5011488
FT                   /estimated_length=20
FT   gap             5027953..5028486
FT                   /estimated_length=534
FT   gap             5031848..5031970
FT                   /estimated_length=123
FT   gap             5041692..5041921
FT                   /estimated_length=230
FT   gap             5046421..5046440
FT                   /estimated_length=20
FT   gap             5082810..5083309
FT                   /estimated_length=500
FT   gap             5084782..5084810
FT                   /estimated_length=29
FT   gap             5089414..5089953
FT                   /estimated_length=540
FT   gap             5116875..5116894
FT                   /estimated_length=20
FT   gap             5120303..5120377
FT                   /estimated_length=75
FT   gap             5137705..5138355
FT                   /estimated_length=651
FT   gap             5146166..5146186
FT                   /estimated_length=21
FT   gap             5157570..5157807
FT                   /estimated_length=238
FT   gap             5158732..5159313
FT                   /estimated_length=582
FT   gap             5163003..5163048
FT                   /estimated_length=46
FT   gap             5171485..5171504
FT                   /estimated_length=20
FT   gap             5177440..5177459
FT                   /estimated_length=20
FT   gap             5178940..5179892
FT                   /estimated_length=953
FT   gap             5181244..5182472
FT                   /estimated_length=1229
FT   gap             5196181..5196386
FT                   /estimated_length=206
FT   gap             5197375..5197789
FT                   /estimated_length=415
FT   gap             5222360..5222381
FT                   /estimated_length=22
FT   gap             5225588..5226019
FT                   /estimated_length=432
FT   gap             5228064..5228083
FT                   /estimated_length=20
FT   gap             5246789..5246808
FT                   /estimated_length=20
FT   gap             5280633..5280652
FT                   /estimated_length=20
FT   gap             5337299..5337318
FT                   /estimated_length=20
FT   gap             5349140..5349159
FT                   /estimated_length=20
FT   gap             5352436..5352455
FT                   /estimated_length=20
FT   gap             5363860..5363898
FT                   /estimated_length=39
FT   gap             5372525..5372626
FT                   /estimated_length=102
FT   gap             5388761..5419467
FT                   /estimated_length=30707
FT   gap             5427350..5427369
FT                   /estimated_length=20
FT   gap             5431312..5431331
FT                   /estimated_length=20
FT   gap             5443799..5443858
FT                   /estimated_length=60
FT   gap             5452260..5452279
FT                   /estimated_length=20
FT   gap             5462155..5462278
FT                   /estimated_length=124
FT   gap             5464703..5464893
FT                   /estimated_length=191
FT   gap             5468446..5469034
FT                   /estimated_length=589
FT   gap             5475944..5475963
FT                   /estimated_length=20
FT   gap             5477559..5477873
FT                   /estimated_length=315
FT   gap             5479200..5479219
FT                   /estimated_length=20
FT   gap             5480714..5480733
FT                   /estimated_length=20
FT   gap             5484057..5484146
FT                   /estimated_length=90
FT   gap             5485311..5485372
FT                   /estimated_length=62
FT   gap             5493543..5493562
FT                   /estimated_length=20
FT   gap             5502537..5502720
FT                   /estimated_length=184
FT   gap             5526358..5526377
FT                   /estimated_length=20
FT   gap             5531315..5531334
FT                   /estimated_length=20
FT   gap             5541722..5541741
FT                   /estimated_length=20
FT   gap             5575252..5575345
FT                   /estimated_length=94
FT   gap             5600366..5600662
FT                   /estimated_length=297
FT   gap             5602143..5602162
FT                   /estimated_length=20
FT   gap             5607160..5607179
FT                   /estimated_length=20
FT   gap             5612432..5612557
FT                   /estimated_length=126
FT   gap             5613333..5613352
FT                   /estimated_length=20
FT   gap             5624745..5624764
FT                   /estimated_length=20
FT   gene            complement(5639877..>5749616)
FT                   /locus_tag="mCG_17925"
FT                   /note="gene_id=mCG17925.1"
FT   mRNA            complement(join(5639877..5640968,5648849..5648979,
FT                   5651448..5651690,5653068..5653155,5699341..5700146,
FT                   5749356..>5749616))
FT                   /locus_tag="mCG_17925"
FT                   /product="mCG17925"
FT                   /note="gene_id=mCG17925.1 transcript_id=mCT17679.2 created
FT                   on 27-DEC-2002"
FT   CDS             complement(join(5648907..5648979,5651448..5651690,
FT                   5653068..5653155,5699341..>5700145))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17925"
FT                   /product="mCG17925"
FT                   /note="gene_id=mCG17925.1 transcript_id=mCT17679.2
FT                   protein_id=mCP21770.2"
FT                   /protein_id="EDL14946.1"
FT                   /translation="SMSIRWPGRSLGSHAWILIAMLQLAVDFPSCDSLGPGPEFRLLSR
FT                   PQRPQRLWSLRSGPPTRLPTPAWSPRAARAERAHGPIQMQTPRARRAHRPRDQVATLGP
FT                   KGGLTKPPAATRSSPSLASATASSSIVTAGAAEHQGLLRRGRRHTHDTEFNDFDFRGGR
FT                   PTTETEFIAWGPTGDEDALESNTFPGGFGPTTVSILQTRKTTVATTTTTTAASTATAMT
FT                   LQTKGVTESLDPWKRTPVGVSTTEPSTSPSSNGKDIQPPRILGETSGLAVHQIITITVS
FT                   LIMVIAALITTLVLKNCCAPSGHTRRNSHQRKMNQQEESCQNLTDFTPARVPSSVDIFT
FT                   AYNETLQCSHECVRASVPVYADETLHSTGEYKSTFNGNRTSSADRHLIPVAFVSEKWFE
FT                   ISC"
FT   gap             5657017..5657304
FT                   /estimated_length=288
FT   gap             5659651..5659670
FT                   /estimated_length=20
FT   gap             5670799..5671477
FT                   /estimated_length=679
FT   gap             5685552..5685664
FT                   /estimated_length=113
FT   gap             5709675..5709826
FT                   /estimated_length=152
FT   gap             5711524..5711543
FT                   /estimated_length=20
FT   gap             5714886..5714993
FT                   /estimated_length=108
FT   gap             5721551..5721681
FT                   /estimated_length=131
FT   gap             5746374..5746500
FT                   /estimated_length=127
FT   gap             5748793..5749164
FT                   /estimated_length=372
FT   gap             5749743..5749762
FT                   /estimated_length=20
FT   gap             5753234..5753253
FT                   /estimated_length=20
FT   gap             5760900..5760919
FT                   /estimated_length=20
FT   gap             5765769..5765889
FT                   /estimated_length=121
FT   gap             5772575..5772594
FT                   /estimated_length=20
FT   gap             5777068..5778174
FT                   /estimated_length=1107
FT   gap             5794137..5794156
FT                   /estimated_length=20
FT   gap             5818934..5819121
FT                   /estimated_length=188
FT   gap             5821805..5821839
FT                   /estimated_length=35
FT   gap             5822914..5822933
FT                   /estimated_length=20
FT   gap             5827937..5828218
FT                   /estimated_length=282
FT   gap             5865036..5865055
FT                   /estimated_length=20
FT   gap             5876372..5876391
FT                   /estimated_length=20
FT   gap             5896532..5896551
FT                   /estimated_length=20
FT   gap             5902800..5902889
FT                   /estimated_length=90
FT   gap             5941318..5941337
FT                   /estimated_length=20
FT   gap             5951292..5951311
FT                   /estimated_length=20
FT   gap             5952471..5952490
FT                   /estimated_length=20
FT   gap             5954571..5954879
FT                   /estimated_length=309
FT   gap             5971576..5971666
FT                   /estimated_length=91
FT   gap             5976117..5976297
FT                   /estimated_length=181
FT   gap             5985300..5985366
FT                   /estimated_length=67
FT   gap             5999411..5999612
FT                   /estimated_length=202
FT   gap             6013292..6014645
FT                   /estimated_length=1354
FT   gap             6018699..6018837
FT                   /estimated_length=139
FT   gap             6024299..6024318
FT                   /estimated_length=20
FT   gap             6029395..6029611
FT                   /estimated_length=217
FT   gap             6037331..6037446
FT                   /estimated_length=116
FT   gap             6051322..6051341
FT                   /estimated_length=20
FT   gap             6058463..6058555
FT                   /estimated_length=93
FT   gap             6068563..6068582
FT                   /estimated_length=20
FT   gap             6069900..6070222
FT                   /estimated_length=323
FT   gene            complement(<6073450..>6073836)
FT                   /locus_tag="mCG_1027432"
FT                   /note="gene_id=mCG1027432.0"
FT   mRNA            complement(join(<6073450..6073684,6073706..>6073836))
FT                   /locus_tag="mCG_1027432"
FT                   /product="mCG1027432"
FT                   /note="gene_id=mCG1027432.0 transcript_id=mCT145136.0
FT                   created on 13-MAR-2003"
FT   CDS             complement(join(6073450..6073684,6073706..6073836))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027432"
FT                   /product="mCG1027432"
FT                   /note="gene_id=mCG1027432.0 transcript_id=mCT145136.0
FT                   protein_id=mCP76788.0"
FT                   /protein_id="EDL14947.1"
FT                   /translation="MEDRGPGTLLSASGFVAALLSASEFVAALLSASGFVGAPLSATDA
FT                   SGFVTALLSASGFVAALLSASGFVAALLNASGFVAALLSASEFVAALLSASGFVGAPLS
FT                   ATGWVGALLSAAGSLGL"
FT   gap             6116932..6117345
FT                   /estimated_length=414
FT   gap             6122550..6122655
FT                   /estimated_length=106
FT   gap             6129653..6129672
FT                   /estimated_length=20
FT   gap             6131366..6131620
FT                   /estimated_length=255
FT   gap             6141519..6141869
FT                   /estimated_length=351
FT   gap             6158341..6158640
FT                   /estimated_length=300
FT   gap             6160500..6160846
FT                   /estimated_length=347
FT   gap             6164480..6164499
FT                   /estimated_length=20
FT   gap             6168381..6168400
FT                   /estimated_length=20
FT   gap             6187293..6188597
FT                   /estimated_length=1305
FT   gap             6194591..6194665
FT                   /estimated_length=75
FT   gap             6213692..6213711
FT                   /estimated_length=20
FT   gene            complement(<6215196..6218066)
FT                   /locus_tag="mCG_147514"
FT                   /note="gene_id=mCG147514.0"
FT   mRNA            complement(join(<6215196..6216400,6217656..6217749,
FT                   6217995..6218066))
FT                   /locus_tag="mCG_147514"
FT                   /product="mCG147514"
FT                   /note="gene_id=mCG147514.0 transcript_id=mCT187777.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<6215196..6215496)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147514"
FT                   /product="mCG147514"
FT                   /note="gene_id=mCG147514.0 transcript_id=mCT187777.0
FT                   protein_id=mCP109473.0"
FT                   /protein_id="EDL14948.1"
FT                   /translation="MRSNVIDNTEWIMHRAPGNGHAQDCCLLGKSWHSHLGSTSSICHG
FT                   AVASAAATFSPSNAKGILHPIECSHHELLHPLDAKAETLEALSQLCSHSTANLSL"
FT   gap             6223968..6223987
FT                   /estimated_length=20
FT   gene            6224801..6229464
FT                   /locus_tag="mCG_17927"
FT                   /note="gene_id=mCG17927.1"
FT   mRNA            join(6224801..6224863,6227290..6227403,6228072..6228533,
FT                   6229031..6229464)
FT                   /locus_tag="mCG_17927"
FT                   /product="mCG17927"
FT                   /note="gene_id=mCG17927.1 transcript_id=mCT17681.1 created
FT                   on 27-DEC-2002"
FT   CDS             join(6224849..6224863,6227290..6227403,6228072..6228533,
FT                   6229031..6229132)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17927"
FT                   /product="mCG17927"
FT                   /note="gene_id=mCG17927.1 transcript_id=mCT17681.1
FT                   protein_id=mCP21771.2"
FT                   /protein_id="EDL14949.1"
FT                   /translation="MRSRKLTGGVRSSARLRARSYSSASLASARDVTSSTSAKTTCLAS
FT                   SSHKATDRRTSKKFKYDKGHLVKAELQKLDPKSDISSLPKVAPVAPCENKFAEDSAEAA
FT                   VSVPESREPPQGCSTPASEEPSVKAENGLSTEPSSAAAAQEPDDSSAGQAEPVPRTEEV
FT                   RASVLQMDSSIFLDDDSNQPMPVSRFFGNVELMQDLPPASSSYPSMSRREFRKMHFRAK
FT                   DDEDDAEG"
FT   gene            complement(6232906..6242594)
FT                   /gene="Dffb"
FT                   /locus_tag="mCG_17930"
FT                   /note="gene_id=mCG17930.1"
FT   mRNA            complement(join(6232906..6233152,6236632..6236732,
FT                   6237480..6237650,6239120..6239199,6240318..6240506,
FT                   6242134..6242260,6242432..6242594))
FT                   /gene="Dffb"
FT                   /locus_tag="mCG_17930"
FT                   /product="DNA fragmentation factor, beta subunit"
FT                   /note="gene_id=mCG17930.1 transcript_id=mCT17684.1 created
FT                   on 25-NOV-2002"
FT   CDS             complement(join(6232909..6233152,6236632..6236732,
FT                   6237480..6237650,6239120..6239199,6240318..6240506,
FT                   6242134..6242260,6242432..6242554))
FT                   /codon_start=1
FT                   /gene="Dffb"
FT                   /locus_tag="mCG_17930"
FT                   /product="DNA fragmentation factor, beta subunit"
FT                   /note="gene_id=mCG17930.1 transcript_id=mCT17684.1
FT                   protein_id=mCP21698.0"
FT                   /protein_id="EDL14950.1"
FT                   /translation="MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMP
FT                   GSRLCLYEDGTEVTDDCFPGLPNDAELLLLTAGETWHGYVSDITRFLSVFNEPHAGVIQ
FT                   AARQLLSDEQAPLRQKLLADLLHHVSQNITAETREQDPSWFEGLESRFRNKSGYLRYSC
FT                   ESRIRGYLREVSAYTSMVDEAAQEEYLRVLGSMCQKLKSVQYNGSYFDRGAEASSRLCT
FT                   PEGWFSCQGPFDLESCLSKHSINPYGNRESRILFSTWNLDHIIEKKRTVVPTLAEAIQD
FT                   GREVNWEYFYSLLFTAENLKLVHIACHKKTTHKLECDRSRIYRPQTGSRRKQPARKKRP
FT                   ARKR"
FT   gene            6242808..6274040
FT                   /gene="BC046331"
FT                   /locus_tag="mCG_17924"
FT                   /note="gene_id=mCG17924.2"
FT   mRNA            join(6242808..6243162,6246509..6246660,6248732..6248905,
FT                   6249195..6249333,6250540..6250602,6251065..6251150,
FT                   6252375..6252543,6252791..6252949,6254235..6254450,
FT                   6255882..6256076,6256601..6256768,6257252..6257425,
FT                   6260295..6260471,6260947..6261159,6262857..6262893,
FT                   6263694..6263760,6264283..6264391,6269085..6269223,
FT                   6269348..6269415,6272981..6273071,6273505..6274040)
FT                   /gene="BC046331"
FT                   /locus_tag="mCG_17924"
FT                   /product="cDNA sequence BC046331"
FT                   /note="gene_id=mCG17924.2 transcript_id=mCT17630.2 created
FT                   on 27-DEC-2002"
FT   CDS             join(6246548..6246660,6248732..6248905,6249195..6249333,
FT                   6250540..6250602,6251065..6251150,6252375..6252543,
FT                   6252791..6252949,6254235..6254450,6255882..6256076,
FT                   6256601..6256768,6257252..6257425,6260295..6260471,
FT                   6260947..6261159,6262857..6262893,6263694..6263760,
FT                   6264283..6264391,6269085..6269223,6269348..6269415,
FT                   6272981..6273071,6273505..6273620)
FT                   /codon_start=1
FT                   /gene="BC046331"
FT                   /locus_tag="mCG_17924"
FT                   /product="cDNA sequence BC046331"
FT                   /note="gene_id=mCG17924.2 transcript_id=mCT17630.2
FT                   protein_id=mCP21749.2"
FT                   /protein_id="EDL14951.1"
FT                   /translation="MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPKFCQFPQE
FT                   IVLQMVERCRVRKLQLLAHQYMISSKVEFYISESLPEYLVPYQAERFRRLGYVSLCDNE
FT                   KTGCKARELKSVYVDAVGQFLKLIFHQNHANKYNIYNQVALVAINIIGDPADLGDESNI
FT                   TSREKLIDHYLGHSPHNPEDPALDGTFSGRSDYISPLDDLAFDMYQDPEVAQIIRRLDE
FT                   RKREAVKKERYDHAKKLKQAIADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMAR
FT                   YRAQVYEQLELHGLLQGEPEMQRPFALPLQPLASPSSPQHWKAVSSLPRTEKLVAEDSF
FT                   AGPVLQEKPSASSPQHSAVDPSPPAAGHAPRSHTEVLPYDERPLPVTRKQLGEASAEAE
FT                   VKEADSDVRRRGVAGEPEPLTEKALREASAAIDTLGEALVAGAYSKMWSCREDALLALY
FT                   KKLMEMPVGTQKEDLKNMLRASVFLIRRAIKDIVASVFQASLKLLKMIITQYIPKHKLG
FT                   KLDTTHCVERAFPLLLARAGDSSARLRVMALNFIQEMALFKEVKSLQLIPSYLVQPLKA
FT                   NASVHLAMSQVDLLARLLRDLGTESSGFTVDNVMKFAVSALEHRVYEVRETAVRIILDM
FT                   YRQHPALTLEHLPPDDSATRRNLLYKAIFEGFAKIDGSVLPTEAEVREKESEAVKLRNQ
FT                   DPQGRKAVLPDTPEIPANHFLDNLCIFCGERNESFTEEGLDLHYWKHCLMLTRCDHCRQ
FT                   VVEISSLTEHLLTECDRRDGFGKCPRCSEAIPKEELPGHIKTKECSPAKPEKVANHCPL
FT                   CHENFAPGEEAWKVHLMGPAGCTMNLRKTHVLYKATAPQQGKGPAAAKSSTSAPKVGSK
FT                   IPTPKGGLSKSSSRTYMRR"
FT   gap             6261342..6261383
FT                   /estimated_length=42
FT   gene            <6278630..6288366
FT                   /gene="Lrrc47"
FT                   /locus_tag="mCG_17923"
FT                   /note="gene_id=mCG17923.1"
FT   mRNA            join(<6278630..6278912,6278976..6279247,6282471..6282923,
FT                   6284233..6284349,6285225..6285340,6285785..6285887,
FT                   6286249..6286338,6286486..6288366)
FT                   /gene="Lrrc47"
FT                   /locus_tag="mCG_17923"
FT                   /product="leucine rich repeat containing 47"
FT                   /note="gene_id=mCG17923.1 transcript_id=mCT17629.2 created
FT                   on 18-DEC-2002"
FT   gap             6278913..6278975
FT                   /estimated_length=63
FT   CDS             join(<6278978..6279247,6282471..6282923,6284233..6284349,
FT                   6285225..6285340,6285785..6285887,6286249..6286338,
FT                   6286486..6286731)
FT                   /codon_start=1
FT                   /gene="Lrrc47"
FT                   /locus_tag="mCG_17923"
FT                   /product="leucine rich repeat containing 47"
FT                   /note="gene_id=mCG17923.1 transcript_id=mCT17629.2
FT                   protein_id=mCP21739.2"
FT                   /protein_id="EDL14952.1"
FT                   /translation="PGEGLGPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQSLNL
FT                   TGNRLDAFPPELFRPGALPLLSELAAADNCLRELSPDIAHLASLKTLDLSNNQLTEIPA
FT                   ELADCPKLKEINFRGNRLRDKRLEKMVGGCQTKSILEYLRAGGRGGRSKGRQEASEKED
FT                   RKKRRERKQHRESGEGEEEVADSARLMLKVLHVSENPTPLTVRVSPEVKDVRPYIVGAI
FT                   VRGMDLQPGNALRRFLNSQTKLHDDLCEKRTAATIATHDLQAVRGPLLYAARPPEDLKI
FT                   VPLGRKEAKAKELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGKENYPCLVDAEGDV
FT                   ISFPPITNSEKTKIKKTTCNLFLEVTSATNLQLCKDIMDSLILRMAELSKSTSENKEED
FT                   MLSGTEADAGCGLSDPNLTLSSGKDGQCPLVVEQVRVVDLEGSLKVVYPSKTDLITLPP
FT                   HVTVVR"
FT   gap             6284468..6284700
FT                   /estimated_length=233
FT   gene            complement(6289943..6293007)
FT                   /locus_tag="mCG_17922"
FT                   /note="gene_id=mCG17922.2"
FT   mRNA            complement(join(6289943..6290308,6290543..6290672,
FT                   6292359..6292476,6292764..6293007))
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, transcript variant mCT17628"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT17628.2 created
FT                   on 18-DEC-2002"
FT   mRNA            complement(join(6290023..6290308,6290543..6290746,
FT                   6290922..6291048,6292359..6292476,6292764..6293007))
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, transcript variant mCT177671"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT177671.0 created
FT                   on 18-DEC-2002"
FT   mRNA            complement(join(6290166..6290308,6290543..6290746,
FT                   6292359..6292476,6292764..6293007))
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, transcript variant mCT177672"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT177672.0 created
FT                   on 18-DEC-2002"
FT   CDS             complement(join(6292408..6292476,6292764..6292994))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, isoform CRA_a"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT17628.2
FT                   protein_id=mCP21718.2 isoform=CRA_a"
FT                   /protein_id="EDL14953.1"
FT                   /translation="MACTVLQQAGKSPRGVRPSSSRLDFLGDCDCRLPRLASLPWPRPS
FT                   DPAPSPASAPPPSPQGAGEASLACGRPLQEAQARSTNLTSQHNWFALLGKGGIH"
FT   CDS             complement(join(6292408..6292476,6292764..6292994))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, isoform CRA_a"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT177671.0
FT                   protein_id=mCP100594.0 isoform=CRA_a"
FT                   /protein_id="EDL14954.1"
FT                   /translation="MACTVLQQAGKSPRGVRPSSSRLDFLGDCDCRLPRLASLPWPRPS
FT                   DPAPSPASAPPPSPQGAGEASLACGRPLQEAQARSTNLTSQHNWFALLGKGGIH"
FT   CDS             complement(join(6292408..6292476,6292764..6292994))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, isoform CRA_a"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT177672.0
FT                   protein_id=mCP100593.0 isoform=CRA_a"
FT                   /protein_id="EDL14955.1"
FT                   /translation="MACTVLQQAGKSPRGVRPSSSRLDFLGDCDCRLPRLASLPWPRPS
FT                   DPAPSPASAPPPSPQGAGEASLACGRPLQEAQARSTNLTSQHNWFALLGKGGIH"
FT   gene            complement(6293221..6294983)
FT                   /pseudo
FT                   /locus_tag="mCG_67211"
FT                   /note="gene_id=mCG67211.1"
FT   mRNA            complement(join(6293221..6293711,6294875..6294983))
FT                   /pseudo
FT                   /locus_tag="mCG_67211"
FT                   /note="gene_id=mCG67211.1 transcript_id=mCT67394.1 created
FT                   on 27-DEC-2002"
FT   gap             6298593..6312883
FT                   /estimated_length=14291
FT   gene            complement(6318337..6380194)
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /note="gene_id=mCG17921.2"
FT   mRNA            complement(join(6318337..6321415,6322677..6322770,
FT                   6323482..6323620,6324073..6324221,6324632..6324759,
FT                   6326005..6326093,6326433..6326575,6326758..6326867,
FT                   6329911..6330026,6330478..6330664,6345843..6346085,
FT                   6367885..6367990,6368384..6368461,6380073..6380194))
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /product="transformation related protein 73, transcript
FT                   variant mCT17627"
FT                   /note="gene_id=mCG17921.2 transcript_id=mCT17627.2 created
FT                   on 18-DEC-2002"
FT   mRNA            complement(join(6320933..6321415,6322677..6322770,
FT                   6323482..6323620,6324073..6324221,6324632..6324759,
FT                   6326005..6326093,6326433..6326575,6326758..6326867,
FT                   6329911..6330026,6330478..6330664,6345843..6346085,
FT                   6360461..6360734))
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /product="transformation related protein 73, transcript
FT                   variant mCT177670"
FT                   /note="gene_id=mCG17921.2 transcript_id=mCT177670.0 created
FT                   on 18-DEC-2002"
FT   CDS             complement(join(6321080..6321415,6322677..6322770,
FT                   6323482..6323620,6324073..6324221,6324632..6324759,
FT                   6326005..6326093,6326433..6326575,6326758..6326867,
FT                   6329911..6330026,6330478..6330664,6345843..6346085,
FT                   6367885..6367990,6368384..6368461,6380073..6380191))
FT                   /codon_start=1
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /product="transformation related protein 73, isoform CRA_a"
FT                   /note="gene_id=mCG17921.2 transcript_id=mCT17627.2
FT                   protein_id=mCP21707.2 isoform=CRA_a"
FT                   /protein_id="EDL14956.1"
FT                   /translation="MSSPRQLDAAATALPLQATTGPPAPLPKSMDPPRAQAQPRMSGSV
FT                   GEMAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGMAQF
FT                   NLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIPSNTDYPGP
FT                   HHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKK
FT                   AEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLAQYVDDPVTGRQSVVVPYEP
FT                   PQVGTEFTTILYNFMCNSSCVGGMNRRPILVIITLETRDGQVLGRRSFEGRICACPGRD
FT                   RKADEDHYREQQALNESTTKNGAASKRAFKQSPPAIPALGTNVKKRRHGDEDMFYMHVR
FT                   GRENFEILMKVKESLELMELVPQPLVDSYRQQQQQQLLQRPSHLQPPSYGPVLSPMNKV
FT                   HGGVNKLPSVNQLVGQPPPHSSAAGPNLGPMGSGMLNSHGHSMPANGEMNGGHSSQTMV
FT                   SGSHCTPPPPYHADPSLVSFLTGLGCPNCIECFTSQGLQSIYHLQNLTIEDLGALKVPD
FT                   QYRMTIWRGLQDLKQSHDCGQQLLRSSSNAATISIGGSGELQRQRVMEAVHFRVRHTIT
FT                   IPNRGGAGAVTGPDEWADFGFDLPDCKSRKQPIKEEFTETESH"
FT   CDS             complement(join(6321080..6321415,6322677..6322770,
FT                   6323482..6323620,6324073..6324221,6324632..6324759,
FT                   6326005..6326093,6326433..6326575,6326758..6326867,
FT                   6329911..6330026,6330478..6330664,6345843..6346085,
FT                   6360461..6360499))
FT                   /codon_start=1
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /product="transformation related protein 73, isoform CRA_b"
FT                   /note="gene_id=mCG17921.2 transcript_id=mCT177670.0
FT                   protein_id=mCP100592.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9JJP2"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002117"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR010991"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR011615"
FT                   /db_xref="InterPro:IPR012346"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="MGI:MGI:1336991"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJP2"
FT                   /protein_id="EDL14957.1"
FT                   /translation="MLYVGDPMRHLATAQFNLLSSAMDQMGSRAAPASPYTPEHAASAP
FT                   THSPYAQPSSTFDTMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYC
FT                   QIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDIVKRCPNHELGRDFNEGQSAPAS
FT                   HLIRVEGNNLAQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPI
FT                   LVIITLETRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESTTKNGAASKRAF
FT                   KQSPPAIPALGTNVKKRRHGDEDMFYMHVRGRENFEILMKVKESLELMELVPQPLVDSY
FT                   RQQQQQQLLQRPSHLQPPSYGPVLSPMNKVHGGVNKLPSVNQLVGQPPPHSSAAGPNLG
FT                   PMGSGMLNSHGHSMPANGEMNGGHSSQTMVSGSHCTPPPPYHADPSLVSFLTGLGCPNC
FT                   IECFTSQGLQSIYHLQNLTIEDLGALKVPDQYRMTIWRGLQDLKQSHDCGQQLLRSSSN
FT                   AATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGAGAVTGPDEWADFGFDLPDCKSR
FT                   KQPIKEEFTETESH"
FT   gap             6328483..6328502
FT                   /estimated_length=20
FT   gap             6334734..6334871
FT                   /estimated_length=138
FT   gap             6338062..6338459
FT                   /estimated_length=398
FT   gap             6346359..6346449
FT                   /estimated_length=91
FT   gap             6357289..6358351
FT                   /estimated_length=1063
FT   gap             6388263..6388404
FT                   /estimated_length=142
FT   gap             6391524..6391543
FT                   /estimated_length=20
FT   gap             6393044..6393210
FT                   /estimated_length=167
FT   gap             6403349..6403396
FT                   /estimated_length=48
FT   gene            6405970..6431574
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /note="gene_id=mCG17929.2"
FT   mRNA            join(6405970..6406091,6408829..6408981,6410077..6410193,
FT                   6412296..6412368,6415015..6415118,6415725..6415811,
FT                   6415948..6416082,6416180..6416257,6417840..6417945,
FT                   6418546..6418671,6419405..6419596,6430425..6431574)
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /product="WD repeat domain 8, transcript variant mCT176361"
FT                   /note="gene_id=mCG17929.2 transcript_id=mCT176361.0 created
FT                   on 25-NOV-2002"
FT   mRNA            join(6405970..6406091,6408829..6408981,6410077..6410193,
FT                   6412296..6412368,6415015..6415118,6415725..6415811,
FT                   6415948..6416082,6416180..6416257,6417840..6417945,
FT                   6418546..6418671,6419405..6419596,6419836..6420119)
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /product="WD repeat domain 8, transcript variant mCT17683"
FT                   /note="gene_id=mCG17929.2 transcript_id=mCT17683.0 created
FT                   on 25-NOV-2002"
FT   CDS             join(6406023..6406091,6408829..6408981,6410077..6410193,
FT                   6412296..6412368,6415015..6415118,6415725..6415811,
FT                   6415948..6416082,6416180..6416257,6417840..6417945,
FT                   6418546..6418671,6419405..6419596,6430425..6430456)
FT                   /codon_start=1
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /product="WD repeat domain 8, isoform CRA_b"
FT                   /note="gene_id=mCG17929.2 transcript_id=mCT176361.0
FT                   protein_id=mCP99283.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1891749"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T993"
FT                   /protein_id="EDL14959.1"
FT                   /translation="MNFSESFKLSGLLCRFSPDGKYLASCVQYRLVIRDVTTLQILQLY
FT                   TCLDQIQHIEWSADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGR
FT                   HILNTTEFHLRITVWSLCTKSVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIF
FT                   VCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEW
FT                   SLGIKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEKS
FT                   PLLGLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSS
FT                   DSYFLASRNDNVPNAVWIWDIQKLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYL
FT                   WSPAGCVSVQVPGEDSRANSIFTL"
FT   CDS             join(6406023..6406091,6408829..6408981,6410077..6410193,
FT                   6412296..6412368,6415015..6415118,6415725..6415811,
FT                   6415948..6416082,6416180..6416257,6417840..6417945,
FT                   6418546..6418671,6419405..6419596,6419836..6419984)
FT                   /codon_start=1
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /product="WD repeat domain 8, isoform CRA_a"
FT                   /note="gene_id=mCG17929.2 transcript_id=mCT17683.0
FT                   protein_id=mCP21751.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JM98"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="MGI:MGI:1891749"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JM98"
FT                   /protein_id="EDL14958.1"
FT                   /translation="MNFSESFKLSGLLCRFSPDGKYLASCVQYRLVIRDVTTLQILQLY
FT                   TCLDQIQHIEWSADSLFILCAMYRRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGR
FT                   HILNTTEFHLRITVWSLCTKSVSYIKYPKACQQGLTFTRDGRYLALAERRDCRDYVSIF
FT                   VCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAAWDTCLEYKVLLYSLDGRLLSAYCAYEW
FT                   SLGIKSVAWSPSSQFLAIGSYDGKVRLLNHVTWKMITEFGHPATINNPKTVVYKEAEKS
FT                   PLLGLGHLSFPPPRAMAGALSTSESKYEIASGPVSLQTLKPVADRANPRMGVGMLAFSS
FT                   DSYFLASRNDNVPNAVWIWDIQKLKLFVVLEHMSPVRSFQWDPQQPRLAICTGGSKVYL
FT                   WSPAGCVSVQVPGEGDFPVLGLCWHLSGDSLALLSKDHFCLCFLETKERVGTAYEQRDG
FT                   MPRT"
FT   gene            complement(6420784..6423996)
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /note="gene_id=mCG17928.1"
FT   mRNA            complement(join(6420784..6421869,6422573..6422726,
FT                   6423389..6423565,6423659..6423996))
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /product="RIKEN cDNA 1200015A19, transcript variant
FT                   mCT17682"
FT                   /note="gene_id=mCG17928.1 transcript_id=mCT17682.1 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(6420785..6421869,6423389..6423565,
FT                   6423659..6423952))
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /product="RIKEN cDNA 1200015A19, transcript variant
FT                   mCT176819"
FT                   /note="gene_id=mCG17928.1 transcript_id=mCT176819.0 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(6421675..6421869,6422573..6422726,
FT                   6423389..6423565,6423659..6423933))
FT                   /codon_start=1
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /product="RIKEN cDNA 1200015A19, isoform CRA_b"
FT                   /note="gene_id=mCG17928.1 transcript_id=mCT17682.1
FT                   protein_id=mCP21717.2 isoform=CRA_b"
FT                   /protein_id="EDL14961.1"
FT                   /translation="MLQLRDTVDSAGTSPTAVLAAGEDAGAGRPGAGTPLRQTLWPLNV
FT                   HDPTRRARVKEYFVFRPGTIEQAVEEIRAVVRPVEDGEIQGVWLLTEVDHWNNEKERLV
FT                   LVTDQSLLICKYDFISLQCQQVVRVALSAVDTISCGEFQFPPKSLNKREGFGVRIQWDK
FT                   QSRPSFINRWNPWSTNMPYATFIEHPMAGMDEKTASLCHLESFKALLIQAVKKAQKESP
FT                   LPGQANTVLVLERPLLIETYVGLMSFINNEAKLGYSMTRGKIGF"
FT   CDS             complement(join(6421845..6421869,6423389..6423565,
FT                   6423659..6423933))
FT                   /codon_start=1
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /product="RIKEN cDNA 1200015A19, isoform CRA_a"
FT                   /note="gene_id=mCG17928.1 transcript_id=mCT176819.0
FT                   protein_id=mCP99741.0 isoform=CRA_a"
FT                   /protein_id="EDL14960.1"
FT                   /translation="MLQLRDTVDSAGTSPTAVLAAGEDAGAGRPGAGTPLRQTLWPLNV
FT                   HDPTRRARVKEYFVFRPGTIEQAVEEIRAVVRPVEDGEIQGVWLLTEVDHWNNEKERLV
FT                   LVTDQSLLICKYDFISLQCQQVVRVALSAVDTISCGEFQFPPKSLNNWKASRLS"
FT   gap             6431696..6431718
FT                   /estimated_length=23
FT   gene            6434088..6542421
FT                   /locus_tag="mCG_130928"
FT                   /note="gene_id=mCG130928.0"
FT   mRNA            join(6434088..6434488,6440379..6440513,6446577..6446686,
FT                   6490684..6490806,6508997..6509119,6516090..6516215,
FT                   6517490..6517612,6518793..6518915,6519088..6519225,
FT                   6519689..6519808,6520378..6520500,6520932..6521102,
FT                   6521365..6521496,6522751..6522879,6524845..6524973,
FT                   6525604..6525738,6525825..6525959,6529246..6529371,
FT                   6529902..6530033,6530125..6530253,6530378..6530509,
FT                   6531784..6531912,6532001..6532129,6532374..6532502,
FT                   6532848..6532976,6533165..6533293,6533904..6534032,
FT                   6534147..6534275,6534370..6534501,6534648..6534776,
FT                   6535290..6535418,6536361..6536489,6536607..6536735,
FT                   6537116..6537244,6537337..6537465,6538319..6538447,
FT                   6540516..6542421)
FT                   /locus_tag="mCG_130928"
FT                   /product="mCG130928"
FT                   /note="gene_id=mCG130928.0 transcript_id=mCT132256.1
FT                   created on 16-DEC-2002"
FT   CDS             join(6434370..6434488,6440379..6440513,6446577..6446686,
FT                   6490684..6490806,6508997..6509119,6516090..6516215,
FT                   6517490..6517612,6518793..6518915,6519088..6519225,
FT                   6519689..6519808,6520378..6520500,6520932..6521102,
FT                   6521365..6521496,6522751..6522879,6524845..6524973,
FT                   6525604..6525738,6525825..6525959,6529246..6529371,
FT                   6529902..6530033,6530125..6530253,6530378..6530509,
FT                   6531784..6531912,6532001..6532129,6532374..6532502,
FT                   6532848..6532976,6533165..6533293,6533904..6534032,
FT                   6534147..6534275,6534370..6534501,6534648..6534776,
FT                   6535290..6535418,6536361..6536489,6536607..6536735,
FT                   6537116..6537244,6537337..6537465,6538319..6538447,
FT                   6540516..6540583)
FT                   /codon_start=1
FT                   /locus_tag="mCG_130928"
FT                   /product="mCG130928"
FT                   /note="gene_id=mCG130928.0 transcript_id=mCT132256.1
FT                   protein_id=mCP76723.1"
FT                   /protein_id="EDL14962.1"
FT                   /translation="MPVGVEARASWRVVALTLLLLPAVPAASQPLPPRPLQPSMPHVCA
FT                   EQKLTLVGHRQPCVQAFSRVVPVWRSGCGQQAWCVGQERRTVYYMSYRQVYATEARTVF
FT                   RCCPGWSQKPGQEGCLSDVDECANANGGCEGPCCNTVGGFYCRCPPGYQLQGDGKTCQD
FT                   VDECRSYNGGCQHRCVNTPGSYLCECKPGFRLHTDGRTCLAISSCTLGNGGCQHQCVQL
FT                   TVTQHRCQCRPQYQLQEDGRRCVRRSPCADGNGGCMHTCQELRGLAHCGCHPGYQLAAD
FT                   RKACEDVDECALGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAG
FT                   NGGCSHGCSHTSTGPLCTCPRGYELDEDQKTCIDIDDCANSPCCQQVCANTPGGYECSC
FT                   FAGYRLNTDGCGCEDVDECASGHSGCEHHCSNLAGSFQCFCEAGYRLDEDRRGCTPLEE
FT                   SVVDLDGQLPFVRPLPHIAVLGDELPQLFQDDYGAEEEAVAELRGEHTLTEKFVCLDHS
FT                   FGHDCSLICDDCRNGGTCFPGLDGCDCPEGWTGIICNETCPPDTFGKNCSSPCICQNGG
FT                   TCDPVSGACRCPPGVSGAHCEDGCPKGFYGKHCRKKCHCANRGRCHRLYGACLCDPGLY
FT                   GRFCHLACPPWAFGPGCSEDCLCEQSHTRSCNSKDGSCSCKAGFQGERCEAECEPGSFG
FT                   PGCRNRCTCRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPC
FT                   HRVTGECLCPPGKTGEDCGADCPEGRWGLGCQEICPACEHGASCDPETGTCLCLPGFVG
FT                   SRCQDACPAGWFGTGCQMRCACANDGHCHPATGRCSCAPGWTGLSCQRACDSGHWGPDC
FT                   IHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFGPGCEQKCRCEHGATCDHV
FT                   SGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSCICPAGRWGPHCA
FT                   QTCPPLTFGLNCSQICTCFNGASCDPVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSC
FT                   LCRNGGSCDPILGQCTCPEGWTGLACENECLPGHHGAGCRLNCSCLNGGTCDRLTGHCR
FT                   CPAGWTGDKCQSPCVSGMFGVHCEEHCACRKGATCHHVTGACLCPPGWRGSHCEQACPR
FT                   GWFGEACAQRCHCPPGASCHHVSGECHCPPGFTGPGCEQACQPGTFGKDCEHPCQCPGE
FT                   TWACHPASGACVCAAGYHGTDCQQRCPSGRYGPGCEQICKCLNGGTCDPATGACYCPAG
FT                   FLGADCSLACPQGRFGPSCAHVCTCGQGAACDPVSGTCICPPGKTGGHCERGCPQDRFG
FT                   KGCEHKCACRNGGLCHATNGSCSCPLGWMGPHCEHACPAGRYGAACLLECSCQNNGSCE
FT                   PTSGACLCGPGFYGQACEDTCPAGFHGSGCQRVCECQQGAPCDPVSGRCLCPAGFRGQF
FT                   CERGCKPGFFGDGCLQQCNCPTGVPCDPISGLCLCPPGRAGTTCDLDCRRGRFGPGCAL
FT                   RCDCGGGADCDPISGQCHCVDSYTGPTCREVPTQLSSIRPAPQHSSSKAMKH"
FT   gene            complement(6444946..6445477)
FT                   /pseudo
FT                   /locus_tag="mCG_17926"
FT                   /note="gene_id=mCG17926.1"
FT   mRNA            complement(6444946..6445477)
FT                   /pseudo
FT                   /locus_tag="mCG_17926"
FT                   /note="gene_id=mCG17926.1 transcript_id=mCT17680.1 created
FT                   on 27-DEC-2002"
FT   gap             6454906..6457100
FT                   /estimated_length=2195
FT   gap             6458430..6458449
FT                   /estimated_length=20
FT   gap             6476029..6478040
FT                   /estimated_length=2012
FT   gap             6497382..6497552
FT                   /estimated_length=171
FT   gap             6504548..6504567
FT                   /estimated_length=20
FT   gap             6513627..6513646
FT                   /estimated_length=20
FT   gap             6515908..6515927
FT                   /estimated_length=20
FT   gap             6520669..6520846
FT                   /estimated_length=178
FT   gene            complement(6545177..6554700)
FT                   /locus_tag="mCG_3923"
FT                   /note="gene_id=mCG3923.2"
FT   mRNA            complement(join(6545177..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6549345,6549445..6549597,
FT                   6551670..6551830,6552299..6552355,6553604..6554700))
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, transcript variant mCT185170"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT185170.0 created
FT                   on 27-MAY-2003"
FT   mRNA            complement(join(6545178..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6548780,6549216..6549345,
FT                   6549445..6549597,6551670..6551868,6552299..6552355,
FT                   6553561..6553773,6554653..>6554699))
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, transcript variant mCT2923"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT2923.2 created on
FT                   27-MAY-2003"
FT   mRNA            complement(join(6545233..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6548780,6549216..6549345,
FT                   6549445..6549597,6551670..6551830,6552299..6552355,
FT                   6553604..>6553669))
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, transcript variant mCT190897"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT190897.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6545656..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6548780,6549216..6549345,
FT                   6549445..6549597,6551670..6551868,6552299..6552355,
FT                   6553561..6553773,6554653..>6554698))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, isoform CRA_c"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT2923.2
FT                   protein_id=mCP21691.2 isoform=CRA_c"
FT                   /protein_id="EDL14965.1"
FT                   /translation="KTLGRKRAHKGSFKDDPQLYQEIRERGLNTSHESDDDILDEPSGP
FT                   VGTQRADTTIVVKSYRPAQLTWSQLPEVSRPTPILNIQGDPGAGVRCPGHAVNGRTEEA
FT                   GELIHHSEHRLLMQAIFEILTSEFSYLHSLSILVTEFLQSRELRATMTQTEHHHLFSNI
FT                   LDVMSASQKFFEALEQRHKAQVCVEDISDILEDHAQHHFHPYIAYCSNEVYQQRTLQKL
FT                   SNSNAAFRDVLKEIEKRPACGGLPMISFLILPMQRVTRLPLLTDTLCLKTQGHPERYKA
FT                   ASQALKAISKLVKQCNEGAHKMERTEQIYTLNMQLDFGKVKSLPLISASRWLLKRGELF
FT                   LLEESSIFRKIASRPTCYLFLFNDVLVVTKKKSEESYLVQDYAQLDHVQVRKLEPSEPL
FT                   LPGGSSRSSSVPYPFQVNLLHNSEGRQEQILLSSDSASDRARWITALTYKERQWQGITN
FT                   KGELPQVEVTKAYFAKQADEITLQQADIVLVLQEEDGWLHGERLRDGETGWFPESFAHS
FT                   ITSRVAVEGNVRRMERLRVETDV"
FT   CDS             complement(join(6545656..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6548780,6549216..6549345,
FT                   6549445..6549597,6551670..6551830,6552299..6552355,
FT                   6553604..>6553669))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, isoform CRA_b"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT190897.0
FT                   protein_id=mCP111855.0 isoform=CRA_b"
FT                   /protein_id="EDL14964.1"
FT                   /translation="ADTTIVVKSYRPAQLTWSQLPEVLESGVLDTLSTEERKRQEAIFE
FT                   ILTSEFSYLHSLSILVTEFLQSRELRATMTQTEHHHLFSNILDVMSASQKFFEALEQRH
FT                   KAQVCVEDISDILEDHAQHHFHPYIAYCSNEVYQQRTLQKLSNSNAAFRDVLKEIEKRP
FT                   ACGGLPMISFLILPMQRVTRLPLLTDTLCLKTQGHPERYKAASQALKAISKLVKQCNEG
FT                   AHKMERTEQIYTLNMQLDFGKVKSLPLISASRWLLKRGELFLLEESSIFRKIASRPTCY
FT                   LFLFNDVLVVTKKKSEESYLVQDYAQLDHVQVRKLEPSEPLLPGGSSRSSSVPYPFQVN
FT                   LLHNSEGRQEQILLSSDSASDRARWITALTYKERQWQGITNKGELPQVEVTKAYFAKQA
FT                   DEITLQQADIVLVLQEEDGWLHGERLRDGETGWFPESFAHSITSRVAVEGNVRRMERLR
FT                   VETDV"
FT   CDS             complement(join(6549120..6549345,6549445..6549597,
FT                   6551670..6551830,6552299..6552355,6553604..6553858))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, isoform CRA_a"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT185170.0
FT                   protein_id=mCP106428.0 isoform=CRA_a"
FT                   /protein_id="EDL14963.1"
FT                   /translation="MFLRALWGPWEGHATPKSSCRQVALLSRDPQLYQEIRERGLNTSH
FT                   ESDDDILDEPSGPVGTQRADTTIVVKSYRPAQLTWSQLPEVLESGVLDTLSTEERKRQE
FT                   AIFEILTSEFSYLHSLSILVTEFLQSRELRATMTQTEHHHLFSNILDVMSASQKFFEAL
FT                   EQRHKAQVCVEDISDILEDHAQHHFHPYIAYCSNEVYQQRTLQKLSNSNAAFRDVLKEI
FT                   EKRPACGGLPMISFLILPMQRVTRLPLLTDVSIGGGLGVAMKTHLEAPPASLTSFLTLT
FT                   DL"
FT   gap             6549396..6549415
FT                   /estimated_length=20
FT   gap             6555403..6564071
FT                   /estimated_length=8669
FT   gap             6569283..6569392
FT                   /estimated_length=110
FT   gap             6575707..6575921
FT                   /estimated_length=215
FT   gene            complement(6581825..>6786826)
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /note="gene_id=mCG3922.2"
FT   mRNA            complement(join(6581825..6582457,6583806..6583980,
FT                   6584782..6584901,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599131,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628690,
FT                   6732422..6732469,6786477..6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT2924"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT2924.2 created on
FT                   16-DEC-2002"
FT   mRNA            complement(join(6581826..6582457,6583806..6583980,
FT                   6584782..6585015,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599128,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628693,
FT                   6732422..6732469,6786477..>6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT190892"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190892.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6581827..6582457,6583806..6583980,
FT                   6584782..6585015,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599128,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628690,
FT                   6732422..6732469,6786477..>6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT190895"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190895.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6581833..6582457,6584782..6585015,
FT                   6589666..6589840,6590083..6590252,6595794..6595871,
FT                   6596494..6596663,6599044..6599128,6602122..6603538,
FT                   6606723..6606876,6607396..6607543,6609325..6609535,
FT                   6616668..6616770,6628556..6628693,6732422..6732472,
FT                   6786477..>6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT190894"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190894.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6581833..6582457,6584782..6585015,
FT                   6589666..6589840,6590083..6590252,6595794..6595871,
FT                   6596494..6596663,6599044..6599131,6602122..6603538,
FT                   6606723..6606876,6607396..6607543,6609325..6609535,
FT                   6616668..6616770,6628556..6628693,6732422..6732472,
FT                   6786477..>6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT190893"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190893.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6582323..6582457,6583806..6583980,
FT                   6584782..6585015,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599128,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628690,
FT                   6732422..6732469,6786477..>6786824))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_d"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190895.0
FT                   protein_id=mCP111854.0 isoform=CRA_d"
FT                   /protein_id="EDL14969.1"
FT                   /translation="DGDVVNNMYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSE
FT                   DFTPKEGSPYEAPVYIPEDIPIPPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTP
FT                   RAALKEADFGWEMLTDTEVSSQESCIKKISEDLGSEKFCVDANQAGSGSWLKYIRVACS
FT                   CDDQNLAMCQINEQIYYKVIKDIEPGEELLVHVKEGAYSLGVMAPSLDEDPTFRCDECD
FT                   ELFQCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQAHECKDCERMFPNKY
FT                   SLEQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQ
FT                   RHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRH
FT                   KRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMMDK
FT                   TKPSPTLNHGGLGFSEYFPSRPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPLLP
FT                   PTPLLKSPLNHAQDAKLPSPLGNPALPLVSAVSNSSQGATAATGSEEKFDGRLEDAYAE
FT                   KVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLDSDRDKGKDKGKPVESKPE
FT                   FGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIASIAEKYFGPG
FT                   FMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPQDALKVGG
FT                   PSAECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPRKN
FT                   HVYGERKPGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYRVEKRKVADPVGVLKEK
FT                   YLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPIL
FT                   RKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHN
FT                   KEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTNHLGTSASSPTSESDNH
FT                   ALLDEKEDSYFSEIRNFIANSEMNQASTRMDKRPEIQDLDSNPPCPGSASAKPEDVEEE
FT                   EEEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTMGFDHTRRCVEERGG
FT                   GLLALEPTPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEVLKQTLYRQAKNQAYAMMLSL
FT                   SEDTPLHAPSQSSLDAWLNITGPSSESGAFNPINHL"
FT   CDS             complement(join(6582323..6582457,6583806..6583980,
FT                   6584782..6585015,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599128,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628693,
FT                   6732422..6732469,6786477..>6786824))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_a"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190892.0
FT                   protein_id=mCP111851.0 isoform=CRA_a"
FT                   /protein_id="EDL14966.1"
FT                   /translation="DGDVVNNMYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSE
FT                   DFTPKEGSPYEAPVYIPEDIPIPPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTP
FT                   RAALKEADFGWEMLTDTEVSSQESCIKKQISEDLGSEKFCVDANQAGSGSWLKYIRVAC
FT                   SCDDQNLAMCQINEQIYYKVIKDIEPGEELLVHVKEGAYSLGVMAPSLDEDPTFRCDEC
FT                   DELFQCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQAHECKDCERMFPNK
FT                   YSLEQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNL
FT                   QRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCR
FT                   HKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMMD
FT                   KTKPSPTLNHGGLGFSEYFPSRPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPLL
FT                   PPTPLLKSPLNHAQDAKLPSPLGNPALPLVSAVSNSSQGATAATGSEEKFDGRLEDAYA
FT                   EKVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLDSDRDKGKDKGKPVESKP
FT                   EFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIASIAEKYFGP
FT                   GFMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPQDALKVG
FT                   GPSAECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPRK
FT                   NHVYGERKPGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYRVEKRKVADPVGVLKE
FT                   KYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPI
FT                   LRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIH
FT                   NKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTNHLGTSASSPTSESDN
FT                   HALLDEKEDSYFSEIRNFIANSEMNQASTRMDKRPEIQDLDSNPPCPGSASAKPEDVEE
FT                   EEEEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTMGFDHTRRCVEERG
FT                   GGLLALEPTPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEVLKQTLYRQAKNQAYAMMLS
FT                   LSEDTPLHAPSQSSLDAWLNITGPSSESGAFNPINHL"
FT   CDS             complement(join(6582323..6582457,6583806..6583980,
FT                   6584782..6584901,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599131,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628690,
FT                   6732422..6732469,6786477..6786803))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_e"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT2924.2
FT                   protein_id=mCP21775.2 isoform=CRA_e"
FT                   /protein_id="EDL14970.1"
FT                   /translation="MYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSEDFTPKEG
FT                   SPYEAPVYIPEDIPIPPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTPRAALKEA
FT                   DFGWEMLTDTEVSSQESCIKKISEDLGSEKFCVDANQAGSGSWLKYIRVACSCDDQNLA
FT                   MCQINEQIYYKVIKDIEPGEELLVHVKEGAYSLGVMAPSLDEDPTFRCDECDELFQCRL
FT                   DLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQAHECKDCERMFPNKYSLEQHMI
FT                   VHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQH
FT                   VGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADC
FT                   RTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMMDKTKPSPTL
FT                   NHGGLGFSEYFPSRPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPLLPPTPLLKS
FT                   PLNHAQDAKLPSPLGNPALPLVSAVSNSSQGATAATGSEEKFDGRLEDAYAEKVKNRSP
FT                   DMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLDSDRDKGKDKGKPVESKPEFGGASVP
FT                   PGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIASIAEKYFGPGFMSMQEK
FT                   KLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPQDALKVGGPSAECPF
FT                   DLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERK
FT                   PGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYSRVEKRKVADPVGVLKEKYLRPSP
FT                   LLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKER
FT                   YTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFK
FT                   CHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTNHLGTSASSPTSESDNHALLDEK
FT                   EDSYFSEIRNFIANSEMNQASTRMDKRLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLT
FT                   MGFDHTRRCVEERGGGLLALEPTPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEVLKQTL
FT                   YRQAKNQAYAMMLSLSEDTPLHAPSQSSLDAWLNITGPSSESGAFNPINHL"
FT   CDS             complement(join(6582445..6582457,6584782..6585015,
FT                   6589666..6589840,6590083..6590252,6595794..6595871,
FT                   6596494..6596663,6599044..6599128,6602122..6603538,
FT                   6606723..6606876,6607396..6607543,6609325..6609535,
FT                   6616668..6616770,6628556..6628693,6732422..6732472,
FT                   6786477..>6786824))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_c"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190894.0
FT                   protein_id=mCP111853.0 isoform=CRA_c"
FT                   /protein_id="EDL14968.1"
FT                   /translation="DGDVVNNMYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSE
FT                   DFTPKEGSPYEAPVYIPEDIPIPPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTP
FT                   RAALKEADFGWEQMLTDTEVSSQESCIKKQISEDLGSEKFCVDANQAGSGSWLKYIRVA
FT                   CSCDDQNLAMCQINEQIYYKVIKDIEPGEELLVHVKEGAYSLGVMAPSLDEDPTFRCDE
FT                   CDELFQCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQAHECKDCERMFPN
FT                   KYSLEQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSN
FT                   LQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLC
FT                   RHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMM
FT                   DKTKPSPTLNHGGLGFSEYFPSRPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPL
FT                   LPPTPLLKSPLNHAQDAKLPSPLGNPALPLVSAVSNSSQGATAATGSEEKFDGRLEDAY
FT                   AEKVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLDSDRDKGKDKGKPVESK
FT                   PEFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIASIAEKYFG
FT                   PGFMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPQDALKV
FT                   GGPSAECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPR
FT                   KNHVYGERKPGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYRVEKRKVADPVGVLK
FT                   EKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDP
FT                   ILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNI
FT                   HNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTNHLGTSASSPTSESD
FT                   NHALLDEKEDSYFSEIRNFIANSEMNQASTRMDKRPEIQDLDSNPPCPGSASAKPEDVE
FT                   EEEEEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTMGFDHTRRHMQ"
FT   CDS             complement(join(6582445..6582457,6584782..6585015,
FT                   6589666..6589840,6590083..6590252,6595794..6595871,
FT                   6596494..6596663,6599044..6599131,6602122..6603538,
FT                   6606723..6606876,6607396..6607543,6609325..6609535,
FT                   6616668..6616770,6628556..6628693,6732422..6732472,
FT                   6786477..>6786824))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_b"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190893.0
FT                   protein_id=mCP111852.0 isoform=CRA_b"
FT                   /protein_id="EDL14967.1"
FT                   /translation="DGDVVNNMYEPDPDLLAGQSAEEETEDGILSPIPMGPPSPFPTSE
FT                   DFTPKEGSPYEAPVYIPEDIPIPPDFELRESSIPGAGLGIWAKRKMEIGERFGPYVVTP
FT                   RAALKEADFGWEQMLTDTEVSSQESCIKKQISEDLGSEKFCVDANQAGSGSWLKYIRVA
FT                   CSCDDQNLAMCQINEQIYYKVIKDIEPGEELLVHVKEGAYSLGVMAPSLDEDPTFRCDE
FT                   CDELFQCRLDLRRHKKYACSSAGAQLYEGLGEELKPEGLGVGSDGQAHECKDCERMFPN
FT                   KYSLEQHMIVHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSN
FT                   LQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLC
FT                   RHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGSIFTPGLPLTPSPMM
FT                   DKTKPSPTLNHGGLGFSEYFPSRPHPGSLPFSAAPPAFPALTPGFPGIFPPSLYPRPPL
FT                   LPPTPLLKSPLNHAQDAKLPSPLGNPALPLVSAVSNSSQGATAATGSEEKFDGRLEDAY
FT                   AEKVKNRSPDMSDGSDFEDINTTTGTDLDTTTGTGSDLDSDLDSDRDKGKDKGKPVESK
FT                   PEFGGASVPPGAMNSVAEVPAFYSQHSFFPPPEEQLLTASGAAGDSIKAIASIAEKYFG
FT                   PGFMSMQEKKLGSLPYHSVFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPQDALKV
FT                   GGPSAECPFDLTTKPKEAKPALLAPKVPLIPSSGEEQPLDLSIGSRARASQNGGGREPR
FT                   KNHVYGERKPGVSEGLPKVCPAQLPQQPSLHYAKPSPFFMDPIYSRVEKRKVADPVGVL
FT                   KEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSD
FT                   PILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRN
FT                   IHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHEGAPVSQHSGVLTNHLGTSASSPTSES
FT                   DNHALLDEKEDSYFSEIRNFIANSEMNQASTRMDKRPEIQDLDSNPPCPGSASAKPEDV
FT                   EEEEEEELEEEDDDSLAGKSQEDTVSPTPEPQGVYEDEEDEEPPSLTMGFDHTRRHMQ"
FT   gap             6585589..6585631
FT                   /estimated_length=43
FT   gap             6618216..6618235
FT                   /estimated_length=20
FT   gap             6630571..6630707
FT                   /estimated_length=137
FT   gap             6653854..6653873
FT                   /estimated_length=20
FT   gap             6678204..6691050
FT                   /estimated_length=12847
FT   gap             6719634..6719726
FT                   /estimated_length=93
FT   gap             6732625..6732658
FT                   /estimated_length=34
FT   gap             6741334..6742475
FT                   /estimated_length=1142
FT   gap             6764839..6764858
FT                   /estimated_length=20
FT   gap             6774381..6774400
FT                   /estimated_length=20
FT   gap             6784622..6784727
FT                   /estimated_length=106
FT   gap             6788695..6788809
FT                   /estimated_length=115
FT   gap             6795805..6796089
FT                   /estimated_length=285
FT   gap             6817439..6817458
FT                   /estimated_length=20
FT   gap             6825632..6826472
FT                   /estimated_length=841
FT   gene            6859418..6862424
FT                   /locus_tag="mCG_1027442"
FT                   /note="gene_id=mCG1027442.1"
FT   mRNA            join(6859418..6859629,6862249..6862424)
FT                   /locus_tag="mCG_1027442"
FT                   /product="mCG1027442, transcript variant mCT145146"
FT                   /note="gene_id=mCG1027442.1 transcript_id=mCT145146.1
FT                   created on 13-MAR-2003"
FT   mRNA            join(6859435..6859629,6860282..6860926)
FT                   /locus_tag="mCG_1027442"
FT                   /product="mCG1027442, transcript variant mCT181158"
FT                   /note="gene_id=mCG1027442.1 transcript_id=mCT181158.0
FT                   created on 13-MAR-2003"
FT   CDS             join(6859472..6859629,6862249..6862378)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027442"
FT                   /product="mCG1027442, isoform CRA_a"
FT                   /note="gene_id=mCG1027442.1 transcript_id=mCT145146.1
FT                   protein_id=mCP76827.1 isoform=CRA_a"
FT                   /protein_id="EDL14971.1"
FT                   /translation="MPLVSWSLEKQSALLHPKPCCSLKTLGDLALWGSPFSGGLTVLST
FT                   PGREQRGRIAEASPAAGLGFPDGRCSPSRLEGAWTSTRPCGVVRLPIQHR"
FT   CDS             join(6859472..6859629,6860282..6860306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027442"
FT                   /product="mCG1027442, isoform CRA_b"
FT                   /note="gene_id=mCG1027442.1 transcript_id=mCT181158.0
FT                   protein_id=mCP104080.0 isoform=CRA_b"
FT                   /protein_id="EDL14972.1"
FT                   /translation="MPLVSWSLEKQSALLHPKPCCSLKTLGDLALWGSPFSGGLTVLST
FT                   PGREQRGRLPRAVFL"
FT   gap             6894601..6895700
FT                   /estimated_length=1100
FT   gene            6895701..6902763
FT                   /locus_tag="mCG_147515"
FT                   /note="gene_id=mCG147515.0"
FT   mRNA            join(6895701..6895844,6899455..6902763)
FT                   /locus_tag="mCG_147515"
FT                   /product="mCG147515"
FT                   /note="gene_id=mCG147515.0 transcript_id=mCT187778.0
FT                   created on 13-JAN-2004"
FT   CDS             6901544..6901804
FT                   /codon_start=1
FT                   /locus_tag="mCG_147515"
FT                   /product="mCG147515"
FT                   /note="gene_id=mCG147515.0 transcript_id=mCT187778.0
FT                   protein_id=mCP109475.0"
FT                   /protein_id="EDL14973.1"
FT                   /translation="MFISPQERFLNTLLASLLKPGRAVSKDRLSWVWTCVWGGEGGSCN
FT                   LIRPYFFGTFCQLLSSPEPCSLVTWGEWVGAPGSTLATAFR"
FT   gap             6903516..6903535
FT                   /estimated_length=20
FT   gene            <6903541..6904159
FT                   /locus_tag="mCG_1027444"
FT                   /note="gene_id=mCG1027444.1"
FT   mRNA            join(<6903541..6903917,6904043..6904159)
FT                   /locus_tag="mCG_1027444"
FT                   /product="mCG1027444"
FT                   /note="gene_id=mCG1027444.1 transcript_id=mCT145148.1
FT                   created on 13-MAR-2003"
FT   CDS             <6903541..6903750
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027444"
FT                   /product="mCG1027444"
FT                   /note="gene_id=mCG1027444.1 transcript_id=mCT145148.1
FT                   protein_id=mCP76675.1"
FT                   /protein_id="EDL14974.1"
FT                   /translation="EHPLSSILDALLFVSSHRNNVALGHPGRARSKWQEHLFPLQLRKK
FT                   KAGLHPRARSTPGCCSQPLRSGEF"
FT   gene            complement(6904212..6913783)
FT                   /locus_tag="mCG_147517"
FT                   /note="gene_id=mCG147517.0"
FT   mRNA            complement(join(6904212..6907094,6913253..6913783))
FT                   /locus_tag="mCG_147517"
FT                   /product="mCG147517"
FT                   /note="gene_id=mCG147517.0 transcript_id=mCT187780.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6906428..6906787)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147517"
FT                   /product="mCG147517"
FT                   /note="gene_id=mCG147517.0 transcript_id=mCT187780.0
FT                   protein_id=mCP109476.0"
FT                   /protein_id="EDL14975.1"
FT                   /translation="MQELPGGGCGYGEDHSGTSESCFTRMRVKKIWGTGQRSYLPSMPL
FT                   GYIPLCRWVTSHFSVSYSQMCLLLPLPVLGLEYQGCDSLLQELAGSGITAEVYISPREH
FT                   REQEKNCPGLEDRAP"
FT   gap             6923172..6923191
FT                   /estimated_length=20
FT   gene            complement(6924904..6926181)
FT                   /gene="Actrt2"
FT                   /locus_tag="mCG_3936"
FT                   /note="gene_id=mCG3936.0"
FT   mRNA            complement(6924904..6926181)
FT                   /gene="Actrt2"
FT                   /locus_tag="mCG_3936"
FT                   /product="actin-related protein T2"
FT                   /note="gene_id=mCG3936.0 transcript_id=mCT2913.1 created on
FT                   06-DEC-2002"
FT   CDS             complement(6925013..6926146)
FT                   /codon_start=1
FT                   /gene="Actrt2"
FT                   /locus_tag="mCG_3936"
FT                   /product="actin-related protein T2"
FT                   /note="gene_id=mCG3936.0 transcript_id=mCT2913.1
FT                   protein_id=mCP21761.2"
FT                   /protein_id="EDL14976.1"
FT                   /translation="MFNPLVLDSPSVIFDNGSGLCKAGLSGEIGPRHVTSSVVGYPKFK
FT                   APPTGASQKKYFVGEEALYKQEALSLHYPIDRGLVTSWDDVEKLWRHLFEWELGVKPCE
FT                   RPVLVTEPSLNPRENREKTAEMMFETFEVPAFYLSDQAVLALYSSACVTGLVVDSGDGV
FT                   TCTVPIYEGYSLPHAVSKLYVAGKDITELLTRLLLASGRAFPCPLEKALADDIKEKLCY
FT                   VALEPEEELSRRAEDVLREYKLPDGNVIYIGDQLYQAPEVLFSPDQLGTHGPGLAQMAS
FT                   NSITKCDADIQKTLFGEIVLSGGSTLFQGLDDRLLKELEQLASKGVPIKITAPPDRWFS
FT                   TWIGASIVTSLSSFKQMWITAADFKEFGVSVVQRRCF"
FT   gap             6928525..6928544
FT                   /estimated_length=20
FT   gap             6932320..6932477
FT                   /estimated_length=158
FT   gap             6945639..6945981
FT                   /estimated_length=343
FT   gap             6950276..6950443
FT                   /estimated_length=168
FT   gap             6951909..6952343
FT                   /estimated_length=435
FT   gap             6979704..6979723
FT                   /estimated_length=20
FT   gap             6983793..6983812
FT                   /estimated_length=20
FT   gap             6986019..6986038
FT                   /estimated_length=20
FT   gap             6993199..6994057
FT                   /estimated_length=859
FT   gap             6997201..6997220
FT                   /estimated_length=20
FT   gap             7015311..7015330
FT                   /estimated_length=20
FT   gap             7028099..7028179
FT                   /estimated_length=81
FT   gap             7030206..7030288
FT                   /estimated_length=83
FT   gap             7057388..7057483
FT                   /estimated_length=96
FT   gene            7102406..7118930
FT                   /gene="B230396O12Rik"
FT                   /locus_tag="mCG_147516"
FT                   /note="gene_id=mCG147516.0"
FT   mRNA            join(7102406..7102623,7104128..7104353,7105604..7105808,
FT                   7106857..7107023,7107463..7107733,7108385..7108599,
FT                   7116716..7117261,7117606..7118930)
FT                   /gene="B230396O12Rik"
FT                   /locus_tag="mCG_147516"
FT                   /product="RIKEN cDNA B230396O12"
FT                   /note="gene_id=mCG147516.0 transcript_id=mCT187779.0
FT                   created on 13-JAN-2004"
FT   CDS             join(7102571..7102623,7104128..7104353,7105604..7105808,
FT                   7106857..7107023,7107463..7107733,7108385..7108599,
FT                   7116716..7117243)
FT                   /codon_start=1
FT                   /gene="B230396O12Rik"
FT                   /locus_tag="mCG_147516"
FT                   /product="RIKEN cDNA B230396O12"
FT                   /note="gene_id=mCG147516.0 transcript_id=mCT187779.0
FT                   protein_id=mCP109474.0"
FT                   /protein_id="EDL14977.1"
FT                   /translation="MLLRSPSYAGKAAQAQEGDAYGVYQLATLLIGMDAEDETSCLLAA
FT                   DALYRLGRLDDAHKSLLVALSQRPQAAPVLVRLALLQLRRGFCYDANQLVKKVAQSGDT
FT                   ACLQHMLDIFHHEDLQLLQDHCHTRALSILRARPGGSDSEAHTREAIAYLSLAIFAAGS
FT                   GGSESLLVRARCYGLLGQKKTAMFDFNAILREEPGNVKALCGRALVHLALDQLQEAVDD
FT                   MVSALKLDPGTVTPEILSLKTEVQLPLTQGLYTRCRVLLNQCLHTGVPLREEDTQGLLA
FT                   TGKALIRINATQPSWRLLLTDILTGLGKYQEAGTHLQEALHLTPSSEAAQARQGLLQLK
FT                   KGDVSAAAHGLQCLAERDTQDLGFLLRLLDSPERQSLVQTAAKEASNILDLGNPGQALS
FT                   YCSLAILAGGNNPYHLRLRVACLTQLREYDRALRDLDRVLQHPAEDSDLPRRSEDFCTR
FT                   GRLLLSLGDKDGAAGAFTQALALAPAQAQNSLLEQPGQAMTASVFLIHGQRCLEEQHFE
FT                   EAWTAVQNGLLVDPSHSGLKKLKLRTRKVATSGCRLH"
FT   gene            complement(7111166..7121286)
FT                   /locus_tag="mCG_147506"
FT                   /note="gene_id=mCG147506.0"
FT   mRNA            complement(join(7111166..7111477,7116692..7116719,
FT                   7116818..7116919,7119724..7119880,7120312..7120445,
FT                   7121207..7121286))
FT                   /locus_tag="mCG_147506"
FT                   /product="mCG147506"
FT                   /note="gene_id=mCG147506.0 transcript_id=mCT187769.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(7111347..7111477,7116692..7116719,
FT                   7116818..7116919,7119724..7119747))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147506"
FT                   /product="mCG147506"
FT                   /note="gene_id=mCG147506.0 transcript_id=mCT187769.0
FT                   protein_id=mCP109465.0"
FT                   /protein_id="EDL14978.1"
FT                   /translation="MGTSEWAEVAVLCRVLQHPVQVPECPVILPQLGQAGHPETQMRSV
FT                   KGTQGKKLRVKSLDIVSLCWCLVPSLCRRHPHSGGPVMGRGKGLVSSCD"
FT   gap             7111656..7116464
FT                   /estimated_length=4809
FT   gap             7121287..7121934
FT                   /estimated_length=648
FT   gene            7123181..7146421
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /note="gene_id=mCG3934.1"
FT   mRNA            join(7123181..7123497,7132338..7132406,7132961..7133020,
FT                   7134057..7134218,7134508..7134588,7135830..7135925,
FT                   7136388..7136506,7137035..7137100,7138510..7138644,
FT                   7138720..7138809,7140398..7140534,7140819..7140912,
FT                   7141730..7141858,7142372..7142470,7142835..7142918,
FT                   7143307..7143410,7143715..7143773,7144123..7144242,
FT                   7144722..7144855,7144966..7145031,7145488..7145583,
FT                   7145852..7145928,7146017..7146421)
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, transcript
FT                   variant mCT2911"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT2911.2 created on
FT                   06-DEC-2002"
FT   mRNA            join(7123181..7123497,7132961..7133020,7134057..7134218,
FT                   7134508..7134588,7135830..7135925,7136388..7136506,
FT                   7137035..7137100,7138510..7138644,7138720..7138809,
FT                   7140398..7140534,7140819..7140912,7141730..7141858,
FT                   7142372..7142470,7142835..7142918,7143307..7143410,
FT                   7143715..7143773,7144123..7144242,7144722..7144855,
FT                   7144966..7145031,7145488..7145583,7145852..7145928,
FT                   7146017..7146421)
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, transcript
FT                   variant mCT176826"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT176826.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(7123181..7123497,7132961..7133020,7134057..7134218,
FT                   7134508..7134588,7135830..7135925,7136388..7136506,
FT                   7137035..7137100,7138510..7138644,7138720..7138809,
FT                   7140087..7140196,7140398..7140534,7140819..7140912,
FT                   7141730..7141858,7142372..7142470,7142835..7142918,
FT                   7143307..7143410,7143715..7143773,7144123..7144242,
FT                   7144722..7144855,7144966..7145031,7145488..7145583,
FT                   7145852..7145928,7146017..7146412)
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, transcript
FT                   variant mCT176825"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT176825.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(7123377..7123497,7132338..7132406,7132961..7133020,
FT                   7134057..7134218,7134508..7134588,7135830..7135925,
FT                   7136388..7136506,7137035..7137100,7138510..7138644,
FT                   7138720..7138809,7140398..7140534,7140819..7140912,
FT                   7141730..7141858,7142372..7142470,7142835..7142918,
FT                   7143307..7143410,7143715..7143773,7144123..7144242,
FT                   7144722..7144855,7144966..7145031,7145488..7145583,
FT                   7145852..7145928,7146017..7146116)
FT                   /codon_start=1
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT2911.2
FT                   protein_id=mCP21746.1 isoform=CRA_c"
FT                   /protein_id="EDL14981.1"
FT                   /translation="MVERAGWCRKKSPGFVEYGLMVLLLLLLGAIVTLGVFYSIGKQLP
FT                   LLTSLLHFSWDERTVVKRALRDSSLKSDICTTPSCVIAAARILENMDQSRNPCENFYQY
FT                   ACGGWLRHHVIPETNSRYSVFDILRDELEVILKGVLEDSTSQHRPAVEKAKTLYRSCMN
FT                   QSVIEKRDSEPLLSVLKMVGGWPVAMDKWNETMGLKWELERQLAVLNSQFNRRVLIDLF
FT                   IWNDDQNSSRHVIYIDQPTLGMPSREYYFQEDNNHKVRKAYLEFMTSVATMLRKDQNLS
FT                   KESAMVREEMAEVLELETHLANATVPQEKRHDVTALYHRMDLMELQERFGLKGFNWTLF
FT                   IQNVLSSVEVELFPDEEVVVYGIPYLENLEDIIDSYSARTMQNYLVWRLVLDRIGSLSQ
FT                   RFKEARVDYRKALYGTTVEEVRWRECVSYVNSNMESAVGSLYIKRAFSKDSKSTVRELI
FT                   EKIRSVFVDNLDELNWMDEESKKKAQEKAMNIREQIGYPDYILEDNNKHLDEEYSSLTF
FT                   YEDLYFENGLQNLKNNAQRSLKKLREKVDQNLWIIGAAVVNAFYSPNRNQIVFPAGILQ
FT                   PPFFSKDQPQSLNFGGIGMVIGHEITHGFDDNGRNFDKNGNMLDWWSNFSARHFQQQSQ
FT                   CMIYQYGNFSWELADNQNVNGFSTLGENIADNGGVRQAYKAYLRWLADGGKDQRLPGLN
FT                   LTYAQLFFINYAQVWCGSYRPEFAVQSIKTDVHSPLKYRVLGSLQNLPGFSEAFHCPRG
FT                   SPMHPMKRCRIW"
FT   CDS             join(7123377..7123497,7132961..7133020,7134057..7134218,
FT                   7134508..7134588,7135830..7135925,7136388..7136506,
FT                   7137035..7137100,7138510..7138644,7138720..7138809,
FT                   7140398..7140534,7140819..7140912,7141730..7141858,
FT                   7142372..7142470,7142835..7142918,7143307..7143410,
FT                   7143715..7143773,7144123..7144242,7144722..7144855,
FT                   7144966..7145031,7145488..7145583,7145852..7145928,
FT                   7146017..7146116)
FT                   /codon_start=1
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT176826.0
FT                   protein_id=mCP99747.0 isoform=CRA_b"
FT                   /db_xref="GOA:B2RPX5"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1351603"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPX5"
FT                   /protein_id="EDL14980.1"
FT                   /translation="MVERAGWCRKKSPGFVEYGLMVLLLLLLGAIVTLGVFYSIALRDS
FT                   SLKSDICTTPSCVIAAARILENMDQSRNPCENFYQYACGGWLRHHVIPETNSRYSVFDI
FT                   LRDELEVILKGVLEDSTSQHRPAVEKAKTLYRSCMNQSVIEKRDSEPLLSVLKMVGGWP
FT                   VAMDKWNETMGLKWELERQLAVLNSQFNRRVLIDLFIWNDDQNSSRHVIYIDQPTLGMP
FT                   SREYYFQEDNNHKVRKAYLEFMTSVATMLRKDQNLSKESAMVREEMAEVLELETHLANA
FT                   TVPQEKRHDVTALYHRMDLMELQERFGLKGFNWTLFIQNVLSSVEVELFPDEEVVVYGI
FT                   PYLENLEDIIDSYSARTMQNYLVWRLVLDRIGSLSQRFKEARVDYRKALYGTTVEEVRW
FT                   RECVSYVNSNMESAVGSLYIKRAFSKDSKSTVRELIEKIRSVFVDNLDELNWMDEESKK
FT                   KAQEKAMNIREQIGYPDYILEDNNKHLDEEYSSLTFYEDLYFENGLQNLKNNAQRSLKK
FT                   LREKVDQNLWIIGAAVVNAFYSPNRNQIVFPAGILQPPFFSKDQPQSLNFGGIGMVIGH
FT                   EITHGFDDNGRNFDKNGNMLDWWSNFSARHFQQQSQCMIYQYGNFSWELADNQNVNGFS
FT                   TLGENIADNGGVRQAYKAYLRWLADGGKDQRLPGLNLTYAQLFFINYAQVWCGSYRPEF
FT                   AVQSIKTDVHSPLKYRVLGSLQNLPGFSEAFHCPRGSPMHPMKRCRIW"
FT   CDS             join(7123377..7123497,7132961..7133020,7134057..7134218,
FT                   7134508..7134588,7135830..7135925,7136388..7136506,
FT                   7137035..7137100,7138510..7138644,7138720..7138809,
FT                   7140087..7140134)
FT                   /codon_start=1
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT176825.0
FT                   protein_id=mCP99748.0 isoform=CRA_a"
FT                   /protein_id="EDL14979.1"
FT                   /translation="MVERAGWCRKKSPGFVEYGLMVLLLLLLGAIVTLGVFYSIALRDS
FT                   SLKSDICTTPSCVIAAARILENMDQSRNPCENFYQYACGGWLRHHVIPETNSRYSVFDI
FT                   LRDELEVILKGVLEDSTSQHRPAVEKAKTLYRSCMNQSVIEKRDSEPLLSVLKMVGGWP
FT                   VAMDKWNETMGLKWELERQLAVLNSQFNRRVLIDLFIWNDDQNSSRHVIYIDQPTLGMP
FT                   SREYYFQEDNNHKVRKAYLEFMTSVATMLRKDQNLSKESAMVREEMAEVLELETHLANA
FT                   TVPQEKRHDVTALYHRMDLMELQERFGLKTGFLCVALDVLELTL"
FT   gap             7123580..7124389
FT                   /estimated_length=810
FT   gap             7129201..7129220
FT                   /estimated_length=20
FT   gene            complement(7147296..7149953)
FT                   /gene="2810405K02Rik"
FT                   /locus_tag="mCG_3932"
FT                   /note="gene_id=mCG3932.1"
FT   mRNA            complement(join(7147296..7147488,7147931..7148049,
FT                   7148240..7148315,7148397..7148460,7149019..7149070,
FT                   7149367..7149571,7149834..7149953))
FT                   /gene="2810405K02Rik"
FT                   /locus_tag="mCG_3932"
FT                   /product="RIKEN cDNA 2810405K02"
FT                   /note="gene_id=mCG3932.1 transcript_id=mCT2921.1 created on
FT                   06-DEC-2002"
FT   CDS             complement(join(7147462..7147488,7147931..7148049,
FT                   7148240..7148315,7148397..7148460,7149019..7149070,
FT                   7149367..7149571,7149834..7149896))
FT                   /codon_start=1
FT                   /gene="2810405K02Rik"
FT                   /locus_tag="mCG_3932"
FT                   /product="RIKEN cDNA 2810405K02"
FT                   /note="gene_id=mCG3932.1 transcript_id=mCT2921.1
FT                   protein_id=mCP21738.1"
FT                   /protein_id="EDL14982.1"
FT                   /translation="MNVVDLGRVGACVLKHAVTGEAVELRSLWQEKACVVAGLRRFGCM
FT                   VCRWIAQDLSNLRSILDQHDVRLVGVGPEALGLQEFLDGGYFSGELYLDESKQIYKELG
FT                   FKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFI
FT                   QKSPGDYVPQENILQALGISAEVCSSKPPQCDEEVCGR"
FT   gap             7158133..7158263
FT                   /estimated_length=131
FT   gene            complement(7173020..7179520)
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /note="gene_id=mCG3935.2"
FT   mRNA            complement(join(7173020..7173283,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7177552..7177677,7178092..7178200,7178931..7179068,
FT                   7179467..7179520))
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), transcript variant
FT                   mCT2912"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT2912.2 created on
FT                   27-DEC-2002"
FT   mRNA            complement(join(<7173200..7173280,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7177552..7177677,7178092..7178200,7178931..>7178999))
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), transcript variant
FT                   mCT190874"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT190874.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7173200..7173280,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7177552..7177677,7178092..7178200,7178931..7178999))
FT                   /codon_start=1
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), isoform CRA_b"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT190874.0
FT                   protein_id=mCP111859.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3SXX1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR022332"
FT                   /db_xref="MGI:MGI:2675303"
FT                   /db_xref="UniProtKB/TrEMBL:Q3SXX1"
FT                   /protein_id="EDL14984.1"
FT                   /translation="MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQE
FT                   EFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMG
FT                   LLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCA
FT                   DCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVG
FT                   VGIAGFLICTRRHLHTSSVAKELEPFQEQQENTIRFPVTEVGFAETEEETASN"
FT   CDS             complement(join(7173200..7173283,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7177552..7177677,7178092..7178200,7178931..7178999))
FT                   /codon_start=1
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), isoform CRA_c"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT2912.2
FT                   protein_id=mCP21680.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q71F55"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR022332"
FT                   /db_xref="MGI:MGI:2675303"
FT                   /db_xref="UniProtKB/TrEMBL:Q71F55"
FT                   /protein_id="EDL14985.1"
FT                   /translation="MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQE
FT                   EFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMG
FT                   LLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCA
FT                   DCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVG
FT                   VGIAGFLICTRRHLHTSSVAKELEPFQQEQQENTIRFPVTEVGFAETEEETASN"
FT   mRNA            complement(join(<7173217..7173280,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7178931..7179068,7179467..>7179506))
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), transcript variant
FT                   mCT190873"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT190873.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<7173217..7173280,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7178931..>7179060))
FT                   /codon_start=1
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), isoform CRA_a"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT190873.0
FT                   protein_id=mCP111858.0 isoform=CRA_a"
FT                   /protein_id="EDL14983.1"
FT                   /translation="ECVRRFRAHGALGLKFLDQENGTSPRMGVGTLEPGPYRQHLQADM
FT                   GLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVC
FT                   ADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIV
FT                   GVGIAGFLICTRRHLHTSSVAKELEPFQEQQENTIRFPVTEVGFAETEE"
FT   gap             7193203..7193222
FT                   /estimated_length=20
FT   gap             7198201..7198220
FT                   /estimated_length=20
FT   gap             7206760..7206917
FT                   /estimated_length=158
FT   gap             7209952..7209971
FT                   /estimated_length=20
FT   gap             7211894..7212039
FT                   /estimated_length=146
FT   gene            <7212426..>7213105
FT                   /gene="Hes5"
FT                   /locus_tag="mCG_3930"
FT                   /note="gene_id=mCG3930.0"
FT   mRNA            join(<7212426..7212479,7212566..7212731,7212822..>7213105)
FT                   /gene="Hes5"
FT                   /locus_tag="mCG_3930"
FT                   /product="hairy and enhancer of split 5 (Drosophila)"
FT                   /note="gene_id=mCG3930.0 transcript_id=mCT2919.0 created on
FT                   06-DEC-2002"
FT   CDS             join(7212426..7212479,7212566..7212731,7212822..7213105)
FT                   /codon_start=1
FT                   /gene="Hes5"
FT                   /locus_tag="mCG_3930"
FT                   /product="hairy and enhancer of split 5 (Drosophila)"
FT                   /note="gene_id=mCG3930.0 transcript_id=mCT2919.0
FT                   protein_id=mCP21737.0"
FT                   /db_xref="GOA:Q499J8"
FT                   /db_xref="InterPro:IPR003650"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR018352"
FT                   /db_xref="MGI:MGI:104876"
FT                   /db_xref="UniProtKB/TrEMBL:Q499J8"
FT                   /protein_id="EDL14986.1"
FT                   /translation="MAPSTVAVEMLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQ
FT                   EFARHQPNSKLEKADILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLT
FT                   LHAASDTQMKLLYHFQRPPAPAAPAKEPPAPGAAPQPARSSAKAAAAAVSTSRQPACGL
FT                   WRPW"
FT   gene            <7215563..7232400
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /note="gene_id=mCG3933.2"
FT   mRNA            join(<7215563..7215699,7220540..7220622,7220983..7221197,
FT                   7221404..7221587,7221857..7221949,7222337..7222490,
FT                   7222836..7223017,7223612..7223693,7223932..7224032,
FT                   7226093..7226248,7227725..7227837,7228046..7228133,
FT                   7228666..7228817,7229614..7229669,7229856..7229905,
FT                   7230384..7230488,7230955..7231055,7231189..7231257,
FT                   7231554..7231694,7231958..7232400)
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /product="pantothenate kinase 4, transcript variant
FT                   mCT190870"
FT                   /note="gene_id=mCG3933.2 transcript_id=mCT190870.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7215564..7215699,7220540..7220622,7220983..7221197,
FT                   7221404..7221587,7221857..7221949,7222337..7222490,
FT                   7222836..7223017,7223612..7223693,7223932..7224032,
FT                   7226093..7226248,7227725..7227837,7228046..7228133,
FT                   7228666..7228817,7229614..7229669,7229856..7229905,
FT                   7230384..7230488,7230955..7231055,7231189..7231257,
FT                   7231554..7231694,7231958..7232171)
FT                   /codon_start=1
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /product="pantothenate kinase 4, isoform CRA_a"
FT                   /note="gene_id=mCG3933.2 transcript_id=mCT190870.0
FT                   protein_id=mCP111857.0 isoform=CRA_a"
FT                   /protein_id="EDL14987.1"
FT                   /translation="GTFKMAERGASGGGSGGDSLDKSITLPPDEIFRNLENAKRFAIDI
FT                   GGSLTKLAYYSTVQHKVAKVRSFDHPGKDVEQDHEPPYEISVQEEITARLHFIKFENTY
FT                   MEACLDFIRDHLVNTETKVIQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVL
FT                   KNIPHEAFMYQKDADPEFRFQTNHPNIFPYLLVNIGSGVSIVKVETEDRFEWIGGSSIG
FT                   GGTFWGLGALLTKTKKFDELLQLASRGRHANVDMLVQDIYGGAHQTLGLSGNLIASSFG
FT                   KSATADREFSKEDMAKSLLHMISNDIGQLACLYAKLHGLDRVYFGGFFIRGHPVTMRTI
FT                   TYSINFFSKGEVQALFLRHEGYLGAIGAFLKGAEQDNPNQYSWGENYAASSGLMSTSPE
FT                   LCPTQRARSGTFDLLEMDRLERPLVNLPLLLDPSSYVPDTVDLTDDALARQYWLTCFEE
FT                   ALDGVVKRAVASQPESMDAVERAEKFRQKYWGKLQTLRHQPFAYGTLTVRSLLDTREHC
FT                   LNEFNFPDPYSKVKQKENGLALKCFQSVTRSLDSLGWEERQLALVKGLLAGNVFDWGAK
FT                   AVSDVLESDPQFGFEEAKRKLQERPWLVDSYTKWLQRLKGPPHKCALIFADNSGIDIIL
FT                   GVFPFVRELLFRGTEVILACNSGPALNDVTYSESLIVAERIAAMDPIICTALREDRLLL
FT                   VQTGSSSPCLDLSLCTSRTTTCMVLPFAMWVLWTKLKSLVEKCLSPLSILLACSVLSAK
FT                   SRLDKGLAVLVRERGADLVVIEGMGRAIHTNYHALLRCESLKLAVVKNAWLAERLGGQL
FT                   FSVIFKYEVPTK"
FT   mRNA            join(<7215576..7215699,7220540..7220622,7220983..7221197,
FT                   7221404..7221587,7221857..7221949,7222337..7222490,
FT                   7222836..7223017,7223612..7223693,7223932..7224032,
FT                   7226093..7226248,7227725..7227837,7228046..7228133,
FT                   7228666..7228817,7229614..7229669,7229856..7229905,
FT                   7230384..7230488,7230955..7231055,7231189..7231257,
FT                   7231958..7232400)
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /product="pantothenate kinase 4, transcript variant
FT                   mCT2914"
FT                   /note="gene_id=mCG3933.2 transcript_id=mCT2914.2 created on
FT                   27-DEC-2002"
FT   CDS             join(7215576..7215699,7220540..7220622,7220983..7221197,
FT                   7221404..7221587,7221857..7221949,7222337..7222490,
FT                   7222836..7223017,7223612..7223693,7223932..7224032,
FT                   7226093..7226248,7227725..7227837,7228046..7228133,
FT                   7228666..7228817,7229614..7229669,7229856..7229905,
FT                   7230384..7230488,7230955..7231055,7231189..7231257,
FT                   7231958..7232171)
FT                   /codon_start=1
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /product="pantothenate kinase 4, isoform CRA_b"
FT                   /note="gene_id=mCG3933.2 transcript_id=mCT2914.2
FT                   protein_id=mCP21774.2 isoform=CRA_b"
FT                   /protein_id="EDL14988.1"
FT                   /translation="MAERGASGGGSGGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSL
FT                   TKLAYYSTVQHKVAKVRSFDHPGKDVEQDHEPPYEISVQEEITARLHFIKFENTYMEAC
FT                   LDFIRDHLVNTETKVIQATGGGAYKFKDLIEEKLRLKVDKEDVMTCLIKGCNFVLKNIP
FT                   HEAFMYQKDADPEFRFQTNHPNIFPYLLVNIGSGVSIVKVETEDRFEWIGGSSIGGGTF
FT                   WGLGALLTKTKKFDELLQLASRGRHANVDMLVQDIYGGAHQTLGLSGNLIASSFGKSAT
FT                   ADREFSKEDMAKSLLHMISNDIGQLACLYAKLHGLDRVYFGGFFIRGHPVTMRTITYSI
FT                   NFFSKGEVQALFLRHEGYLGAIGAFLKGAEQDNPNQYSWGENYAASSGLMSTSPELCPT
FT                   QRARSGTFDLLEMDRLERPLVNLPLLLDPSSYVPDTVDLTDDALARQYWLTCFEEALDG
FT                   VVKRAVASQPESMDAVERAEKFRQKYWGKLQTLRHQPFAYGTLTVRSLLDTREHCLNEF
FT                   NFPDPYSKVKQKENGLALKCFQSVTRSLDSLGWEERQLALVKGLLAGNVFDWGAKAVSD
FT                   VLESDPQFGFEEAKRKLQERPWLVDSYTKWLQRLKGPPHKCALIFADNSGIDIILGVFP
FT                   FVRELLFRGTEVILACNSGPALNDVTYSESLIVAERIAAMDPIICTALREDRLLLVQTG
FT                   SSSPCLDLSRLDKGLAVLVRERGADLVVIEGMGRAIHTNYHALLRCESLKLAVVKNAWL
FT                   AERLGGQLFSVIFKYEVPTK"
FT   gap             7222192..7222330
FT                   /estimated_length=139
FT   gene            complement(7234590..7260619)
FT                   /gene="Plcl4"
FT                   /locus_tag="mCG_3920"
FT                   /note="gene_id=mCG3920.2"
FT   mRNA            complement(join(7234590..7236440,7237691..7238492,
FT                   7240611..7240690,7240913..7241059,7241232..7241316,
FT                   7241396..7241520,7242189..7242296,7242515..7242697,
FT                   7242785..7242882,7244035..7244117,7244427..7244525,
FT                   7247637..7247795,7249954..7250061,7250352..7250523,
FT                   7251571..7251691,7251954..7252157,7252310..7252403,
FT                   7254261..7254431,7258084..7258212,7258400..7258643,
FT                   7260473..7260619))
FT                   /gene="Plcl4"
FT                   /locus_tag="mCG_3920"
FT                   /product="phospholipase C-like 4"
FT                   /note="gene_id=mCG3920.2 transcript_id=mCT2928.2 created on
FT                   30-DEC-2002"
FT   CDS             complement(join(7235137..7236440,7237691..7238492,
FT                   7240611..7240690,7240913..7241059,7241232..7241316,
FT                   7241396..7241520,7242189..7242296,7242515..7242697,
FT                   7242785..7242882,7244035..7244117,7244427..7244525,
FT                   7247637..7247795,7249954..7250061,7250352..7250523,
FT                   7251571..7251691,7251954..7252157,7252310..7252403,
FT                   7254261..7254431,7258084..7258092))
FT                   /codon_start=1
FT                   /gene="Plcl4"
FT                   /locus_tag="mCG_3920"
FT                   /product="phospholipase C-like 4"
FT                   /note="gene_id=mCG3920.2 transcript_id=mCT2928.2
FT                   protein_id=mCP21687.2"
FT                   /protein_id="EDL14989.1"
FT                   /translation="MFREADTDDHQGTLGFEEFCAFYKMMSTRRDLYLLMLTYSNHKDH
FT                   LDASDLQRFLEVEQKMNGVTLESCQNIIEQFEPCLENKSKGMLGIDGFTNYTRSPAGDI
FT                   FNPEHNRVHQDMTQPLSHYFITSSHNTYLVGDQLMSQSRVDMYAWVLQAGCRCVEVDCW
FT                   DGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIKNEYPVILSIENHCSVVQQKKMAQY
FT                   LTDILGDKLDLSSVSSEDATMLPSPQMLKGKILVKGKKLPANISEDAEEGEVSDEDSAD
FT                   EMEDDCKLLNGDASTNRKRVENIAKKKLDSLIKESKIRDCEDPNDFSVSTLSPSGKLGR
FT                   KAEAKKGQSKVEEDVEAGEDSGVSRQNSRLFMSSFSKRKKKGSKIKKVASVEEGDETLD
FT                   SPGSQSRGTARQKKTMKLSRALSDLVKYTKSVGTHDVEIEVVSSWQVSSFSETKAHQIL
FT                   QQKPTQYLRFNQHQLSRIYPSSYRVDSSNYNPQPFWNAGCQMVALNYQSEGRMLQLNRA
FT                   KFSANGDCGYVLKPQCMCQGVFNPNSEDPLPGQLKKQLALRIISGQQLPKPRDSVLGDR
FT                   GEIIDPFVEVEVIGLPVDCSKEQTRVVDDNGFNPMWEETLVFTVHMPEIALVRFLVWDH
FT                   DPIGRDFIGQRTLAFSSIMPGYRHVYLEGMEEASIFVHVAVSDISGKVKQTLGLKGLFL
FT                   RGTKPGSLDSHAAGQPLPRPSVSQRLLRRTASAPTKSQKPSRKGFPELALGTQDAGSEG
FT                   AADDVAPSSPNPALEAPTQERSGSSSPRGKAPGGEATEERTLAQVRSPNAPEGPGPAGM
FT                   AATCMKCVVGSCAGMDVEGLRREQQPSPGPAGSHMAISHQPRARVDSLGGPCCSPSPRA
FT                   TPGRSKEAPKGPRARRQGPGGGSVSSDSSSPDSPGSPKVAPCQPEGAHRQQGALQGEMN
FT                   ALFVQKLEEIRSHSPMFSTDTRLFPLQRPISPLCSLEPIAEEPALGPGLPLQAAAPTGP
FT                   SQEGSQCPVGLGAKVTSSQQTSLGAFGTLQLRIGGGRENEEPPLRPHNGGISSGPREGT
FT                   SGRQTDSKSRSRVPGHLPVVRRAKSEGQVLSELSPTPAVYSDATGTDRLWQRLEPGSHR
FT                   DSVSSSSSMSSNDTVIDLSLPSLGLCRSRESIPGVSLGRLTSRPCLASAARPDLPPVTK
FT                   SKSNPNLRVAGGLPTAPDELQPRPLAPRLTGHHPRPPWHHLTLVGLRDCPVSAKSKSLG
FT                   DLTADDFAPSFQGSTSSLSCGLGSLGVAHQVLEPGIRRDALTEQLRWLTGFQQAGDITS
FT                   PTSLGPAGDGSVGGPSFLRRSSSRSQSRVRAIASRARQAQERQQRLRGQDSRGPPEEER
FT                   GTPEGACSVGHEGCVDVPMPAKGAPEQVCGAADSQLLLRL"
FT   gap             7283614..7283672
FT                   /estimated_length=59
FT   gap             7293758..7294250
FT                   /estimated_length=493
FT   gene            7318719..7324172
FT                   /locus_tag="mCG_3937"
FT                   /note="gene_id=mCG3937.1"
FT   mRNA            join(7318719..7318911,7319560..7319640,7320400..7320806,
FT                   7322124..7322299,7322378..7322513,7323442..7324172)
FT                   /locus_tag="mCG_3937"
FT                   /product="mCG3937, transcript variant mCT2910"
FT                   /note="gene_id=mCG3937.1 transcript_id=mCT2910.1 created on
FT                   27-DEC-2002"
FT   mRNA            join(<7318793..7318911,7319560..7319640,7320400..7322513,
FT                   7323442..7323918)
FT                   /locus_tag="mCG_3937"
FT                   /product="mCG3937, transcript variant mCT190877"
FT                   /note="gene_id=mCG3937.1 transcript_id=mCT190877.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7318794..7318911,7319560..7319640,7320400..7320854)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3937"
FT                   /product="mCG3937, isoform CRA_a"
FT                   /note="gene_id=mCG3937.1 transcript_id=mCT190877.0
FT                   protein_id=mCP111860.0 isoform=CRA_a"
FT                   /protein_id="EDL14990.1"
FT                   /translation="AIRAMARAGAPEVIRAAQKDEYYLGGLRSAAGEALHSLAGAKKWL
FT                   EWRKEIELLSDIAYFGLTTIAGYQTLGEEYVGIIQVDPSQQRVPSRLRRAALVALHAVL
FT                   PYLLDKALLPLEQELQADGDAPRASQGSLLPGGRSRSGARRWVRHHAATLTEQQRKALQ
FT                   RAVFILRQGFACLHRLHVAWFYIHGTFYHLAKRLAGITYVSSHAKGTDIQAGIL"
FT   CDS             join(7318806..7318911,7319560..7319640,7320400..7320806,
FT                   7322124..7322299,7322378..7322513,7323442..7323510)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3937"
FT                   /product="mCG3937, isoform CRA_b"
FT                   /note="gene_id=mCG3937.1 transcript_id=mCT2910.1
FT                   protein_id=mCP21681.2 isoform=CRA_b"
FT                   /db_xref="GOA:B1AUE5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR025654"
FT                   /db_xref="MGI:MGI:2684988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1AUE5"
FT                   /protein_id="EDL14991.1"
FT                   /translation="MARAGAPEVIRAAQKDEYYLGGLRSAAGEALHSLAGAKKWLEWRK
FT                   EIELLSDIAYFGLTTIAGYQTLGEEYVGIIQVDPSQQRVPSRLRRAALVALHAVLPYLL
FT                   DKALLPLEQELQADGDAPRASQGSLLPGGRSRSGARRWVRHHAATLTEQQRKALQRAVF
FT                   ILRQGFACLHRLHVAWFYIHGTFYHLAKRLAGITYLRTRRLPGEDQKARTSYGLLGLIS
FT                   LLHLVLSMGLRLYSFRQKQRARKEWRLHRNLSHRRSSLEDRAVCRTPLCTLCLEERRHS
FT                   TATPCGHLFCWECITEWCNTKTECPLCREKFPPQKLVYLRHYR"
FT   gap             7324188..7324532
FT                   /estimated_length=345
FT   gene            complement(7325939..7338118)
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /note="gene_id=mCG3927.1"
FT   mRNA            complement(join(7325939..7326855,7327416..7327551,
FT                   7328539..7328617,7330379..7330478,7332684..7332788,
FT                   7334552..7334639,7338026..7338118))
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /product="RER1 retention in endoplasmic reticulum 1 homolog
FT                   (S. cerevisiae), transcript variant mCT2916"
FT                   /note="gene_id=mCG3927.1 transcript_id=mCT2916.1 created on
FT                   06-DEC-2002"
FT   CDS             complement(join(7326766..7326855,7327416..7327551,
FT                   7328539..7328617,7330379..7330478,7332684..7332788,
FT                   7334552..7334632))
FT                   /codon_start=1
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /product="RER1 retention in endoplasmic reticulum 1 homolog
FT                   (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG3927.1 transcript_id=mCT2916.1
FT                   protein_id=mCP21727.2 isoform=CRA_b"
FT                   /protein_id="EDL14993.1"
FT                   /translation="MSEGDSVGDSVHGKPSVVYRFFSRLGQIYQSWLDKSTPYTAVRWV
FT                   VTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTK
FT                   QNEEFRPFIRRLPEFKFWHAATKGILVAMICTFFEAFNVPVFWPILVMYFIMLFCITMK
FT                   RQIKHMIKYRYIPFTHGKRRYKGKEDVGKTFAS"
FT   mRNA            complement(join(<7327484..7327551,7328539..7328617,
FT                   7330379..7330478,7332684..7332788,7334552..7334639,
FT                   7334994..7335202,7338026..>7338099))
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /product="RER1 retention in endoplasmic reticulum 1 homolog
FT                   (S. cerevisiae), transcript variant mCT190898"
FT                   /note="gene_id=mCG3927.1 transcript_id=mCT190898.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<7327484..7327551,7328539..7328617,
FT                   7330379..7330478,7332684..7332788,7334552..7334639,
FT                   7334994..>7335001))
FT                   /codon_start=1
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /product="RER1 retention in endoplasmic reticulum 1 homolog
FT                   (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG3927.1 transcript_id=mCT190898.0
FT                   protein_id=mCP111856.0 isoform=CRA_a"
FT                   /protein_id="EDL14992.1"
FT                   /translation="NQGYRMSEGDSVGDSVHGKPSVVYRFFSRLGQIYQSWLDKSTPYT
FT                   AVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGP
FT                   SLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMICTFFEAFNVP"
FT   gap             7329311..7329340
FT                   /estimated_length=30
FT   gap             7337924..7337943
FT                   /estimated_length=20
FT   gene            7338421..7398496
FT                   /locus_tag="mCG_3921"
FT                   /note="gene_id=mCG3921.1"
FT   mRNA            join(7338421..7338502,7339242..7339313,7341306..7341404,
FT                   7342703..7342813,7344089..7344179,7344882..7344969,
FT                   7353065..7353161,7353889..7353999,7362887..7363010,
FT                   7363376..7363548,7380954..7381075,7381158..7381240,
FT                   7395391..7395434,7398157..7398496)
FT                   /locus_tag="mCG_3921"
FT                   /product="mCG3921, transcript variant mCT2929"
FT                   /note="gene_id=mCG3921.1 transcript_id=mCT2929.1 created on
FT                   20-DEC-2002"
FT   mRNA            join(7338422..7338502,7339242..7339313,7341306..7341404,
FT                   7342703..7342813,7344089..7344179,7344882..7344969,
FT                   7353065..7353161,7353889..7353999,7362887..7363010,
FT                   7363376..7363548,7380954..7381075,7381158..7381240,
FT                   7398157..7398400)
FT                   /locus_tag="mCG_3921"
FT                   /product="mCG3921, transcript variant mCT177682"
FT                   /note="gene_id=mCG3921.1 transcript_id=mCT177682.0 created
FT                   on 20-DEC-2002"
FT   CDS             join(7338427..7338502,7339242..7339313,7341306..7341404,
FT                   7342703..7342813,7344089..7344179,7344882..7344969,
FT                   7353065..7353161,7353889..7353999,7362887..7363010,
FT                   7363376..7363548,7380954..7381075,7381158..7381240,
FT                   7395391..7395434,7398157..7398299)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3921"
FT                   /product="mCG3921, isoform CRA_b"
FT                   /note="gene_id=mCG3921.1 transcript_id=mCT2929.1
FT                   protein_id=mCP21766.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2RTS7"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="MGI:MGI:1924116"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTS7"
FT                   /protein_id="EDL14995.1"
FT                   /translation="MEAAGDPYQASLQPRRHSPRLPPRNGYGVYVYPNSFFRYEGEWKG
FT                   GKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGVMKYK
FT                   AGGRYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQ
FT                   RQGHGVLCCADGSTYKGQWHSDVFSGLGSLVHCSGVTYCGMFINGHPAEQAKKIVILGP
FT                   EVLEVVQGSPFTLSVQLQQDDGEVAKSESGRVLKISAGVRYVQLPEYSEVSFFKMDEDY
FT                   METPIQTPFGFQCISYPLSVPMSWGPEPGSTVESARADLLLSKRDSEPVLDSGAFHGQG
FT                   DTLSILPARRHKPCCQQVDHGCAEFVDILLGAPPPGMQPYLFLPGTLEKTLGRPKGGPS
FT                   SPEVLPTAQEPLKGTNRPDGTTVEPPTAAYLGEYVLMVCDVTSPPFLGHRLPTTFKHLR
FT                   ILAKGDTHWPHVPEDHQKL"
FT   CDS             join(7338427..7338502,7339242..7339313,7341306..7341404,
FT                   7342703..7342813,7344089..7344179,7344882..7344969,
FT                   7353065..7353161,7353889..7353999,7362887..7363010,
FT                   7363376..7363548,7380954..7381075,7381158..7381240,
FT                   7398157..7398181)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3921"
FT                   /product="mCG3921, isoform CRA_a"
FT                   /note="gene_id=mCG3921.1 transcript_id=mCT177682.0
FT                   protein_id=mCP100604.0 isoform=CRA_a"
FT                   /protein_id="EDL14994.1"
FT                   /translation="MEAAGDPYQASLQPRRHSPRLPPRNGYGVYVYPNSFFRYEGEWKG
FT                   GKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGVMKYK
FT                   AGGRYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQ
FT                   RQGHGVLCCADGSTYKGQWHSDVFSGLGSLVHCSGVTYCGMFINGHPAEQAKKIVILGP
FT                   EVLEVVQGSPFTLSVQLQQDDGEVAKSESGRVLKISAGVRYVQLPEYSEVSFFKMDEDY
FT                   METPIQTPFGFQCISYPLSVPMSWGPEPGSTVESARADLLLSKRDSEPVLDSGAFHGQG
FT                   DTLSILPARRHKPCCQQVDHGCAEFVDILLGAPPPGMQPYLFLPGTLEKTLGRPKGGPS
FT                   SPEVLPTAQEPLKGTNRGVCAHGL"
FT   gap             7352561..7352580
FT                   /estimated_length=20
FT   gap             7358742..7359562
FT                   /estimated_length=821
FT   gap             7361018..7361047
FT                   /estimated_length=30
FT   gap             7365333..7365766
FT                   /estimated_length=434
FT   gap             7388954..7389607
FT                   /estimated_length=654
FT   gap             7399019..7399081
FT                   /estimated_length=63
FT   gene            <7403947..>7404405
FT                   /locus_tag="mCG_1027449"
FT                   /note="gene_id=mCG1027449.1"
FT   mRNA            join(<7403947..7404082,7404295..>7404405)
FT                   /locus_tag="mCG_1027449"
FT                   /product="mCG1027449"
FT                   /note="gene_id=mCG1027449.1 transcript_id=mCT145153.1
FT                   created on 13-MAR-2003"
FT   CDS             join(<7403947..7404082,7404295..>7404405)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027449"
FT                   /product="mCG1027449"
FT                   /note="gene_id=mCG1027449.1 transcript_id=mCT145153.1
FT                   protein_id=mCP76688.1"
FT                   /protein_id="EDL14996.1"
FT                   /translation="GRTAGSPRGRASPQQSPPGPAHPQASRSLAELQTRVAPARRKERE
FT                   LLRTAARSQKPVWWVNTALERPWIQQGFPSLMPGWRT"
FT   gap             7404086..7404275
FT                   /estimated_length=190
FT   gene            complement(7407291..>7475712)
FT                   /gene="Ski"
FT                   /locus_tag="mCG_3931"
FT                   /note="gene_id=mCG3931.1"
FT   mRNA            complement(join(7407291..7410720,7411137..7411367,
FT                   7412479..7412771,7412887..7413149,7413771..7413886,
FT                   7414025..7414147,7474744..>7475712))
FT                   /gene="Ski"
FT                   /locus_tag="mCG_3931"
FT                   /product="Sloan-Kettering viral oncogene homolog"
FT                   /note="gene_id=mCG3931.1 transcript_id=mCT2920.1 created on
FT                   06-DEC-2002"
FT   CDS             complement(join(7410532..7410720,7411137..7411367,
FT                   7412479..7412771,7412887..7413149,7413771..7413886,
FT                   7414025..7414147,7474744..7475712))
FT                   /codon_start=1
FT                   /gene="Ski"
FT                   /locus_tag="mCG_3931"
FT                   /product="Sloan-Kettering viral oncogene homolog"
FT                   /note="gene_id=mCG3931.1 transcript_id=mCT2920.1
FT                   protein_id=mCP21768.0"
FT                   /db_xref="GOA:B1AUF1"
FT                   /db_xref="InterPro:IPR003380"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010919"
FT                   /db_xref="InterPro:IPR014890"
FT                   /db_xref="InterPro:IPR023216"
FT                   /db_xref="MGI:MGI:98310"
FT                   /db_xref="UniProtKB/TrEMBL:B1AUF1"
FT                   /protein_id="EDL14997.1"
FT                   /translation="MEAAAAGRGGFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQE
FT                   AYKKESAKEAGAATVPAPVPTAAEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETV
FT                   LEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHIYCSRCTADQLEILKV
FT                   MGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYH
FT                   ECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANW
FT                   RAYILLSQDYTGKEEQARLGRCLDDVKEKFDYANKYKRRVPRVSEPPASIRPKTDDTSS
FT                   QSPASSEKDKQSTWLRTLAGSSNKSLGCTHPRQRLSAFRPWSPAVSASEKETSPHLPAL
FT                   IRDSFYSYKSFETAVAPNVALAPPTQQKVVNSPPCTTVVSRAPEPLTTCIQPRKRKLTL
FT                   DTAGAPDMLTPVAAAEEDKDSEAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLSSPGM
FT                   HAPPVVAPDAAAHVDAPSGLEAELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKL
FT                   TAALQAKRSLHQELEFLRVAKKEKLREATEAKRSLRKEIERLRAENEKKMKEANESRVR
FT                   LKRELEQARQVRVCDKGCEAGRLRAKYSAQIEDLQAKLQHAEADREQLRADLLREREAR
FT                   EHLEKVVRELQEQLRPRPRPEHPGGESNAELGP"
FT   gap             7427640..7427659
FT                   /estimated_length=20
FT   gap             7459927..7460058
FT                   /estimated_length=132
FT   gap             7475777..7476531
FT                   /estimated_length=755
FT   gap             7486001..7486186
FT                   /estimated_length=186
FT   gap             7489179..7489198
FT                   /estimated_length=20
FT   gene            7503206..7510085
FT                   /locus_tag="mCG_23126"
FT                   /note="gene_id=mCG23126.1"
FT   mRNA            join(7503206..7503466,7503898..7504042,7504148..7504428,
FT                   7509530..7510085)
FT                   /locus_tag="mCG_23126"
FT                   /product="mCG23126, transcript variant mCT23149"
FT                   /note="gene_id=mCG23126.1 transcript_id=mCT23149.2 created
FT                   on 20-DEC-2002"
FT   CDS             join(7503405..7503466,7503898..7504042,7504148..7504428,
FT                   7509530..7509602)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23126"
FT                   /product="mCG23126, isoform CRA_b"
FT                   /note="gene_id=mCG23126.1 transcript_id=mCT23149.2
FT                   protein_id=mCP21674.2 isoform=CRA_b"
FT                   /protein_id="EDL14999.1"
FT                   /translation="MEEERRLRGRLSRRRPPAGGGPPNCRPWFLSEGSKSEPWAALLRS
FT                   TVSGTADWTPNRQPLPPLPAFPSQESLPDPESTVPPEAFTVGSKTFSWTPLPPALRGSG
FT                   SSRHLFCEPEGSLGSPTPSLKGCPALNSGRTPSAQECVPVQSPLALLSCPLCQKAFDPK
FT                   LTQLDVDSHLAQCLAECTEDVVW"
FT   mRNA            join(<7503471..7504042,7504148..7504428,7509530..7510078)
FT                   /locus_tag="mCG_23126"
FT                   /product="mCG23126, transcript variant mCT190865"
FT                   /note="gene_id=mCG23126.1 transcript_id=mCT190865.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7503836..7504042,7504148..7504428,7509530..7509602)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23126"
FT                   /product="mCG23126, isoform CRA_a"
FT                   /note="gene_id=mCG23126.1 transcript_id=mCT190865.0
FT                   protein_id=mCP111835.0 isoform=CRA_a"
FT                   /protein_id="EDL14998.1"
FT                   /translation="NQLFTISLPWMPRLTLPVLPRPPNCRPWFLSEGSKSEPWAALLRS
FT                   TVSGTADWTPNRQPLPPLPAFPSQESLPDPESTVPPEAFTVGSKTFSWTPLPPALRGSG
FT                   SSRHLFCEPEGSLGSPTPSLKGCPALNSGRTPSAQECVPVQSPLALLSCPLCQKAFDPK
FT                   LTQLDVDSHLAQCLAECTEDVVW"
FT   gap             7510121..7510140
FT                   /estimated_length=20
FT   gene            complement(7515468..7614665)
FT                   /gene="Prkcz"
FT                   /locus_tag="mCG_23123"
FT                   /note="gene_id=mCG23123.1"
FT   mRNA            complement(join(7515468..7515922,7516093..7516208,
FT                   7521086..7521175,7521575..7521654,7522430..7522549,
FT                   7524596..7524683,7524866..7525001,7526338..7526424,
FT                   7540208..7540305,7543059..7543247,7543931..7543983,
FT                   7546586..7546667,7547695..7547826,7554358..7554443,
FT                   7608074..7608124,7609847..7609936,7610901..7611022,
FT                   7614571..7614665))
FT                   /gene="Prkcz"
FT                   /locus_tag="mCG_23123"
FT                   /product="protein kinase C, zeta"
FT                   /note="gene_id=mCG23123.1 transcript_id=mCT23147.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(7515835..7515922,7516093..7516208,
FT                   7521086..7521175,7521575..7521654,7522430..7522549,
FT                   7524596..7524683,7524866..7525001,7526338..7526424,
FT                   7540208..7540305,7543059..7543247,7543931..7543983,
FT                   7546586..7546667,7547695..7547826,7554358..7554443,
FT                   7608074..7608124,7609847..7609936,7610901..7611022,
FT                   7614571..7614641))
FT                   /codon_start=1
FT                   /gene="Prkcz"
FT                   /locus_tag="mCG_23123"
FT                   /product="protein kinase C, zeta"
FT                   /note="gene_id=mCG23123.1 transcript_id=mCT23147.1
FT                   protein_id=mCP21683.2"
FT                   /db_xref="GOA:Q02956"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012233"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="MGI:MGI:97602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02956"
FT                   /protein_id="EDL15000.1"
FT                   /translation="MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDAMTTFKDLCEEVR
FT                   DMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLVCQGRDEVLIIHVFPSIPEQPG
FT                   MPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCIN
FT                   CKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHD
FT                   NIKDDSEDLKPVIDGVDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMK
FT                   VVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMF
FT                   HMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCK
FT                   EGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNP
FT                   DMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAF
FT                   FRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFE
FT                   GFEYINPLLLSAEESV"
FT   gap             7532303..7532322
FT                   /estimated_length=20
FT   gap             7536635..7536654
FT                   /estimated_length=20
FT   gap             7624090..7624159
FT                   /estimated_length=70
FT   gap             7626577..7626596
FT                   /estimated_length=20
FT   gene            complement(7638310..7651419)
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /note="gene_id=mCG23125.2"
FT   mRNA            complement(join(7638310..7639022,7639266..7639477,
FT                   7639734..7639889,7640485..7640622,7641189..7641271,
FT                   7641586..7641806,7641897..7641964,7642265..7642377,
FT                   7651233..7651419))
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit delta, transcript variant mCT23148"
FT                   /note="gene_id=mCG23125.2 transcript_id=mCT23148.2 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(7638311..7639022,7639266..7640622,
FT                   7641189..7641271,7641586..7641806,7641897..7641964,
FT                   7642265..7642377,7651233..>7651386))
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit delta, transcript variant mCT190863"
FT                   /note="gene_id=mCG23125.2 transcript_id=mCT190863.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7638732..7639022,7639266..7639477,
FT                   7639734..7639889,7640485..7640622,7641189..7641271,
FT                   7641586..7641806,7641897..7641964,7642265..7642377,
FT                   7651233..7651300))
FT                   /codon_start=1
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit delta, isoform CRA_b"
FT                   /note="gene_id=mCG23125.2 transcript_id=mCT23148.2
FT                   protein_id=mCP21670.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q14AH9"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008098"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95622"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AH9"
FT                   /protein_id="EDL15002.1"
FT                   /translation="MDVLGWLLLPLLLLCTQPHHGARAMNDIGDYVGSNLEISWLPNLD
FT                   GLMEGYARNFRPGIGGAPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNH
FT                   TNETLGLDSRFVDKLWLPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVA
FT                   CDMDLAKYPLDEQECMLDLESYGYSSEDIVYYWSENQEQIHGLDRLQLAQFTITSYRFT
FT                   TELMNFKSAGQFPRLSLHFQLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVS
FT                   LGITTVLTMTTLMVSARSSLPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKK
FT                   RKAKVKVTKPRAEMDVRNAIVLFSLSAAGVSQELAISRRQGRVPGNLMGSYRSVEVEAK
FT                   KEGGSRPGGPGGIRSRLKPIDADTIDIYARAVFPAAFAAVNIIYWAAYTM"
FT   CDS             complement(join(7640435..7640622,7641189..7641271,
FT                   7641586..7641806,7641897..7641964,7642265..7642377,
FT                   7651233..>7651384))
FT                   /codon_start=1
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit delta, isoform CRA_a"
FT                   /note="gene_id=mCG23125.2 transcript_id=mCT190863.0
FT                   protein_id=mCP111834.0 isoform=CRA_a"
FT                   /protein_id="EDL15001.1"
FT                   /translation="WCRRAAAGKATLLALGLAGPVPRTARKAMDVLGWLLLPLLLLCTQ
FT                   PHHGARAMNDIGDYVGSNLEISWLPNLDGLMEGYARNFRPGIGGAPVNVALALEVASID
FT                   HISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLWLPDTFIVNAKSAWFH
FT                   DVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPLDEQECMLDLESYGYSSEDIVY
FT                   YWSENQEQIHGLDRLQLAQFTITSYRFTTELMNFKSGNVASLVSCPQVSCAL"
FT   gap             7656108..7659218
FT                   /estimated_length=3111
FT   gene            complement(7661954..>7668615)
FT                   /locus_tag="mCG_146182"
FT                   /note="gene_id=mCG146182.0"
FT   mRNA            complement(join(7661954..7663344,7664481..7665456,
FT                   7667549..7667717,7668545..>7668615))
FT                   /locus_tag="mCG_146182"
FT                   /product="mCG146182"
FT                   /note="gene_id=mCG146182.0 transcript_id=mCT186285.0
FT                   created on 14-JUL-2003"
FT   gene            7662832..>7674221
FT                   /locus_tag="mCG_1027453"
FT                   /note="gene_id=mCG1027453.1"
FT   mRNA            join(7662832..7663214,7669504..7669589,7672496..7672571,
FT                   7672723..7672866,7674121..>7674221)
FT                   /locus_tag="mCG_1027453"
FT                   /product="mCG1027453"
FT                   /note="gene_id=mCG1027453.1 transcript_id=mCT145157.1
FT                   created on 16-DEC-2002"
FT   CDS             complement(7664710..>7665237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146182"
FT                   /product="mCG146182"
FT                   /note="gene_id=mCG146182.0 transcript_id=mCT186285.0
FT                   protein_id=mCP107635.0"
FT                   /protein_id="EDL15003.1"
FT                   /translation="SAMVGSLKQPRTSHLGLRQKYILKYSCGFLGFFFLLGLVFFVFRD
FT                   KVSLYSPGCPGTHSVDQAGLELRNPPASASQVCHHARLFLWFFFFFFKKPKLPICHYRY
FT                   YFKINKQITERMSLLWFYFEIGFLSLTPALTRLASNSQRWPASASQVIEGVRHYHPASL
FT                   ALRSTPQIHSSF"
FT   gap             7666754..7667040
FT                   /estimated_length=287
FT   CDS             join(7669523..7669589,7672496..7672571,7672723..7672866,
FT                   7674121..>7674221)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027453"
FT                   /product="mCG1027453"
FT                   /note="gene_id=mCG1027453.1 transcript_id=mCT145157.1
FT                   protein_id=mCP76697.1"
FT                   /db_xref="GOA:G3UWF6"
FT                   /db_xref="MGI:MGI:1917130"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWF6"
FT                   /protein_id="EDL15004.1"
FT                   /translation="MEEPTVQFSDEDLVDNFPPMDDERVQLEDLEFEVERPSEGLEDEG
FT                   SHSSAKKESKGAEKMRKSTTKDQVQAFHLRKSLNLLDKMHEEKDVFIQKTKGELHICRQ
FT                   RMDLLNKQQESLAAEIATEKEANNM"
FT   gap             7670247..7670384
FT                   /estimated_length=138
FT   gene            7675779..7702185
FT                   /locus_tag="mCG_132275"
FT                   /note="gene_id=mCG132275.1"
FT   mRNA            join(7675779..7676178,7676449..7676622,7677133..7677243,
FT                   7677784..7677886,7678547..7678704,7679871..7680066,
FT                   7681144..7681302,7682999..7683172,7683749..7683867,
FT                   7688027..7688093,7688327..7688416,7690749..7690913,
FT                   7692200..7692335,7695642..7695721,7696420..7696542,
FT                   7700879..7701000,7701724..7702185)
FT                   /locus_tag="mCG_132275"
FT                   /product="mCG132275"
FT                   /note="gene_id=mCG132275.1 transcript_id=mCT133626.1
FT                   created on 27-DEC-2002"
FT   CDS             join(7676162..7676178,7676449..7676622,7677133..7677243,
FT                   7677784..7677886,7678547..7678704,7679871..7680066,
FT                   7681144..7681302,7682999..7683172,7683749..7683867,
FT                   7688027..7688093,7688327..7688416,7690749..7690913,
FT                   7692200..7692335,7695642..7695721,7696420..7696542,
FT                   7700879..7701000,7701724..7701811)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132275"
FT                   /product="mCG132275"
FT                   /note="gene_id=mCG132275.1 transcript_id=mCT133626.1
FT                   protein_id=mCP76801.1"
FT                   /protein_id="EDL15005.1"
FT                   /translation="MLKDSENAMWHIEIQKGQFEDVRKHHEAEAEARQRGLEVHSARQL
FT                   QREREAMEKSEKNRLLRARKSLHTQKELGLRHQKLVEDAQRNHRIAVKFLKASLGRVRE
FT                   REQKEEMESRTHMQRRMDAVLSLKNNITASRETLKKFQAWGQTRADLAKQKALTEKEVI
FT                   LSQGGDAFKYLFHQRRHQELEAQKRAFEEEQKLRKQEIVNRILKEEAEEEQRKRRQHPL
FT                   SKPINRRTLRDKTWQYISDFCEGKSVLTSQQERERELLLYPKTVCVIKAISSESVQVDL
FT                   GSISTEDEVLAEPDISGLWNKESYQVPKEDMERKPVGGSKMEKDILARTMEQLRSGVVQ
FT                   KQVVSGREFKGRPFNSKPEVIHFKDFDIGKVYKKKITLINATYTINYCKLVGVEENLKD
FT                   FIHIDFEPPGPMSAGMSCEVLVTFKPMINKDLEGNVSFLAQTGSFSVPLKCSTKKCSLS
FT                   LDKELIDFGTYVVGETTSRIITLTNVGGLGTKFKFLPDSEFYEMDESQPAMKISSLFTC
FT                   EEKIIYEKIMTSLSEQQLEVNDSSLVDLQSLKESEKQLDDPEVTTAAVSAMTMIPSEEQ
FT                   AEITLGEVTEGEIGPFSSVKVPITFTPVIPGEVQTKFKVMFKNPQSPPLYFRATGTAID
FT                   VPVWVPKATVDLKICMYDRLYQDSITVHTSFEPLGARPEGRCCLHQAPSLVTHGKCRI"
FT   gap             7686829..7687104
FT                   /estimated_length=276
FT   gap             7693429..7693448
FT                   /estimated_length=20
FT   gene            7716024..>7720486
FT                   /locus_tag="mCG_1027348"
FT                   /note="gene_id=mCG1027348.1"
FT   mRNA            join(7716024..7717418,7717535..7718086,7718669..7718798,
FT                   7718997..7719151,7719380..7719512,7719798..7719928,
FT                   7720149..7720287,7720395..>7720486)
FT                   /locus_tag="mCG_1027348"
FT                   /product="mCG1027348"
FT                   /note="gene_id=mCG1027348.1 transcript_id=mCT145052.1
FT                   created on 29-JAN-2003"
FT   CDS             join(7717991..7718086,7718669..7718798,7718997..7719151,
FT                   7719380..7719512,7719798..7719928,7720149..7720287,
FT                   7720395..>7720486)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027348"
FT                   /product="mCG1027348"
FT                   /note="gene_id=mCG1027348.1 transcript_id=mCT145052.1
FT                   protein_id=mCP76713.1"
FT                   /protein_id="EDL15006.1"
FT                   /translation="MGVASMITCSIDGNILNMGYVLARESVSTNFKLQNESSLPIKFWV
FT                   RLESLSRKKAEAHQQLPKFITSHEQRAEIVGTQNYNGQSVFSIVPVEGLMFPGKAQEFT
FT                   VTFSPDHESLFFSDLLKVVLFEKKVSHQILLKGAAREHMMFVEGGDPLDVPVESLAVVT
FT                   AFDTEHKEEAEELKPILVTLNYVQLDTDTTTSPATRELQVGCIRTTQPSPRRTVEFSLD
FT                   GVSWLQHKGFSIEPSRGSVERGQTKTINISWVPPADFDVDHPLMVSTLLQLRGDVKETY
FT                   KVTFVAHVVTG"
FT   gene            7723198..7724942
FT                   /locus_tag="mCG_23365"
FT                   /note="gene_id=mCG23365.0"
FT   mRNA            join(7723198..7723295,7723388..7723431,7723547..7723588,
FT                   7724074..7724252,7724356..7724942)
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, transcript variant mCT23142"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT23142.2 created
FT                   on 20-DEC-2002"
FT   mRNA            join(7723199..7723295,7723388..7723431,7723529..7723588,
FT                   7724074..7724252,7724356..7724916)
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, transcript variant mCT177681"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT177681.0 created
FT                   on 20-DEC-2002"
FT   mRNA            join(7723199..7723295,7723388..7723588,7724074..7724252,
FT                   7724356..7724842)
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, transcript variant mCT177680"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT177680.0 created
FT                   on 20-DEC-2002"
FT   CDS             join(7723230..7723295,7723388..7723431,7723529..7723588,
FT                   7724074..7724252,7724356..7724615)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, isoform CRA_a"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT177681.0
FT                   protein_id=mCP100603.0 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZN39"
FT                   /db_xref="MGI:MGI:1916921"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN39"
FT                   /protein_id="EDL15007.1"
FT                   /translation="MAPGPSATQGILLLLPLLPLSQVTLGSADRNCDPSDQCRCPRRCP
FT                   PQARWSSLWHVGLILLAILLMLLCGVTASCVRFCCLRKQTHTQSHTPAAWQPCDGTVIP
FT                   VDSDSPAHSTVTSYSSVQYPLGMRLPLYFGEPDPDSMVPPTYSLYASELPPSYDEVVKM
FT                   IKAREEVAAPSEKTNSLPEALEPETTGGPQEPGPSAQRP"
FT   CDS             join(7723230..7723295,7723388..7723431,7723547..7723588,
FT                   7724074..7724252,7724356..7724615)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, isoform CRA_b"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT23142.2
FT                   protein_id=mCP21754.1 isoform=CRA_b"
FT                   /protein_id="EDL15008.1"
FT                   /translation="MAPGPSATQGILLLLPLLPLSQVTLGSADRNCDPSDQCPPQARWS
FT                   SLWHVGLILLAILLMLLCGVTASCVRFCCLRKQTHTQSHTPAAWQPCDGTVIPVDSDSP
FT                   AHSTVTSYSSVQYPLGMRLPLYFGEPDPDSMVPPTYSLYASELPPSYDEVVKMIKAREE
FT                   VAAPSEKTNSLPEALEPETTGGPQEPGPSAQRP"
FT   CDS             join(7724099..7724252,7724356..7724615)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, isoform CRA_c"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT177680.0
FT                   protein_id=mCP100602.0 isoform=CRA_c"
FT                   /protein_id="EDL15009.1"
FT                   /translation="MLLCGVTASCVRFCCLRKQTHTQSHTPAAWQPCDGTVIPVDSDSP
FT                   AHSTVTSYSSVQYPLGMRLPLYFGEPDPDSMVPPTYSLYASELPPSYDEVVKMIKAREE
FT                   VAAPSEKTNSLPEALEPETTGGPQEPGPSAQRP"
FT   gap             7742462..7742481
FT                   /estimated_length=20
FT   gap             7745354..7745373
FT                   /estimated_length=20
FT   gene            7745476..7812349
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /note="gene_id=mCG23363.2"
FT   mRNA            join(7745476..7745708,7781685..7781781,7787968..7788006,
FT                   7789631..7789737,7794865..7794928,7797306..7797468,
FT                   7805937..7806003,7807600..7807801,7809297..7809513,
FT                   7811453..7811568,7811753..7812094)
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   transcript variant mCT23141"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT23141.1 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<7745498..7745708,7769797..7769845,7781685..7781781,
FT                   7787968..7788006,7789631..7789737,7794865..7794928,
FT                   7797306..7797468,7805937..7806003,7807600..7807801,
FT                   7809297..7809513,7811453..7811568,7811753..7812098)
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   transcript variant mCT190880"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT190880.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(7745654..7745708,7769797..7769845,7781685..7781781,
FT                   7787968..7788006,7789631..7789737,7794865..7794928,
FT                   7797306..7797468,7805937..7806003,7807600..7807801,
FT                   7809297..7809513,7811453..7811568,7811750..7812349)
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   transcript variant mCT176824"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT176824.0 created
FT                   on 06-DEC-2002"
FT   gap             7745932..7746057
FT                   /estimated_length=126
FT   gap             7754292..7754381
FT                   /estimated_length=90
FT   gene            complement(7756476..7756881)
FT                   /pseudo
FT                   /locus_tag="mCG_23366"
FT                   /note="gene_id=mCG23366.2"
FT   mRNA            complement(7756476..7756881)
FT                   /pseudo
FT                   /locus_tag="mCG_23366"
FT                   /note="gene_id=mCG23366.2 transcript_id=mCT23144.2 created
FT                   on 27-DEC-2002"
FT   CDS             join(<7781716..7781781,7787968..7788006,7789631..7789737,
FT                   7794865..7794928,7797306..7797468,7805937..7806003,
FT                   7807600..7807801,7809297..7809513,7811453..7811559)
FT                   /codon_start=1
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT190880.0
FT                   protein_id=mCP111850.0 isoform=CRA_a"
FT                   /protein_id="EDL15010.1"
FT                   /translation="DVKMSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGR
FT                   IQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVM
FT                   TCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS
FT                   SGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCR
FT                   QTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSF
FT                   SKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLK
FT                   IWN"
FT   CDS             join(7781725..7781781,7787968..7788006,7789631..7789737,
FT                   7794865..7794928,7797306..7797468,7805937..7806003,
FT                   7807600..7807801,7809297..7809513,7811453..7811559)
FT                   /codon_start=1
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT176824.0
FT                   protein_id=mCP99746.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TQ70"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:95781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQ70"
FT                   /protein_id="EDL15011.1"
FT                   /translation="MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQM
FT                   RTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCA
FT                   YAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGD
FT                   TTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTF
FT                   TGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKS
FT                   GRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
FT                   "
FT   CDS             join(7781725..7781781,7787968..7788006,7789631..7789737,
FT                   7794865..7794928,7797306..7797468,7805937..7806003,
FT                   7807600..7807801,7809297..7809513,7811453..7811559)
FT                   /codon_start=1
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT23141.1
FT                   protein_id=mCP21732.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TQ70"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:95781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQ70"
FT                   /protein_id="EDL15012.1"
FT                   /translation="MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQM
FT                   RTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCA
FT                   YAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGD
FT                   TTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTF
FT                   TGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKS
FT                   GRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
FT                   "
FT   gap             7817683..7817775
FT                   /estimated_length=93
FT   gene            7817948..7845269
FT                   /gene="Nadk"
FT                   /locus_tag="mCG_23367"
FT                   /note="gene_id=mCG23367.2"
FT   mRNA            join(7817948..7818228,7831005..7831474,7833588..7833671,
FT                   7838417..7838546,7839432..7839540,7839644..7839729,
FT                   7841009..7841111,7841637..7841776,7841965..7842064,
FT                   7842141..7842298,7842890..7842972,7843608..7845269)
FT                   /gene="Nadk"
FT                   /locus_tag="mCG_23367"
FT                   /product="NAD kinase"
FT                   /note="gene_id=mCG23367.2 transcript_id=mCT23145.2 created
FT                   on 06-DEC-2002"
FT   gap             7827247..7827538
FT                   /estimated_length=292
FT   CDS             join(7831296..7831474,7833588..7833671,7838417..7838546,
FT                   7839432..7839540,7839644..7839729,7841009..7841111,
FT                   7841637..7841776,7841965..7842064,7842141..7842298,
FT                   7842890..7842972,7843608..7843755)
FT                   /codon_start=1
FT                   /gene="Nadk"
FT                   /locus_tag="mCG_23367"
FT                   /product="NAD kinase"
FT                   /note="gene_id=mCG23367.2 transcript_id=mCT23145.2
FT                   protein_id=mCP21762.2"
FT                   /db_xref="GOA:P58058"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="MGI:MGI:2183149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58058"
FT                   /protein_id="EDL15013.1"
FT                   /translation="MEMEQEKMNLSQELSADSASYNCSACHGDETWSYNHPIRGRAKSR
FT                   SLSASPALGSTKEFRRTRSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSP
FT                   KSVLVIKKIRDASLLQPFKELCIYLMEENNMIVYVEKKVLEDPAIVSDENFGPVKKKFC
FT                   TFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFNFENFQ
FT                   SQVNQVIEGNAAVILRSRLKVRVVKEPRDKKTAIHNGLSENGLDTEGGKQAMQYQVLNE
FT                   VVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMVHPNVPAIM
FT                   VTPICPHSLSFRPIVVPAGVELKIMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCY
FT                   PLPSICVCDPVSDWFESLAQCLHWNVRKKQAHFPEDEEDS"
FT   gap             7848968..7850044
FT                   /estimated_length=1077
FT   gene            7855723..7873351
FT                   /gene="A530082C11Rik"
FT                   /locus_tag="mCG_132283"
FT                   /note="gene_id=mCG132283.0"
FT   mRNA            join(7855723..7856461,7864150..7864630,7864812..7864947,
FT                   7865926..7866053,7866927..7867047,7869894..7869947,
FT                   7870508..7870580,7871965..7872110,7872861..7873351)
FT                   /gene="A530082C11Rik"
FT                   /locus_tag="mCG_132283"
FT                   /product="RIKEN cDNA A530082C11"
FT                   /note="gene_id=mCG132283.0 transcript_id=mCT133634.1
FT                   created on 27-DEC-2002"
FT   CDS             join(7864309..7864630,7864812..7864947,7865926..7866053,
FT                   7866927..7867047,7869894..7869947,7870508..7870580,
FT                   7871965..7872110,7872861..7873098)
FT                   /codon_start=1
FT                   /gene="A530082C11Rik"
FT                   /locus_tag="mCG_132283"
FT                   /product="RIKEN cDNA A530082C11"
FT                   /note="gene_id=mCG132283.0 transcript_id=mCT133634.1
FT                   protein_id=mCP76709.1"
FT                   /protein_id="EDL15014.1"
FT                   /translation="MSAAAKSQVPEEAAPGCEEEPKGKTLLTWGSLFGHRSEKIVFTKG
FT                   DGSPEESLLTVTITETTVIESDLGVWSSRALIYLTLWFFFSFCTLFLNKYILSLLEGEP
FT                   SMLGAVQMLSTTLIGCVKIFVPCCLYQHKTRLSYPPNFIMTMLFVGLMRFATVVLGLVS
FT                   LKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNI
FT                   LGFSAALSTNIMDCLQNVFSKKLLSGDKYRFSAPELQFYTSAAAVALLIPAWTFFMDIP
FT                   VIGRSGKSFSYSQDIVLLLLTDGALFHLQSVTAYALMGKISPVTFSVASTVKHALSIWL
FT                   SIIVFGNKITSLSAIGTILVTLGVLLYNKARQYQQETMQSLVTATSRNPEDDTEPLVPQ
FT                   DSRQHH"
FT   gap             7871122..7871141
FT                   /estimated_length=20
FT   gene            7873544..>7874576
FT                   /locus_tag="mCG_132285"
FT                   /note="gene_id=mCG132285.1"
FT   mRNA            7873544..>7874576
FT                   /locus_tag="mCG_132285"
FT                   /product="mCG132285"
FT                   /note="gene_id=mCG132285.1 transcript_id=mCT133636.1
FT                   created on 27-DEC-2002"
FT   CDS             7874444..>7874576
FT                   /codon_start=1
FT                   /locus_tag="mCG_132285"
FT                   /product="mCG132285"
FT                   /note="gene_id=mCG132285.1 transcript_id=mCT133636.1
FT                   protein_id=mCP76846.1"
FT                   /protein_id="EDL15015.1"
FT                   /translation="MADVGLICVDLSAQDLAVELLTPKSTCLWVLVGRALLAFPQTCL"
FT   gap             7875601..7875620
FT                   /estimated_length=20
FT   gene            complement(7877133..7878292)
FT                   /locus_tag="mCG_1027454"
FT                   /note="gene_id=mCG1027454.1"
FT   mRNA            complement(join(7877133..7877314,7877458..7878292))
FT                   /locus_tag="mCG_1027454"
FT                   /product="mCG1027454"
FT                   /note="gene_id=mCG1027454.1 transcript_id=mCT145158.1
FT                   created on 13-MAR-2003"
FT   CDS             complement(7877879..7878064)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027454"
FT                   /product="mCG1027454"
FT                   /note="gene_id=mCG1027454.1 transcript_id=mCT145158.1
FT                   protein_id=mCP76703.1"
FT                   /protein_id="EDL15016.1"
FT                   /translation="MKKMRDIGVKHFVIPALTLPPELSVTWKLSLISVAYITELYKPGG
FT                   GGSHLRSYHFVDRGTV"
FT   gene            <7879263..7904191
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /note="gene_id=mCG132264.2"
FT   mRNA            join(<7879263..7879336,7879926..7880049,7881169..7881284,
FT                   7883090..7883217,7884434..7884572,7888331..7888467,
FT                   7892762..7892884,7893836..7893931,7894019..7894183,
FT                   7894989..7895054,7895757..7895932,7896727..7896817,
FT                   7901741..7901862,7902120..7902225,7902541..7902662,
FT                   7902744..7902851,7902975..7903091,7903270..7903418,
FT                   7903680..7903869,7903950..7904190)
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, transcript variant
FT                   mCT190878"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT190878.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<7879263..7879336,7879926..7880049,7881169..7881284,
FT                   7883090..7883217,7884434..7884572,7888331..7888467,
FT                   7892762..7892884,7893836..7893931,7894019..7894183,
FT                   7894989..7895054,7895757..7895932,7896727..7896817,
FT                   7901741..7901862,7902120..7902225,7902541..7902662,
FT                   7902744..7902851,7902975..7903091,7903270..7903418,
FT                   7903680..7903869,7903950..7904042)
FT                   /codon_start=1
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT190878.0
FT                   protein_id=mCP111813.0 isoform=CRA_b"
FT                   /protein_id="EDL15018.1"
FT                   /translation="QSWRAPGAVPSQTPGPAAAAVAAQGVLTQMGDEKDSWKVKTLDEI
FT                   LQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMED
FT                   RGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKEREHERR
FT                   KRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKLREQQKEQREQKE
FT                   RERRAEERRKEREARREVSAHHRTMREEYSDKGKVGHWSRSPLRPPRERFEMGDNRKPV
FT                   KEEKVEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEEEEEEGSTSEES
FT                   EEEEEEEEEEEEEETGSNSEEASEQSAEEVSDEEMSEDEDRENENHILVVPESRFDRDS
FT                   GDSEEGEEEVGEGTPQSSAPTEGDYVPDSPALSPIELKQELPKYLPALQGCRSVEEFQC
FT                   LNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVT
FT                   VREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLSGVKHLHDNWI
FT                   LHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTLWYRAPELLLGAKEYST
FT                   AVDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDLGTPSEKIWPGYNDLPAVKKMTF
FT                   SEYPYNNLRKRFGALLSDQGFDLMNKFLTYYPGRRINAEDGLKHEYFRETPLPIDPSMF
FT                   PTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLK
FT                   F"
FT   mRNA            join(7879275..7879336,7879580..7879734,7879926..7880049,
FT                   7881169..7881284,7883090..7883217,7884434..7884572,
FT                   7888331..7888467,7892762..7892884,7893836..7893931,
FT                   7894019..7894183,7894989..7895054,7895757..7895932,
FT                   7896727..7896817,7901741..7901862,7902120..7902225,
FT                   7902541..7902662,7902744..7902851,7902975..7903091,
FT                   7903270..7903418,7903680..7903869,7903950..7904191)
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, transcript variant
FT                   mCT133622"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT133622.1
FT                   created on 06-DEC-2002"
FT   mRNA            join(7879278..7880049,7881169..7881284,7883090..7883217,
FT                   7884434..7884572,7888331..7888467,7892762..7892884,
FT                   7893836..7893931,7894022..7894183,7894989..7895054,
FT                   7895757..7895932,7896727..7896817,7901741..7901862,
FT                   7902120..7902225,7902541..7902662,7902744..7902851,
FT                   7902975..7903091,7903270..7903418,7903680..7903869,
FT                   7903950..7904190)
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, transcript variant
FT                   mCT133618"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT133618.0
FT                   created on 06-DEC-2002"
FT   mRNA            join(<7879305..7879336,7879926..7880168,7881169..7881284,
FT                   7883090..7883217,7884434..7884572,7888331..7888467,
FT                   7892762..7892884,7893836..7893931,7894019..7894183,
FT                   7894989..7895054,7895757..7895932,7896727..7896817,
FT                   7901741..7901862,7902120..7902225,7902541..7902662,
FT                   7902744..7902851,7902975..7903091,7903270..7903418,
FT                   7903680..7903869,7903950..7904190)
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, transcript variant
FT                   mCT190879"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT190879.0
FT                   created on 08-MAR-2004"
FT   CDS             join(7879939..7880049,7881169..7881284,7883090..7883217,
FT                   7884434..7884572,7888331..7888467,7892762..7892884,
FT                   7893836..7893931,7894019..7894183,7894989..7895054,
FT                   7895757..7895932,7896727..7896817,7901741..7901862,
FT                   7902120..7902225,7902541..7902662,7902744..7902851,
FT                   7902975..7903091,7903270..7903418,7903680..7903869,
FT                   7903950..7904042)
FT                   /codon_start=1
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, isoform CRA_d"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT133622.1
FT                   protein_id=mCP76783.1 isoform=CRA_d"
FT                   /protein_id="EDL15020.1"
FT                   /translation="MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKR
FT                   DSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEK
FT                   RKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRR
FT                   ERDRLEQLERKRERERKLREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREEY
FT                   SDKGKVGHWSRSPLRPPRERFEMGDNRKPVKEEKVEERDLLSDLQDISDSERKTSSAES
FT                   SSAESGSGSEEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEEETGSNSEEASEQSAEE
FT                   VSDEEMSEDEDRENENHILVVPESRFDRDSGDSEEGEEEVGEGTPQSSAPTEGDYVPDS
FT                   PALSPIELKQELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRL
FT                   KMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLME
FT                   TMKQPFLPGEVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREY
FT                   GSPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSDIDQ
FT                   INKIFKDLGTPSEKIWPGYNDLPAVKKMTFSEYPYNNLRKRFGALLSDQGFDLMNKFLT
FT                   YYPGRRINAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQ
FT                   LGDDDLKETGFHLTTTNQGASAAGPGFSLKF"
FT   CDS             join(7879939..7880049,7881169..7881284,7883090..7883217,
FT                   7884434..7884572,7888331..7888467,7892762..7892884,
FT                   7893836..7893931,7894022..7894183,7894989..7895054,
FT                   7895757..7895932,7896727..7896817,7901741..7901862,
FT                   7902120..7902225,7902541..7902662,7902744..7902851,
FT                   7902975..7903091,7903270..7903418,7903680..7903869,
FT                   7903950..7904042)
FT                   /codon_start=1
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT133618.0
FT                   protein_id=mCP76667.1 isoform=CRA_a"
FT                   /protein_id="EDL15017.1"
FT                   /translation="MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKR
FT                   DSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEK
FT                   RKEKRRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRR
FT                   ERDRLEQLERKRERERKLREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREEY
FT                   SDKGKVGHWSRSPLRPPRERFEMGDNRKPVKEEKVEERDLLSDLQDISDSERKTSSAES
FT                   SSESGSGSEEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEEETGSNSEEASEQSAEEV
FT                   SDEEMSEDEDRENENHILVVPESRFDRDSGDSEEGEEEVGEGTPQSSAPTEGDYVPDSP
FT                   ALSPIELKQELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLK
FT                   MEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMET
FT                   MKQPFLPGEVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYG
FT                   SPLKAYTPVVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSDIDQI
FT                   NKIFKDLGTPSEKIWPGYNDLPAVKKMTFSEYPYNNLRKRFGALLSDQGFDLMNKFLTY
FT                   YPGRRINAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQL
FT                   GDDDLKETGFHLTTTNQGASAAGPGFSLKF"
FT   CDS             join(<7880085..7880168,7881169..7881284,7883090..7883217,
FT                   7884434..7884572,7888331..7888467,7892762..7892884,
FT                   7893836..7893931,7894019..7894183,7894989..7895054,
FT                   7895757..7895932,7896727..7896817,7901741..7901862,
FT                   7902120..7902225,7902541..7902662,7902744..7902851,
FT                   7902975..7903091,7903270..7903418,7903680..7903869,
FT                   7903950..7904042)
FT                   /codon_start=1
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT190879.0
FT                   protein_id=mCP111814.0 isoform=CRA_c"
FT                   /protein_id="EDL15019.1"
FT                   /translation="RRFNFFALIFPLEQRFFGEVLLYFQMSQSDDRDSKRDSLEEGELR
FT                   DHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRS
FT                   HSAEGGKHARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLE
FT                   RKRERERKLREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREEYSDKGKVGHW
FT                   SRSPLRPPRERFEMGDNRKPVKEEKVEERDLLSDLQDISDSERKTSSAESSSAESGSGS
FT                   EEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEEETGSNSEEASEQSAEEVSDEEMSED
FT                   EDRENENHILVVPESRFDRDSGDSEEGEEEVGEGTPQSSAPTEGDYVPDSPALSPIELK
FT                   QELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGF
FT                   PITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPG
FT                   EVKTLMIQLLSGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTP
FT                   VVVTLWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDLG
FT                   TPSEKIWPGYNDLPAVKKMTFSEYPYNNLRKRFGALLSDQGFDLMNKFLTYYPGRRINA
FT                   EDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKET
FT                   GFHLTTTNQGASAAGPGFSLKF"
FT   gap             7899784..7899803
FT                   /estimated_length=20
FT   gene            complement(7904913..7907642)
FT                   /gene="Mmp23"
FT                   /locus_tag="mCG_23354"
FT                   /note="gene_id=mCG23354.0"
FT   mRNA            complement(join(7904913..7905141,7905265..7905391,
FT                   7905497..7905607,7905689..7905853,7906243..7906410,
FT                   7906480..7906619,7906707..7906843,7907286..7907642))
FT                   /gene="Mmp23"
FT                   /locus_tag="mCG_23354"
FT                   /product="matrix metallopeptidase 23"
FT                   /note="gene_id=mCG23354.0 transcript_id=mCT23189.0 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(7904967..7905141,7905265..7905391,
FT                   7905497..7905607,7905689..7905853,7906243..7906410,
FT                   7906480..7906619,7906707..7906843,7907286..7907438))
FT                   /codon_start=1
FT                   /gene="Mmp23"
FT                   /locus_tag="mCG_23354"
FT                   /product="matrix metallopeptidase 23"
FT                   /note="gene_id=mCG23354.0 transcript_id=mCT23189.0
FT                   protein_id=mCP21682.1"
FT                   /protein_id="EDL15021.1"
FT                   /translation="MGCRACLRPEASGAVQGRWLGAALSGLCLLSALALLEWLGAPTET
FT                   AWRAAQGNVDAPNVGSSTAQVPRLLTMSVTRRRRYTLTPARLRWDHFNLTYRVLSFPRN
FT                   LLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSAVHHCFD
FT                   GPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTNLVHVAAHEIGHALGLMH
FT                   SQQDQALMHLNATLRGWKALSQDELWGLHRLYGCLDRIFVCASWARKGFCDVRQRLMKR
FT                   LCPRSCDFCYEFPFPTVATTTSPTRTKTRLVREGRNMTFHCGQKILHKKGKVYWYKDQE
FT                   PLEFSYPGYLALGEAQLSIIANAVNEGTYTCVVRRHQRVLSTYSWRVRVRN"
FT   gene            complement(7908736..7923062)
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /note="gene_id=mCG23356.2"
FT   mRNA            complement(join(7908736..7909255,7909367..7909432,
FT                   7909514..7909701,7909784..7909962,7910334..7910567,
FT                   7910656..7910782,7910908..7911068,7911175..7911331,
FT                   7911428..7911576,7911651..7911784,7911860..7912022,
FT                   7912117..7912221,7913385..7913527,7913650..7913844,
FT                   7913940..7914046,7915112..7915283,7915368..7915636,
FT                   7921260..7921415,7922822..7923062))
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /product="mindbomb homolog 2 (Drosophila), transcript
FT                   variant mCT23191"
FT                   /note="gene_id=mCG23356.2 transcript_id=mCT23191.2 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(7908945..7909255,7909367..7909432,
FT                   7909514..7909701,7909784..7909962,7910334..7910567,
FT                   7910656..7910782,7910908..7911068,7911175..7911576,
FT                   7911651..7911784,7911860..7912022,7912117..7912221,
FT                   7913156..7913527,7913650..7913844,7913940..7914046,
FT                   7915112..7915283,7915368..7915636,7921260..>7921355))
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /product="mindbomb homolog 2 (Drosophila), transcript
FT                   variant mCT190909"
FT                   /note="gene_id=mCG23356.2 transcript_id=mCT190909.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7909017..7909255,7909367..7909432,
FT                   7909514..7909701,7909784..7909962,7910334..7910567,
FT                   7910656..7910782,7910908..7911068,7911175..7911331,
FT                   7911428..7911576,7911651..7911784,7911860..7912022,
FT                   7912117..7912221,7913385..7913527,7913650..7913844,
FT                   7913940..7914046,7915112..7915283,7915368..7915614))
FT                   /codon_start=1
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /product="mindbomb homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG23356.2 transcript_id=mCT23191.2
FT                   protein_id=mCP21694.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8R516"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR010606"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2679684"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R516"
FT                   /protein_id="EDL15023.1"
FT                   /translation="MDLDPHAGVQVGMRVVRGMDWKWGQQDGGEGGVGTVVELGRHGSP
FT                   STPDRTVVVQWDQGTRTNYRAGYQGAHDLLLYDNAQIGIRHPNIICDCCKKHGLRGMRW
FT                   KCRVCFDYDLCTQCYMHNKHDLTHAFERYETSHSRPVTLSPRQGLPRIPLRGIFQGAKV
FT                   VRGPDWEWGSQDGGEGKTGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLR
FT                   CVGEAAGGFYYKEHLPKLGKPAELQRRVSADGQPFQRGDKVKCLLDTDVLRDMQEGHGG
FT                   WNPRMAEHNSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNL
FT                   RVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGR
FT                   LVVEAALGNVARALDLLRRHPEQVDTKNQGRTALQVAAYLGQVELVRLLLQARASMDLP
FT                   DDEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKILCER
FT                   GCDVNLPDAHADTPLHSAISAGAGASSIVEVLTEVPGIDVTATNSQGFTLLHHASLKGH
FT                   VLAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQVLIREGRCDVNVRNRKLQSP
FT                   LHLAVQQAHLGLVPLLVDAGCSVNTEDEEGDTALHVALQRHQLLPLVADRAGGDPGPLQ
FT                   LLSRLQASGLPGCTELTVGAAVACFLALEGADVSYANHRGRSPLDLATEGRVLKALQGC
FT                   AQRFRERQAGGGGGVPPGPRHVLSTPNTVTNLHVSGTAGPEAAECLVCSELALLILFSP
FT                   CQHRTVCEECARRMKKCIRCQVVISKKLRPDGSEVVNAIQVPGPPRQLVEELQSRYRQM
FT                   EERITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQIFV"
FT   CDS             complement(join(7909017..7909255,7909367..7909432,
FT                   7909514..7909701,7909784..7909962,7910334..7910567,
FT                   7910656..7910782,7910908..7911068,7911175..>7911381))
FT                   /codon_start=1
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /product="mindbomb homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG23356.2 transcript_id=mCT190909.0
FT                   protein_id=mCP111868.0 isoform=CRA_a"
FT                   /protein_id="EDL15022.1"
FT                   /translation="SRCANGLSPNLPASTIRNQPEATRVLLSAGCAVDARNGTRSTALH
FT                   VAVQRGFLEVVKILCERGCDVNLPDAHADTPLHSAISAGAGASSIVEVLTEVPGIDVTA
FT                   TNSQGFTLLHHASLKGHVLAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQVLI
FT                   REGRCDVNVRNRKLQSPLHLAVQQAHLGLVPLLVDAGCSVNTEDEEGDTALHVALQRHQ
FT                   LLPLVADRAGGDPGPLQLLSRLQASGLPGCTELTVGAAVACFLALEGADVSYANHRGRS
FT                   PLDLATEGRVLKALQGCAQRFRERQAGGGGGVPPGPRHVLSTPNTVTNLHVSGTAGPEA
FT                   AECLVCSELALLILFSPCQHRTVCEECARRMKKCIRCQVVISKKLRPDGSEVVNAIQVP
FT                   GPPRQLVEELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPI
FT                   RDRIQIFV"
FT   gap             7926708..7933786
FT                   /estimated_length=7079
FT   gap             7945902..7945962
FT                   /estimated_length=61
FT   gene            <7945963..7947740
FT                   /locus_tag="mCG_1027372"
FT                   /note="gene_id=mCG1027372.1"
FT   mRNA            join(<7945963..7947268,7947719..7947740)
FT                   /locus_tag="mCG_1027372"
FT                   /product="mCG1027372"
FT                   /note="gene_id=mCG1027372.1 transcript_id=mCT145076.1
FT                   created on 29-JAN-2003"
FT   CDS             <7945965..7946588
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027372"
FT                   /product="mCG1027372"
FT                   /note="gene_id=mCG1027372.1 transcript_id=mCT145076.1
FT                   protein_id=mCP76891.1"
FT                   /protein_id="EDL15024.1"
FT                   /translation="LVPLQGAVRGPRDGRWAPVLSQPRSGFPLPDAGLRNVGLGGWLAA
FT                   RPRPAQSQRAAAVAPGSCRGAPRARLRAKLLVAWHLYALPLRSRAFGCLLPRLPATGRA
FT                   RQRALPLVPAAAAAARRGRRRPARAGRVRGVHRRTGSYAGDRGGHDGGRRLHLCHAGGH
FT                   LPAGGLHHREPHAPDLPATQSAQAALKRKATRPPGFHLPSALRP"
FT   gene            7956483..7984871
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /note="gene_id=mCG23351.2"
FT   mRNA            join(7956483..7956821,7966795..7966938,7982417..7982556,
FT                   7983019..7983137,7984559..7984871)
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /product="Ssu72 RNA polymerase II CTD phosphatase homolog
FT                   (yeast), transcript variant mCT23185"
FT                   /note="gene_id=mCG23351.2 transcript_id=mCT23185.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<7956495..7956821,7966795..7966938,7982417..7982556,
FT                   7983019..7983276)
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /product="Ssu72 RNA polymerase II CTD phosphatase homolog
FT                   (yeast), transcript variant mCT190899"
FT                   /note="gene_id=mCG23351.2 transcript_id=mCT190899.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7956496..7956821,7966795..7966938,7982417..7982556,
FT                   7983019..7983203)
FT                   /codon_start=1
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /product="Ssu72 RNA polymerase II CTD phosphatase homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG23351.2 transcript_id=mCT190899.0
FT                   protein_id=mCP111846.0 isoform=CRA_a"
FT                   /protein_id="EDL15025.1"
FT                   /translation="RRWSTTAGLGCSQADSASAGRPPAPAAVRAQESTVGLPTRCVALR
FT                   CVHFRVADFRLPPSSSRGSRLLGGSSVARAVGSSVGAMPSSPLRVAVVCSSNQNRSMEA
FT                   HNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGI
FT                   LHMLDRNKRIKPRPERFQNCTDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD
FT                   IQDNHEEATLGAFLICELCQCVSLSSWVLLGLLIATYKNKIK"
FT   CDS             join(7956742..7956821,7966795..7966938,7982417..7982556,
FT                   7983019..7983137,7984559..7984660)
FT                   /codon_start=1
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /product="Ssu72 RNA polymerase II CTD phosphatase homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG23351.2 transcript_id=mCT23185.2
FT                   protein_id=mCP21700.2 isoform=CRA_b"
FT                   /protein_id="EDL15026.1"
FT                   /translation="MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLP
FT                   GPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCTDL
FT                   FDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQ
FT                   HTEDMENEIDELLQEFEEKSGRAFLHTVCFY"
FT   gap             7959304..7959999
FT                   /estimated_length=696
FT   gap             7964249..7964886
FT                   /estimated_length=638
FT   gap             7985909..7986199
FT                   /estimated_length=291
FT   gene            7986213..>7991145
FT                   /locus_tag="mCG_23350"
FT                   /note="gene_id=mCG23350.2"
FT   mRNA            join(7986213..7986270,7986546..7986652,7990715..7990923,
FT                   7990997..>7991145)
FT                   /locus_tag="mCG_23350"
FT                   /product="mCG23350"
FT                   /note="gene_id=mCG23350.2 transcript_id=mCT23184.1 created
FT                   on 27-DEC-2002"
FT   CDS             join(7986214..7986270,7986546..7986652,7990715..7990923,
FT                   7990997..7991145)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23350"
FT                   /product="mCG23350"
FT                   /note="gene_id=mCG23350.2 transcript_id=mCT23184.1
FT                   protein_id=mCP21699.1"
FT                   /db_xref="GOA:B2RWJ3"
FT                   /db_xref="InterPro:IPR027947"
FT                   /db_xref="MGI:MGI:3648074"
FT                   /db_xref="UniProtKB/TrEMBL:B2RWJ3"
FT                   /protein_id="EDL15027.1"
FT                   /translation="MSMSANTMIFMILGASIVMAIACLMDMNALLDRFHNYILPHLRGE
FT                   DRVCHCNCGRHHIHYVIPYDGDQSVVDASENYFVTDNVTKQEIDLMLGLLLGFCISWFL
FT                   VWMDGVLHCAVRAWRAGRRYDGSWTWLPKLCSLRELGRRPHRPFEEPTGNMVHVKQKLY
FT                   HNGHPSPRHL"
FT   gene            complement(7991792..8012251)
FT                   /locus_tag="mCG_142032"
FT                   /note="gene_id=mCG142032.0"
FT   mRNA            complement(join(7991792..7992503,7997186..7997294,
FT                   7998470..7998637,7999829..7999899,8000315..8000366,
FT                   8001290..8001414,8001631..8001756,8002026..8002082,
FT                   8002595..8002750,8004731..8004800,8005046..8005211,
FT                   8005921..8005990,8006852..8006911,8007234..8007335,
FT                   8008249..8008325,8011959..8012251))
FT                   /locus_tag="mCG_142032"
FT                   /product="mCG142032"
FT                   /note="gene_id=mCG142032.0 transcript_id=mCT178506.0
FT                   created on 27-DEC-2002"
FT   CDS             complement(join(7992339..7992503,7997186..7997294,
FT                   7998470..7998637,7999829..7999899,8000315..8000366,
FT                   8001290..8001414,8001631..8001756,8002026..8002082,
FT                   8002595..8002750,8004731..8004800,8005046..8005211,
FT                   8005921..8005990,8006852..8006911,8007234..8007335,
FT                   8008249..8008325,8011959..8012160))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142032"
FT                   /product="mCG142032"
FT                   /note="gene_id=mCG142032.0 transcript_id=mCT178506.0
FT                   protein_id=mCP101428.0"
FT                   /db_xref="GOA:Q925I1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR021911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1919214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q925I1"
FT                   /protein_id="EDL15028.1"
FT                   /translation="MSWLFGIKGPKGEGTGPPLPLPPAQPGAEGGGDRGAGDRPSPKDK
FT                   WSNFDPTGLERAAKAARELEHSRHAKEALSLAQMQEQTLQLEQQSKLKEYEAAVEQLKS
FT                   EQIRVQAEERRKTLTEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQ
FT                   KQEAIRRATVEREMELRHKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTIL
FT                   ESIRTAGTLLGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKP
FT                   SLVRETSRISVLEALRHPIQVSRRLVSRPQDALEGVILSPSLEARVRDIAIATRNTKKN
FT                   KSLYRNVLMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAS
FT                   TSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQF
FT                   DWAINDRIDEMVCFALPQREERERLVRMYFDKYVLKPATEGKQRLKVAQFDYGKKCSEV
FT                   AQLTEGMSGREIAQLAVAWQAMAYSSEDGVLTEAMMDARVQDAVQQHQQKMQWLKVERP
FT                   DSQTNKPPHPSLLSC"
FT   gene            8012367..8014726
FT                   /gene="2610204G22Rik"
FT                   /locus_tag="mCG_1027455"
FT                   /note="gene_id=mCG1027455.0"
FT   mRNA            join(8012367..8012443,8012551..8012943,8014536..8014726)
FT                   /gene="2610204G22Rik"
FT                   /locus_tag="mCG_1027455"
FT                   /product="RIKEN cDNA 2610204G22"
FT                   /note="gene_id=mCG1027455.0 transcript_id=mCT145159.0
FT                   created on 16-DEC-2002"
FT   CDS             join(8012861..8012943,8014536..8014644)
FT                   /codon_start=1
FT                   /gene="2610204G22Rik"
FT                   /locus_tag="mCG_1027455"
FT                   /product="RIKEN cDNA 2610204G22"
FT                   /note="gene_id=mCG1027455.0 transcript_id=mCT145159.0
FT                   protein_id=mCP76705.1"
FT                   /protein_id="EDL15029.1"
FT                   /translation="MYICGCFERLQASGSYSQACIRIRELLSVGLENGFVAKKSMHCSS
FT                   RGLEVYFQQQHQASPCCL"
FT   gene            complement(8020455..8025741)
FT                   /gene="Vwa1"
FT                   /locus_tag="mCG_23349"
FT                   /note="gene_id=mCG23349.1"
FT   mRNA            complement(join(8020455..8021831,8021911..8022189,
FT                   8023890..8024447,8025635..8025741))
FT                   /gene="Vwa1"
FT                   /locus_tag="mCG_23349"
FT                   /product="von Willebrand factor A domain containing 1"
FT                   /note="gene_id=mCG23349.1 transcript_id=mCT23183.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(8021494..8021831,8021911..8022189,
FT                   8023890..8024447,8025635..8025707))
FT                   /codon_start=1
FT                   /gene="Vwa1"
FT                   /locus_tag="mCG_23349"
FT                   /product="von Willebrand factor A domain containing 1"
FT                   /note="gene_id=mCG23349.1 transcript_id=mCT23183.1
FT                   protein_id=mCP21747.2"
FT                   /protein_id="EDL15030.1"
FT                   /translation="MLFWTAFSMALSLRLALARSSIERGSTASDPQGDLLFLLDSSASV
FT                   SHYEFSRVREFVGQLVATMSFGPGALRASLVHVGSQPHTEFTFDQYSSGQAIQDAIRVA
FT                   PQRMGDTNTGLALAYAKEQLFAEEAGARPGVPKVLVWVTDGGSSDPVGPPMQELKDLGV
FT                   TIFIVSTGRGNLLELLAAASAPAEKHLHFVDVDDLPIIARELRGSITDAMQPQQLHASE
FT                   VLSSGFRLSWPPLLTADSGYYVLELVPSGKLATTRRQQLPGNATSWTWTDLDPDTDYEV
FT                   SLLPESNVHLLRPQHVRVRTLQEEAGPERIVISHARPRSLRVSWAPALGPDSALGYHVQ
FT                   LGPLQGGSLERVEVPAGQNSTTVQGLTPCTTYLVTVTAAFRSGRQRALSAKACTASGAR
FT                   TRAPQSMRPEAGPREP"
FT   gap             8025394..8025413
FT                   /estimated_length=20
FT   gap             8030570..8030787
FT                   /estimated_length=218
FT   gene            complement(8034313..8037075)
FT                   /locus_tag="mCG_1027456"
FT                   /note="gene_id=mCG1027456.1"
FT   mRNA            complement(join(8034313..8035764,8036540..8037075))
FT                   /locus_tag="mCG_1027456"
FT                   /product="mCG1027456"
FT                   /note="gene_id=mCG1027456.1 transcript_id=mCT145160.1
FT                   created on 13-MAR-2003"
FT   CDS             complement(join(8035507..8035764,8036540..8036803))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027456"
FT                   /product="mCG1027456"
FT                   /note="gene_id=mCG1027456.1 transcript_id=mCT145160.1
FT                   protein_id=mCP76711.1"
FT                   /db_xref="GOA:Q3TYP4"
FT                   /db_xref="MGI:MGI:2444329"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TYP4"
FT                   /protein_id="EDL15031.1"
FT                   /translation="MSEQERETEEDEGVASDTAPMLPRRRPTDYHISVLAPILATRGLR
FT                   TLVLSGRALVGFLLHLLLPGTVFLLVLLPAAAVVYLGFLCHSRVHPAPGPRCRALLSDR
FT                   GSAALIVFGLLSLPPLVVLAAAARSLLVRRLRPALPDPARTPAPRRPPRSSGDLADGHP
FT                   DEDKQLCAWV"
FT   gap             8036271..8036290
FT                   /estimated_length=20
FT   gene            8042004..>8044013
FT                   /locus_tag="mCG_23358"
FT                   /note="gene_id=mCG23358.1"
FT   mRNA            join(8042004..8042340,8042430..8042964,8043639..>8044013)
FT                   /locus_tag="mCG_23358"
FT                   /product="mCG23358"
FT                   /note="gene_id=mCG23358.1 transcript_id=mCT23192.1 created
FT                   on 27-DEC-2002"
FT   CDS             join(8042156..8042340,8042430..8042964,8043639..8044013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23358"
FT                   /product="mCG23358"
FT                   /note="gene_id=mCG23358.1 transcript_id=mCT23192.1
FT                   protein_id=mCP21728.1"
FT                   /protein_id="EDL15032.1"
FT                   /translation="MDSSSLEQELRWMKLVWEEAPGDKTEGPLTSPGWSTLFQAVWWGA
FT                   PSLVMQLLRQGSSVEERDHTGRTPLHLAVMRGHAPLVRLLLQRGALAGAADHTGRTPLH
FT                   EAAWHGHSNVAELLLRRGASAAACSQTGLTPLHGAAALGRTLLVTSFTVASDSGSDVKD
FT                   VRGWTAAHWAAACGQLAVLELLSAGGNADLDGALLVSAIAGSTSSLQLLLTLGAKVDTQ
FT                   DSTGATALGLAAGLGHHQDIEVLLDHGADPNIRDRNNRSALHRAATGGHLRVTQLLVAT
FT                   GIEIDARDSLGLTPLHHAARGGHVEVVSHLLDRGAHINAAGWLHKTPLHLAVENGHSTT
FT                   VELLLSRGANSTLRTQWGEAAQIP"
FT   gene            8053986..8060663
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /note="gene_id=mCG23357.2"
FT   mRNA            join(8053986..8054195,8054286..8054396,8057296..8057373,
FT                   8057685..8057846)
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, transcript
FT                   variant mCT176823"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT176823.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(8054068..8054195,8054286..8054396,8057296..8057373,
FT                   8059167..8059396,8060366..8060663)
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, transcript
FT                   variant mCT23187"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT23187.1 created
FT                   on 06-DEC-2002"
FT   mRNA            join(8054069..8054195,8054286..8054396,8057296..8057373,
FT                   8059167..8059517)
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, transcript
FT                   variant mCT176822"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT176822.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(8054109..8054195,8054286..8054396,8057296..8057373,
FT                   8059167..8059340)
FT                   /codon_start=1
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT23187.1
FT                   protein_id=mCP21709.2 isoform=CRA_b"
FT                   /protein_id="EDL15034.1"
FT                   /translation="MVFLTTRLWLRNRLTDRYWRVQEVLKHAQHFRGRKNRCYRLAVRA
FT                   VTRAFVKCTKARRLKKRNLRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNRKVLVD
FT                   LAIYEPKTFKSLAALAKRRQQEGFAAALGDGKEPEGIFSRVVQYH"
FT   CDS             join(8054109..8054195,8054286..8054396,8057296..8057373,
FT                   8059167..8059340)
FT                   /codon_start=1
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT176822.0
FT                   protein_id=mCP99745.0 isoform=CRA_b"
FT                   /protein_id="EDL15035.1"
FT                   /translation="MVFLTTRLWLRNRLTDRYWRVQEVLKHAQHFRGRKNRCYRLAVRA
FT                   VTRAFVKCTKARRLKKRNLRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNRKVLVD
FT                   LAIYEPKTFKSLAALAKRRQQEGFAAALGDGKEPEGIFSRVVQYH"
FT   CDS             join(8054109..8054195,8054286..8054396,8057296..8057373,
FT                   8057685..8057816)
FT                   /codon_start=1
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT176823.0
FT                   protein_id=mCP99744.0 isoform=CRA_a"
FT                   /protein_id="EDL15033.1"
FT                   /translation="MVFLTTRLWLRNRLTDRYWRVQEVLKHAQHFRGRKNRCYRLAVRA
FT                   VTRAFVKCTKARRLKKRNLRTLWINRITAASQEHGLKYPAFIVNLIKGFSVQPWLSWNS
FT                   LCRPGWLRTQKSTCLCLPSAGIKGMCHNCPS"
FT   gene            complement(<8062756..8063556)
FT                   /locus_tag="mCG_147505"
FT                   /note="gene_id=mCG147505.0"
FT   mRNA            complement(<8062756..8063556)
FT                   /locus_tag="mCG_147505"
FT                   /product="mCG147505"
FT                   /note="gene_id=mCG147505.0 transcript_id=mCT187768.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<8062756..8063132)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147505"
FT                   /product="mCG147505"
FT                   /note="gene_id=mCG147505.0 transcript_id=mCT187768.0
FT                   protein_id=mCP109464.0"
FT                   /protein_id="EDL15036.1"
FT                   /translation="MAAPPRPLPLAERHRCLDAVGRTTSPSVSRQAPTPEAPTGGAARY
FT                   PLGPAAWPEPELLPGKRGSRRAPFFGGWDRTTFLPQSHVHDVTPRLSSESLVLSPPFRP
FT                   RALEQLWGGSASIKRADVPLIP"
FT   gene            <8063161..8075181
FT                   /locus_tag="mCG_23353"
FT                   /note="gene_id=mCG23353.3"
FT   mRNA            join(<8063161..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068582,8069134..8071023,
FT                   8071376..8071480,8071565..8071706,8072400..8072508,
FT                   8072593..8072685,8073982..8075181)
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, transcript variant mCT190903"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190903.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(8063174..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068582,8070924..8071023,
FT                   8071376..8071480,8071565..8071706,8072400..8072508,
FT                   8072593..8072685,8073982..8074939)
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, transcript variant mCT23188"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT23188.1 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8063180..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068582,8069134..8071023,
FT                   8071376..8071480,8071565..8071706,8072397..8072508,
FT                   8072593..8072685,8073982..8074993)
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, transcript variant mCT190902"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190902.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(8063190..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068582,8070924..8071023,
FT                   8071376..8071480,8071565..8071706,8072400..8072508,
FT                   8072593..8072685,8073982..8074336)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, isoform CRA_d"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT23188.1
FT                   protein_id=mCP21676.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9JJA7"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="InterPro:IPR017060"
FT                   /db_xref="MGI:MGI:1927119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJA7"
FT                   /protein_id="EDL15040.1"
FT                   /translation="MAAAAAGAAGLMAPAAAACSSGSAGAAPGSQGVLIGDRLYSGVLI
FT                   TLENCLLPDDKLRFTPSMSSGLDVDTETGLRVVGCELIQAAGILLRLPQVAMATGQVLF
FT                   QRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHRLRHLREKKKPVPLVL
FT                   DQEYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQHLVQTAWNYMN
FT                   DSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICFKILQL
FT                   YTRKKVDLTHLESEVEKRKHAIEEAKARAKGLLPGSAPGLDSAAGFSPAPKLESPKEGK
FT                   GGKPSPPSGKSAKRKMEGPKKAQGHSPVNGLLKGQESRSQSRSREQSYSRSPSRSASPK
FT                   RRKSDSGSTSGGSKSQSRSRSRSDSPPRQVHRGAPYKGSEVRGSRKSKDCKYLTQKPHK
FT                   SRSRSSSRSRSRSRERTDNSGKYKKKSHYYRDQRRERSRSYERTGHRYERDHPGHSRHR
FT                   R"
FT   mRNA            join(<8063362..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068554,8074199..8074977)
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, transcript variant mCT190904"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190904.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8063364..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068554,8074199..8074245)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, isoform CRA_c"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190904.0
FT                   protein_id=mCP111849.0 isoform=CRA_c"
FT                   /protein_id="EDL15039.1"
FT                   /translation="FTPSMSSGLDVDTETGLRVVGCELIQAAGILLRLPQVAMATGQVL
FT                   FQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHRLRHLREKKKPVPLV
FT                   LDQEYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECEPDGQFWKIQEEKS
FT                   LL"
FT   CDS             join(<8070847..8071023,8071376..8071480,8071565..8071706,
FT                   8072397..8072508,8072593..8072685,8073982..8074336)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, isoform CRA_a"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190902.0
FT                   protein_id=mCP111847.0 isoform=CRA_a"
FT                   /protein_id="EDL15037.1"
FT                   /translation="EQPTTFDDTWWHNCPWHYSLPGFGFRNYMNDSLRTDVFVRFQPES
FT                   IACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICFKILQLYTRKKVDLTHLESEV
FT                   EKRKHAIEEAKARAKGLLPGSAPGLDSAAGFSPAPKLVESPKEGKGGKPSPPSGKSAKR
FT                   KMEGPKKAQGHSPVNGLLKGQESRSQSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSK
FT                   SQSRSRSRSDSPPRQVHRGAPYKGSEVRGSRKSKDCKYLTQKPHKSRSRSSSRSRSRSR
FT                   ERTDNSGKYKKKSHYYRDQRRERSRSYERTGHRYERDHPGHSRHRR"
FT   CDS             join(<8070847..8071023,8071376..8071480,8071565..8071706,
FT                   8072400..8072508,8072593..8072685,8073982..8074336)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, isoform CRA_b"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190903.0
FT                   protein_id=mCP111848.0 isoform=CRA_b"
FT                   /protein_id="EDL15038.1"
FT                   /translation="EQPTTFDDTWWHNCPWHYSLPGFGFRNYMNDSLRTDVFVRFQPES
FT                   IACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICFKILQLYTRKKVDLTHLESEV
FT                   EKRKHAIEEAKARAKGLLPGSAPGLDSAAGFSPAPKLESPKEGKGGKPSPPSGKSAKRK
FT                   MEGPKKAQGHSPVNGLLKGQESRSQSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSKS
FT                   QSRSRSRSDSPPRQVHRGAPYKGSEVRGSRKSKDCKYLTQKPHKSRSRSSSRSRSRSRE
FT                   RTDNSGKYKKKSHYYRDQRRERSRSYERTGHRYERDHPGHSRHRR"
FT   gap             8077379..8077398
FT                   /estimated_length=20
FT   gene            8081866..8083280
FT                   /gene="Aurkaip1"
FT                   /locus_tag="mCG_23352"
FT                   /note="gene_id=mCG23352.0"
FT   mRNA            join(8081866..8081956,8082203..8082290,8082572..8083017,
FT                   8083111..8083280)
FT                   /gene="Aurkaip1"
FT                   /locus_tag="mCG_23352"
FT                   /product="aurora kinase A interacting protein 1"
FT                   /note="gene_id=mCG23352.0 transcript_id=mCT23186.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(8082236..8082290,8082572..8083017,8083111..8083212)
FT                   /codon_start=1
FT                   /gene="Aurkaip1"
FT                   /locus_tag="mCG_23352"
FT                   /product="aurora kinase A interacting protein 1"
FT                   /note="gene_id=mCG23352.0 transcript_id=mCT23186.0
FT                   protein_id=mCP21675.1"
FT                   /db_xref="GOA:Q3TZ21"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="MGI:MGI:1913327"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TZ21"
FT                   /protein_id="EDL15041.1"
FT                   /translation="MFLARLTSRLARTVVPWAGFSRSCPGSGVIGSYAFRPLYSLQPAS
FT                   PSRAASLPGKRTQLELEEFLVPRKMAISPLESWLTAQYLLPRRNVEVPVTLAPSQFYEC
FT                   PPRQGEEEAQQGVREAWDATPVQCKNVLKIRRRKMNHHKYRKLVKRTRFLRRKVREGRL
FT                   KKKQIKFEKDLKRIWLKAGLKEAPENWQTPKIYLKNK"
FT   gap             8087071..8087173
FT                   /estimated_length=103
FT   gene            8090384..8094642
FT                   /gene="Mxra8"
FT                   /locus_tag="mCG_132165"
FT                   /note="gene_id=mCG132165.0"
FT   mRNA            join(8090384..8090477,8091363..8091383,8091491..8091793,
FT                   8092029..8092130,8092246..8092716,8093085..8093243,
FT                   8093321..8093360,8093433..8093509,8093586..8093666,
FT                   8093832..8094642)
FT                   /gene="Mxra8"
FT                   /locus_tag="mCG_132165"
FT                   /product="matrix-remodelling associated 8"
FT                   /note="gene_id=mCG132165.0 transcript_id=mCT133512.0
FT                   created on 06-DEC-2002"
FT   CDS             join(8090429..8090477,8091363..8091383,8091491..8091793,
FT                   8092029..8092130,8092246..8092716,8093085..8093243,
FT                   8093321..8093360,8093433..8093509,8093586..8093666,
FT                   8093832..8093857)
FT                   /codon_start=1
FT                   /gene="Mxra8"
FT                   /locus_tag="mCG_132165"
FT                   /product="matrix-remodelling associated 8"
FT                   /note="gene_id=mCG132165.0 transcript_id=mCT133512.0
FT                   protein_id=mCP76754.1"
FT                   /protein_id="EDL15042.1"
FT                   /translation="MELLSRVLLWKLLLLQSSAVLSSGPSGTAAASNSLVSESVVSLAA
FT                   GTQAVLRCQSPRMVWTQDRLHDRQRVVHWDLSGDPGSQRRRLVDMYSAGEQRVYEPRDR
FT                   DRLLLSPSAFHDGNFSLLIRAVERGDEGVYTCNLHHHYCHLDESLAVRLEVTDDPLLSR
FT                   AYWDGEKEVLVVAHGAPALMTCINRAHVWTDRHLEEAQQVVHWDRQLPGVSHDRADRLL
FT                   DLYASGERRAYGPPFLRDRVSVNTNAFARGDFSLRIDELERADEGIYSCHLHHHYCGLH
FT                   ERRVFHLQVTEPAFEPPARASPGNGSGHSSAPSPDPTLTRGHSIINVIVPEDHTHFFQQ
FT                   LGYVLATLLLFILLLITVVLATRHRHSGGCKTSDKKAGKSKGKDVNMVEFAVATRDQAP
FT                   YRTEDIQLDYKNNILKERAELAHSPLPAKDVDLDKEFRKEYCK"
FT   gene            8097797..8109639
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /note="gene_id=mCG23342.2"
FT   mRNA            join(8097797..8098229,8103757..8103826,8103976..8104097,
FT                   8104322..8104425,8104668..8104806,8104904..8104997,
FT                   8105069..8105138,8105224..8105363,8105442..8105518,
FT                   8105610..8105677,8105805..8105957,8106469..8106600,
FT                   8106699..8106866,8106951..8107157,8108330..8109639)
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila),
FT                   transcript variant mCT23176"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT23176.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8097996..8098229,8103757..8103826,8103976..8104097,
FT                   8104322..8104425,8104668..8104806,8104904..8105363,
FT                   8105442..8105518,8105610..8105677,8105805..8105957,
FT                   8106469..8106600,8106699..8106866,8106951..8107157,
FT                   8107833..8107871,8108330..8109638)
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila),
FT                   transcript variant mCT190872"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT190872.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8098060..8098229,8103757..8103826,8103976..8104102,
FT                   8104337..8104425,8104668..8104806,8104904..8104997,
FT                   8105069..8105138,8105224..8105363,8105442..8105518,
FT                   8105610..8105677,8105805..8105957,8106469..8106600,
FT                   8106699..8106866,8106951..8107157,8108330..>8108703)
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila),
FT                   transcript variant mCT190871"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT190871.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(8098060..8098229,8103757..8103826,8103976..8104097,
FT                   8104322..8104425,8104668..8104806,8104904..8104997,
FT                   8105069..8105138,8105224..8105363,8105442..8105518,
FT                   8105610..8105677,8105805..8105957,8106469..8106600,
FT                   8106699..8106866,8106951..8107157,8108330..8108703)
FT                   /codon_start=1
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT23176.2
FT                   protein_id=mCP21759.2 isoform=CRA_c"
FT                   /db_xref="GOA:P51141"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001158"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR003351"
FT                   /db_xref="InterPro:IPR008339"
FT                   /db_xref="InterPro:IPR008340"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015506"
FT                   /db_xref="InterPro:IPR024580"
FT                   /db_xref="MGI:MGI:94941"
FT                   /db_xref="PDB:1FSH"
FT                   /db_xref="PDB:1MC7"
FT                   /db_xref="PDB:2KAW"
FT                   /db_xref="PDB:3PZ8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51141"
FT                   /protein_id="EDL15045.1"
FT                   /translation="MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAY
FT                   KFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPP
FT                   PLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNRDEAARTNGHP
FT                   RGDRRRDLGLPPDSASTVLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLVRKHKCR
FT                   RRKQRLRQTDRASSFSSITDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIG
FT                   SIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWD
FT                   PTPRSYFTIPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVP
FT                   GAPQLEEAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHV
FT                   EGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGAS
FT                   DQDTLAPLPHPSVPWPLGQGYPYQYPGPPPCFPPAYQDPGFSCGSGSAGSQQSEGSKSS
FT                   GSTRSSHRTPGREERRATGAGGSGSESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQAS
FT                   AVAPGLPPLHPLTKAYAVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDI
FT                   M"
FT   CDS             join(<8104056..8104102,8104337..8104425,8104668..8104806,
FT                   8104904..8104997,8105069..8105138,8105224..8105363,
FT                   8105442..8105518,8105610..8105677,8105805..8105957,
FT                   8106469..8106600,8106699..8106866,8106951..8107157,
FT                   8108330..8108703)
FT                   /codon_start=1
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT190871.0
FT                   protein_id=mCP111841.0 isoform=CRA_a"
FT                   /protein_id="EDL15043.1"
FT                   /translation="EDRRHWGLQAPLLPVSSRDGMDNETGTESMVSHRRERARRRNRDE
FT                   AARTNGHPRGDRRRDLGLPPDSASTVLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSR
FT                   LVRKHKCRRRKQRLRQTDRASSFSSITDSTMSLNIITVTLNMERHHFLGISIVGQSNDR
FT                   GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPIS
FT                   LTVAKCWDPTPRSYFTIPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAITRTSS
FT                   SSLTSSVPGAPQLEEAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADV
FT                   VDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGDLCSNLASLNL
FT                   NSGSSGASDQDTLAPLPHPSVPWPLGQGYPYQYPGPPPCFPPAYQDPGFSCGSGSAGSQ
FT                   QSEGSKSSGSTRSSHRTPGREERRATGAGGSGSESDHTVPSGSGSTGWWERPVSQLSRG
FT                   SSPRSQASAVAPGLPPLHPLTKAYAVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGN
FT                   PCEFFVDIM"
FT   CDS             join(<8105112..8105363,8105442..8105518,8105610..8105677,
FT                   8105805..8105957,8106469..8106600,8106699..8106866,
FT                   8106951..8107157,8107833..8107843)
FT                   /codon_start=1
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT190872.0
FT                   protein_id=mCP111842.0 isoform=CRA_b"
FT                   /protein_id="EDL15044.1"
FT                   /translation="TSSPSLSTWVRPCGLWGPAGGGYSLGSFGGLLTAPPAERHHFLGI
FT                   SIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLRE
FT                   IVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDPAAWLSHTAALTGALPRYGTSPC
FT                   SSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITI
FT                   ANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGDL
FT                   CSNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPYQYPGPPPCFPPAYQDPGFS
FT                   CGSGSAGSQQSEALD"
FT   gene            complement(8109615..8113676)
FT                   /gene="Tas1r3"
FT                   /locus_tag="mCG_56364"
FT                   /note="gene_id=mCG56364.1"
FT   mRNA            complement(join(8109615..8111469,8111645..8111765,
FT                   8111864..8112061,8112173..8112976,8113057..8113357,
FT                   8113467..8113676))
FT                   /gene="Tas1r3"
FT                   /locus_tag="mCG_56364"
FT                   /product="taste receptor, type 1, member 3"
FT                   /note="gene_id=mCG56364.1 transcript_id=mCT56547.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(8110508..8111469,8111645..8111765,
FT                   8111864..8112061,8112173..8112976,8113057..8113357,
FT                   8113467..8113657))
FT                   /codon_start=1
FT                   /gene="Tas1r3"
FT                   /locus_tag="mCG_56364"
FT                   /product="taste receptor, type 1, member 3"
FT                   /note="gene_id=mCG56364.1 transcript_id=mCT56547.1
FT                   protein_id=mCP41699.2"
FT                   /protein_id="EDL15046.1"
FT                   /translation="MPALAIMGLSLAAFLELGMGASLCLSQQFKAQGDYILGGLFPLGS
FT                   TEEATLNQRAQPNSTLCNRFSPLGLFLAMAMKMAVEEINNGSALLPGLRLGYDLFDTCS
FT                   EPVVTMKSSLMFLAKVGSQSIAAYCNYTQYQPRVLAVIGPHSSELALITGKFFSFFLMP
FT                   QVSYSASMDRLSDRETFPSFFRTVPSDRVQLQAVVTLLQNFSWNWVAALGSDDDYGREG
FT                   LSIFSSLANARGICIAHEGLVPQHDTSGQQLGKVLDVLRQVNQSKVQVVVLFASARAVY
FT                   SLFSYSIHHGLSPKVWVASESWLTSDLVMTLPNIARVGTVLGFLQRGALLPEFSHYVET
FT                   HLALAADPAFCASLNAELDLEEHVMGQRCPQCDDIMLQNLSSGLLQNLSAGQLHHQIFA
FT                   TYAAVYSVAQALHNTLQCNVSHCHVSEHVLPWQLLENMYNMSFHARDLTLQFDAEGNVD
FT                   MEYDLKMWVWQSPTPVLHTVGTFNGTLQLQQSKMYWPGNQVPVSQCSRQCKDGQVRRVK
FT                   GFHSCCYDCVDCKAGSYRKHPDDFTCTPCNQDQWSPEKSTACLPRRPKFLAWGEPVVLS
FT                   LLLLLCLVLGLALAALGLSVHHWDSPLVQASGGSQFCFGLICLGLFCLSVLLFPGRPSS
FT                   ASCLAQQPMAHLPLTGCLSTLFLQAAETFVESELPLSWANWLCSYLRGLWAWLVVLLAT
FT                   FVEAALCAWYLTAFPPEVVTDWSVLPTEVLEHCHVRSWVSLGLVHITNAMLAFLCFLGT
FT                   FLVQSQPGRYNRARGLTFAMLAYFITWVSFVPLLANVQVAYQPAVQMGAILVCALGILV
FT                   TFHLPKCYVLLWLPKLNTQEFFLGRNAKKAADENSGGGEAAQEHNE"
FT   gene            complement(8115592..8119747)
FT                   /gene="BC002216"
FT                   /locus_tag="mCG_23341"
FT                   /note="gene_id=mCG23341.1"
FT   mRNA            complement(join(8115592..8117191,8117419..8117643,
FT                   8119475..8119747))
FT                   /gene="BC002216"
FT                   /locus_tag="mCG_23341"
FT                   /product="cDNA sequence BC002216"
FT                   /note="gene_id=mCG23341.1 transcript_id=mCT23175.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(8116663..8117191,8117419..8117540))
FT                   /codon_start=1
FT                   /gene="BC002216"
FT                   /locus_tag="mCG_23341"
FT                   /product="cDNA sequence BC002216"
FT                   /note="gene_id=mCG23341.1 transcript_id=mCT23175.1
FT                   protein_id=mCP21758.1"
FT                   /protein_id="EDL15047.1"
FT                   /translation="MDDSEKDFNLKVVLVSFKQCLTDKGEVLLDHYIAGWKGLVRFLNS
FT                   LGAVFSFISKDVVAKLQIMERLRSSPQSEHYTSLQSMVAYEVSNKLVDMDHRSHPRHPH
FT                   SGCRTVLRLHRALHWLQLFLDGLRTSSEDARTSTLCSEAYNATLANYHSWIVRQAVTVA
FT                   FCALPSRKVFLEAMNMESTEQAVEMLGEALPFIEHVYDISQKLYAEHSLLDLP"
FT   gene            8119881..8139576
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /note="gene_id=mCG23348.1"
FT   mRNA            join(8119881..8120028,8122435..8122532,8123166..8123239,
FT                   8125726..8125954,8135450..8135548,8135639..8135673,
FT                   8135917..8136055,8136446..8136510,8137152..8137341,
FT                   8137470..8137553,8137786..8137875,8137959..8138121,
FT                   8138209..8138316,8138402..8138463,8138538..8138680,
FT                   8138750..8138879,8138974..8139576)
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /product="cleavage and polyadenylation specific factor
FT                   3-like, transcript variant mCT23181"
FT                   /note="gene_id=mCG23348.1 transcript_id=mCT23181.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8119950..8120028,8122435..8122532,8123166..8123239,
FT                   8125817..8125954,8135450..8135548,8135639..8135673,
FT                   8135917..8136055,8136446..8136510,8137152..>8137273)
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /product="cleavage and polyadenylation specific factor
FT                   3-like, transcript variant mCT190883"
FT                   /note="gene_id=mCG23348.1 transcript_id=mCT190883.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(8120001..8120028,8122435..8122532,8123166..8123239,
FT                   8125726..8125954,8135450..8135548,8135639..8135673,
FT                   8135917..8136055,8136446..8136510,8137152..8137341,
FT                   8137470..8137553,8137786..8137875,8137959..8138121,
FT                   8138209..8138316,8138402..8138463,8138538..8138680,
FT                   8138750..8138879,8138974..8139039)
FT                   /codon_start=1
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /product="cleavage and polyadenylation specific factor
FT                   3-like, isoform CRA_b"
FT                   /note="gene_id=mCG23348.1 transcript_id=mCT23181.2
FT                   protein_id=mCP21764.2 isoform=CRA_b"
FT                   /protein_id="EDL15049.1"
FT                   /translation="MPEIRVTPLGAGQDVGRSCILVSISGKNVMLDCGMHMGYNDDRRF
FT                   PDFSYITQSGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILL
FT                   EDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAM
FT                   FQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFL
FT                   KKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKL
FT                   FITWTNQKIRKTFVQRNMFEFKHIKAFDRTFADNPGPMVVFATPGMLHAGQSLQIFRKW
FT                   AGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQMLEVKMQVEYMSFSAHADAKGIM
FT                   QLVGQAEPESVLLVHGEAKKMEFLRQKIEQEFRVSCYMPANGETVTLPTSPSIPVGISL
FT                   GLLKREMVQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHL
FT                   QDTRKEQETALRVYSHLKSTLKDHCVQHLPDGSVTVESILIQAAAHSEDPGTKVLLVSW
FT                   TYQDEELGSFLTTLLKNGLPQAPS"
FT   CDS             join(<8123216..8123239,8125817..8125954,8135450..8135548,
FT                   8135639..8135673,8135917..8136055,8136446..8136510,
FT                   8137152..>8137273)
FT                   /codon_start=1
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /product="cleavage and polyadenylation specific factor
FT                   3-like, isoform CRA_a"
FT                   /note="gene_id=mCG23348.1 transcript_id=mCT190883.0
FT                   protein_id=mCP111845.0 isoform=CRA_a"
FT                   /protein_id="EDL15048.1"
FT                   /translation="LSGLCDHQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVV
FT                   AVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWID
FT                   KCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILL
FT                   ETFWERMNLKVPIYFSTGLTEKANHYYKLFITWTNQKIRKTFVQ"
FT   gene            complement(8138233..8142080)
FT                   /locus_tag="mCG_23338"
FT                   /note="gene_id=mCG23338.2"
FT   mRNA            complement(join(8138233..8138621,8138877..8139121,
FT                   8139788..8139950,8140023..8140077,8140850..8141020,
FT                   8141104..8141253,8141400..8141763,8141920..8142080))
FT                   /locus_tag="mCG_23338"
FT                   /product="mCG23338, transcript variant mCT23173"
FT                   /note="gene_id=mCG23338.2 transcript_id=mCT23173.2 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(8139024..8139121,8139788..8139950,
FT                   8140023..8140077,8140850..8141020,8141104..8141253,
FT                   8141400..8141617))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23338"
FT                   /product="mCG23338, isoform CRA_b"
FT                   /note="gene_id=mCG23338.2 transcript_id=mCT23173.2
FT                   protein_id=mCP21763.2 isoform=CRA_b"
FT                   /protein_id="EDL15051.1"
FT                   /translation="MWQPPVRFPQEAAKRLNSVDPVRFTISSRTDAGVHALSNAAHLDI
FT                   QRRPGQSPFSPEVVAKALNTHLKHPAIRVLKAFRVPNDFHARHAATSRTYQYRLATGCS
FT                   WPNQLPVFEQNVCWALQTEYLDMAAMQEAAQHLLGTHDFSAFQSAGSPVTNTVRTLRRV
FT                   SVSPGPASPFVLPEGSRRLQFWTLEFESQSFLYRQVRRMTAVLVAVGLGILAPTQVKVI
FT                   LESQDPLGKYQARVAPARGLFLKSVLYDNFGHPPLGRSPGPAGRTARDKSSGFLVDTCQ
FT                   LGA"
FT   mRNA            complement(join(8139270..8139522,8139788..8139950,
FT                   8140023..8140077,8140850..8141020,8141104..8141253,
FT                   8141400..8141587,8141706..8142059))
FT                   /locus_tag="mCG_23338"
FT                   /product="mCG23338, transcript variant mCT177836"
FT                   /note="gene_id=mCG23338.2 transcript_id=mCT177836.0 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(8139509..8139522,8139788..8139950,
FT                   8140023..8140077,8140850..8141010))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23338"
FT                   /product="mCG23338, isoform CRA_a"
FT                   /note="gene_id=mCG23338.2 transcript_id=mCT177836.0
FT                   protein_id=mCP100758.0 isoform=CRA_a"
FT                   /protein_id="EDL15050.1"
FT                   /translation="MAAMQEAAQHLLGTHDFSAFQSAGSPVTNTVRTLRRVSVSPGPAS
FT                   PFVLPEGSRRLQFWTLEFESQSFLYRQVRRMTAVLVAVGLGILAPTQVKVILESQDPLG
FT                   KYQARVAPARGLFLKSVLYDNFGPTS"
FT   gene            8142250..8157130
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /note="gene_id=mCG23347.2"
FT   mRNA            join(8142250..8142789,8145834..8145918,8146452..8146509,
FT                   8146908..8147027,8147225..8147278,8148672..8148730,
FT                   8149227..8149410,8149769..8149813,8149899..8149994,
FT                   8150097..8150171,8151468..8151595,8151684..8151735,
FT                   8151940..8152040,8152113..8152224,8152466..8152674,
FT                   8152768..8152837,8152947..8153041,8153119..8153321,
FT                   8153558..8153665,8154688..8154786,8154873..8155108,
FT                   8155285..8155394,8155483..8155593,8155688..8157130)
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, transcript variant mCT23182"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT23182.2 created
FT                   on 30-DEC-2002"
FT   mRNA            join(8142250..8142789,8146452..8146509,8146908..8147027,
FT                   8147225..8147278,8148672..8148730,8149227..8149410,
FT                   8149769..8149813,8149899..8149994,8150097..8150171,
FT                   8151483..8151595,8151684..8151735,8151940..8152040,
FT                   8152113..8152224,8152466..8152674,8152768..8152837,
FT                   8152947..8153041,8153119..8153218,8154983..8155108,
FT                   8155285..8155394,8155483..8155593,8155688..8156218)
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, transcript variant mCT177837"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT177837.0 created
FT                   on 30-DEC-2002"
FT   mRNA            join(<8142656..8142789,8146452..8146509,8146908..8147027,
FT                   8147225..8147278,8148672..8148730,8149227..8149410,
FT                   8149769..8149813,8149899..8149994,8150097..8150171,
FT                   8151468..8151595,8151684..8151735,8151940..8152040,
FT                   8152113..8152224,8152466..8152674,8152768..8152837,
FT                   8152947..8153041,8153119..8153665,8154688..8154786,
FT                   8154873..8155108,8155285..8155394,8155483..8155593,
FT                   8155688..8157130)
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, transcript variant mCT190882"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT190882.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8142725..8142789,8146452..8146509,8146908..8147027,
FT                   8147225..8147278,8148672..8148730,8149227..8149410,
FT                   8149769..8149813,8149899..8149994,8150097..8150171,
FT                   8151468..8151595,8151684..8151735,8151940..8152040,
FT                   8152113..8152224,8152466..8152674,8152768..8152837,
FT                   8152947..8153041,8153119..8153350)
FT                   /codon_start=1
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, isoform CRA_b"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT190882.0
FT                   protein_id=mCP111844.0 isoform=CRA_b"
FT                   /protein_id="EDL15053.1"
FT                   /translation="APLAAAMTVEFEECIKDSPRFRATIDEVETDVVEIEAKLDKLVKL
FT                   CSGMIEAGKAYVTTNRLFVSGVRDLSQQCQGDTVISECLQRFGDSLQEMVNYHTILFDQ
FT                   AQRSVRQQLHNFVKEDVRKFKETKKQFDKVREDMELSLVRNAQAPRHRPHEVEEATGAL
FT                   TVTRKCFRHLALDYVLQINVLQAKKKFEILDSMLSFMHAQYSFFQQGYSLLHQLDPYMK
FT                   KLAAELDQLVIDSAVEKREMERKHAAIQQRLCLPQDFSYDEPKVEFDVDAPSGVVMEGY
FT                   LFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDALTVVVDDLRLCSVKPCEDIERRFCFE
FT                   VVSPTKSCMLQADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDST
FT                   TDSRERGVKGESVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVH
FT                   CSKVRSLTLDSWEPELLKLMCELGNSTVNQIYEAQCEGPGVRKPTASSSRQDKEAWIKD
FT                   KYVEKKFLRKLTSAPAREPPRRWRAQKCQRPHSSPHAPTTRRKVRLEPVLPSVAALSSG
FT                   GRAARSCT"
FT   CDS             join(8142743..8142789,8146452..8146509,8146908..8147027,
FT                   8147225..8147278,8148672..8148730,8149227..8149410,
FT                   8149769..8149813,8149899..8149994,8150097..8150171,
FT                   8151483..8151595,8151684..8151735,8151940..8152040,
FT                   8152113..8152224,8152466..8152674,8152768..8152837,
FT                   8152947..8153041,8153119..8153218,8154983..8155108,
FT                   8155285..8155394,8155483..8155593,8155688..8155835)
FT                   /codon_start=1
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, isoform CRA_a"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT177837.0
FT                   protein_id=mCP100759.0 isoform=CRA_a"
FT                   /protein_id="EDL15052.1"
FT                   /translation="MTVEFEECIKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMIE
FT                   AGKAYVTTNRLFVSGVRDLSQQCQGDTVISECLQRFGDSLQEMVNYHTILFDQAQRSVR
FT                   QQLHNFVKEDVRKFKETKKQFDKVREDMELSLVRNAQAPRHRPHEVEEATGALTVTRKC
FT                   FRHLALDYVLQINVLQAKKKFEILDSMLSFMHAQYSFFQQGYSLLHQLDPYMKKLAAEL
FT                   DQLVIDSAVEKREMERKHAAIQQRDFSYDEPKVEFDVDAPSGVVMEGYLFKRASNAFKT
FT                   WNRRWFSIQNSQLVYQKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQ
FT                   ADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSTTDSRERGVKGE
FT                   SVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDS
FT                   WEPELLKLMCELGNSTVNQIYEAQCEGPGVRKPTASSSRQDKEAWIKDKYVEKKFLRKL
FT                   TSAPAREPPRRWRAHQAARTRDLPALAAALAHGAEVNWADAADEGKTPLVQAVLGGSLI
FT                   VCEFLLQNGADVNQRDSLGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQQDPLTIA
FT                   VQAANADIVTLLRLARMAEEMREAEAPPGQPGPLPGSSPTELQYRRCIQEFIGLHLEES
FT                   "
FT   CDS             join(8146929..8147027,8147225..8147278,8148672..8148730,
FT                   8149227..8149410,8149769..8149813,8149899..8149994,
FT                   8150097..8150171,8151468..8151595,8151684..8151735,
FT                   8151940..8152040,8152113..8152224,8152466..8152674,
FT                   8152768..8152837,8152947..8153041,8153119..8153321,
FT                   8153558..8153665,8154688..8154786,8154873..8155108,
FT                   8155285..8155394,8155483..8155593,8155688..8155835)
FT                   /codon_start=1
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, isoform CRA_c"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT23182.2
FT                   protein_id=mCP21744.2 isoform=CRA_c"
FT                   /protein_id="EDL15054.1"
FT                   /translation="MIEAGKAYVTTNRLFVSGVRDLSQQCQGDTVISECLQRFGDSLQE
FT                   MVNYHTILFDQAQRSVRQQLHNFVKEDVRKFKETKKQFDKVREDMELSLVRNAQAPRHR
FT                   PHEVEEATGALTVTRKCFRHLALDYVLQINVLQAKKKFEILDSMLSFMHAQYSFFQQGY
FT                   SLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKHAAIQQRLCLPQDFSYDEPKVEFDV
FT                   DAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDALTVVVDDLRLCSVKP
FT                   CEDIERRFCFEVVSPTKSCMLQADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRT
FT                   ASPSTSSIDSTTDSRERGVKGESVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIE
FT                   CSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSTVNQIYEAQCEGPGVRKPTASS
FT                   SRQDKEAWIKDKYVEKKFLRKLTSAPAREPPRRWRAQKCQRPHSSPHAPTTRRKVRLEP
FT                   VLPSVAALSSAATMERKFRRDSLFCPDELDSLFSYFDAGAAGAGPRSLSSDSGLGGSSD
FT                   GSSDVLAFGTGSVVDSVTEEEGAESEESSSEVDGEAEAWSLADVRELHPGLLHPGLLAH
FT                   QAARTRDLPALAAALAHGAEVNWADAADEGKTPLVQAVLGGSLIVCEFLLQNGADVNQR
FT                   DSLGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQQDPLTIAVQAANADIVTLLRLA
FT                   RMAEEMREAEAPPGQPGPLPGSSPTELQYRRCIQEFIGLHLEES"
FT   gene            complement(<8160144..8161262)
FT                   /locus_tag="mCG_132192"
FT                   /note="gene_id=mCG132192.1"
FT   mRNA            complement(join(<8160144..8160238,8160342..8160571,
FT                   8161111..8161262))
FT                   /locus_tag="mCG_132192"
FT                   /product="mCG132192"
FT                   /note="gene_id=mCG132192.1 transcript_id=mCT133541.1
FT                   created on 30-DEC-2002"
FT   CDS             complement(join(<8160144..8160238,8160342..8160571,
FT                   8161111..8161181))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132192"
FT                   /product="mCG132192"
FT                   /note="gene_id=mCG132192.1 transcript_id=mCT133541.1
FT                   protein_id=mCP76698.1"
FT                   /protein_id="EDL15055.1"
FT                   /translation="MAVSPHSECKFFPSIIPCDVNPHQPDLICQHLEVLDSFAWENINA
FT                   LYKFHFSERWDTPFAEVPSHKLHFRLDHGIHLQHLSRLDSQYEVGFRLMSSGPQGGGNC
FT                   FYCAYSSGMPPAQELYCFCYMDILASLP"
FT   gap             8165571..8166193
FT                   /estimated_length=623
FT   gap             8167467..8167486
FT                   /estimated_length=20
FT   gap             8168141..8171051
FT                   /estimated_length=2911
FT   gene            complement(8173004..8176541)
FT                   /locus_tag="mCG_132174"
FT                   /note="gene_id=mCG132174.1"
FT   mRNA            complement(join(8173004..8175348,8175745..8176541))
FT                   /locus_tag="mCG_132174"
FT                   /product="mCG132174"
FT                   /note="gene_id=mCG132174.1 transcript_id=mCT133523.1
FT                   created on 30-DEC-2002"
FT   CDS             complement(join(8174687..8175348,8175745..8176318))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132174"
FT                   /product="mCG132174"
FT                   /note="gene_id=mCG132174.1 transcript_id=mCT133523.1
FT                   protein_id=mCP76913.1"
FT                   /protein_id="EDL15056.1"
FT                   /translation="MSKSFQQSSLGRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRM
FT                   NQGTARLASLMNLGMSSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGD
FT                   TDQASNILASFGLSARDLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGR
FT                   SATREPPYRVPRDDWEEKRHFRRDSFDDLHGPSLNPVLDYDHGSRSQESGYYDRMDYED
FT                   DRLRDGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIED
FT                   FHGLLPKGYPHLCSICDLPVHSNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTM
FT                   GDPFMLQQSTNPAPGILGPPPPSFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSQ
FT                   LFTLWIFSEEKT"
FT   gap             8178434..8178453
FT                   /estimated_length=20
FT   gap             8179481..8179500
FT                   /estimated_length=20
FT   gap             8180874..8180893
FT                   /estimated_length=20
FT   gap             8185498..8185567
FT                   /estimated_length=70
FT   gene            8185933..8200064
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /note="gene_id=mCG23339.2"
FT   mRNA            join(8185933..8186078,8188315..8188477,8191102..8191232,
FT                   8193564..8193604,8197584..8197686,8197772..8197910,
FT                   8198712..8198792,8199429..8200064)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT176820"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT176820.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8186057..8186078,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..>8199501)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT190906"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190906.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8186058..8186078,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..>8199501)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190906.0
FT                   protein_id=mCP111838.0 isoform=CRA_a"
FT                   /protein_id="EDL15057.1"
FT                   /translation="RPRPQGEMSNNSNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLP
FT                   SNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSI
FT                   TDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKKQLAAQSLVFNLKDKVF
FT                   CELFPEVVEEIKQKQKAQDELSNRPQNLPLPDV"
FT   mRNA            join(8186063..8186223,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8200064)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT23171"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT23171.1 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8186231..8186332,8188315..8188477,8191102..8191232,
FT                   8193564..8193604,8197584..8197686,8197772..8197910,
FT                   8198712..8198792,8199429..8200064)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT190907"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190907.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8188313..8188477,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8199696,8199796..8199991)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT190908"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190908.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8188415..8188477,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8199696,8199796..8199869)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_c"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190908.0
FT                   protein_id=mCP111840.0 isoform=CRA_c"
FT                   /protein_id="EDL15059.1"
FT                   /translation="PCSWCEHSWMHQAKALDSARKMSNNSNKRAPTTATQRLKQDYLRI
FT                   KKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITP
FT                   NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKKQL
FT                   AAQSLVFNLKDKVFCELFPEVVEEIKQKQKAQDELSNRPQNLPLPDVVPDGELHRGQHG
FT                   IQLLNGHAPAAGPNLAGLPQANRHHGLLGGALANLFVIVGFAAFAYTVKYVLRTQGGLP
FT                   DSRASLFKNLKEKAKTKM"
FT   CDS             join(<8188415..8188477,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8199713)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190907.0
FT                   protein_id=mCP111839.0 isoform=CRA_b"
FT                   /protein_id="EDL15058.1"
FT                   /translation="PCSWCEHSWMHQAKALDSARKMSNNSNKRAPTTATQRLKQDYLRI
FT                   KKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITP
FT                   NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKKQL
FT                   AAQSLVFNLKDKVFCELFPEVVEEIKQKQKAQDELSNRPQNLPLPDVVPDGELHRGQHG
FT                   IQLLNGHAPAAGPNLAGLPQANRHHGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE"
FT   CDS             join(8188442..8188477,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8199713)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_e"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT176820.0
FT                   protein_id=mCP99742.0 isoform=CRA_e"
FT                   /db_xref="GOA:B1ASK8"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="MGI:MGI:2153608"
FT                   /db_xref="UniProtKB/TrEMBL:B1ASK8"
FT                   /protein_id="EDL15061.1"
FT                   /translation="MHQAKALDSARKMSNNSNKRAPTTATQRLKQDYLRIKKDPVPYIC
FT                   AEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTR
FT                   LCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKKQLAAQSLVFNL
FT                   KDKVFCELFPEVVEEIKQKQKAQDELSNRPQNLPLPDVVPDGELHRGQHGIQLLNGHAP
FT                   AAGPNLAGLPQANRHHGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE"
FT   gap             8188511..8188530
FT                   /estimated_length=20
FT   CDS             join(8191102..8191232,8193564..8193604,8197584..8197686,
FT                   8197772..8197910,8198712..8198792,8199429..8199713)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_d"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT23171.1
FT                   protein_id=mCP21753.1 isoform=CRA_d"
FT                   /protein_id="EDL15060.1"
FT                   /translation="MSNNSNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWH
FT                   YVVRGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDT
FT                   WNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKKQLAAQSLVFNLKDKVFCELFPEV
FT                   VEEIKQKQKAQDELSNRPQNLPLPDVVPDGELHRGQHGIQLLNGHAPAAGPNLAGLPQA
FT                   NRHHGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE"
FT   gene            8204679..8208962
FT                   /gene="C1qdc2"
FT                   /locus_tag="mCG_23337"
FT                   /note="gene_id=mCG23337.0"
FT   mRNA            join(8204679..8205103,8206888..8207004,8207113..8207233,
FT                   8207325..8207476,8207932..8208040,8208203..8208293,
FT                   8208419..8208497,8208741..8208962)
FT                   /gene="C1qdc2"
FT                   /locus_tag="mCG_23337"
FT                   /product="C1q domain containing 2"
FT                   /note="gene_id=mCG23337.0 transcript_id=mCT23172.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(8204945..8205103,8206888..8207004,8207113..8207233,
FT                   8207325..8207476,8207932..8208040,8208203..8208293,
FT                   8208419..8208497,8208741..8208839)
FT                   /codon_start=1
FT                   /gene="C1qdc2"
FT                   /locus_tag="mCG_23337"
FT                   /product="C1q domain containing 2"
FT                   /note="gene_id=mCG23337.0 transcript_id=mCT23172.0
FT                   protein_id=mCP21745.1"
FT                   /protein_id="EDL15062.1"
FT                   /translation="MWAWGWAAAALLWLQTAGAGARQELKKSRQLFARVDSPNITTSNR
FT                   EGFPGSVKPPEASGPELSDAHMTWLNFVRRPDDGSSRKRCRGRDKKSRGLSGLPGPPGP
FT                   PGPPGPPGSPGVDVTPEALLQEFQEILKEATELRFSGLPDTLLPQEPSQRLVVEAFYCR
FT                   LKGPVLVDKKTLVELQGFQAPTTQGAFLRGSGLSLSLGRFTAPVSAIFQFSASLHVDHS
FT                   ELQGRGRLRTRDMVRVLICIESLCHRHTSLEAVSGLESNSRVFTVQVQGLLHLQSGQYV
FT                   SVFVDNSSGAVLTIQNTSSFSGMLLGT"
FT   gap             8223997..8224016
FT                   /estimated_length=20
FT   gap             8229840..8229859
FT                   /estimated_length=20
FT   gene            complement(8233133..8235201)
FT                   /gene="B3galt6"
FT                   /locus_tag="mCG_51249"
FT                   /note="gene_id=mCG51249.2"
FT   mRNA            complement(8233133..8235201)
FT                   /gene="B3galt6"
FT                   /locus_tag="mCG_51249"
FT                   /product="UDP-Gal:betaGal beta 1,3-galactosyltransferase,
FT                   polypeptide 6"
FT                   /note="gene_id=mCG51249.2 transcript_id=mCT51432.2 created
FT                   on 06-DEC-2002"
FT   CDS             complement(8234218..8235195)
FT                   /codon_start=1
FT                   /gene="B3galt6"
FT                   /locus_tag="mCG_51249"
FT                   /product="UDP-Gal:betaGal beta 1,3-galactosyltransferase,
FT                   polypeptide 6"
FT                   /note="gene_id=mCG51249.2 transcript_id=mCT51432.2
FT                   protein_id=mCP41714.1"
FT                   /protein_id="EDL15063.1"
FT                   /translation="MKVFRRAWRHRVALGLGGLAFCGTTLLYLARCASEGETPSASGAA
FT                   RPRAKAFLAVLVASAPRAVERRTAVRSTWLAPERRGGPEDVWARFAVGTGGLGSEERRA
FT                   LELEQAQHGDLLLLPALRDAYENLTAKVLAMLTWLDERVDFEFVLKADDDSFARLDAIL
FT                   VDLRAREPARRRRLYWGFFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVLSADLVH
FT                   YLRLSREYLRAWHSEDVSLGTWLAPVDVQREHDPRFDTEYKSRGCNNQYLVTHKQSPED
FT                   MLEKQQMLLHEGRLCKHEVQLRLSYVYDWSAPPSQCCQRKEGVP"
FT   gene            <8235419..8252496
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /note="gene_id=mCG23336.3"
FT   mRNA            join(<8235419..8235553,8235700..8235881,8238739..8239068,
FT                   8241768..8241904,8243040..8243153,8250965..8251123,
FT                   8251322..8251497,8251952..8252387)
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, transcript variant
FT                   mCT190901"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT190901.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(8235458..8235881,8238739..8239068,8241768..8241904,
FT                   8243040..8243153,8250965..8251123,8251322..8251497,
FT                   8251952..8252496)
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, transcript variant
FT                   mCT23170"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT23170.1 created
FT                   on 06-DEC-2002"
FT   CDS             join(<8235826..8235881,8238739..8239068,8241768..8241904,
FT                   8243040..8243153,8250965..8251123,8251322..8251497,
FT                   8251952..8252128)
FT                   /codon_start=1
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, isoform CRA_b"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT190901.0
FT                   protein_id=mCP111837.0 isoform=CRA_b"
FT                   /protein_id="EDL15065.1"
FT                   /translation="AEFCVRLGGRPDPAHQKPGSPMVWLVAMTPRQSSLCGLAAHGLWF
FT                   LGLVLLMDATARPANHSSTRERAANREENEIMPPDHLNGVKLEMDGHLNKDFHQEVFLG
FT                   KDMDGFDEDSEPRRSRRKLMVIFSKVDVNTDRRISAKEMQHWIMEKTAEHFQEAVKENK
FT                   LHFRAVDPDGDGHVSWDEYKVKFLASKGHNEREIAEAIKNHEELKVDEETQEVLGNLRD
FT                   RWYQADNPPADLLLTEDEFLSFLHPEHSRGMLKFMVKEIFRDLDQDGDKQLSLPEFISL
FT                   PVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTMEELENYMDPMNEYNALNEAK
FT                   QMIAIADENQNHHLEPEEILKYSEFFTGSKLMDYARNVHEEF"
FT   mRNA            join(<8235920..8236116,8238739..8239068,8241768..8241904,
FT                   8243040..8243153,8250965..8251123,8251322..8251497,
FT                   8251952..8252384)
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, transcript variant
FT                   mCT190900"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT190900.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8235920..8236116,8238739..8239068,8241768..8241904,
FT                   8243040..8243153,8250965..8251123,8251322..8251497,
FT                   8251952..8252128)
FT                   /codon_start=1
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, isoform CRA_a"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT190900.0
FT                   protein_id=mCP111836.0 isoform=CRA_a"
FT                   /protein_id="EDL15064.1"
FT                   /translation="GLGGHSGSVRIAPGLSRLDPAGRPLPRLLLPELTAAGDLRLGALL
FT                   PAGVVTSTCGPAASLPRFPLWSPMVWLVAMTPRQSSLCGLAAHGLWFLGLVLLMDATAR
FT                   PANHSSTRERAANREENEIMPPDHLNGVKLEMDGHLNKDFHQEVFLGKDMDGFDEDSEP
FT                   RRSRRKLMVIFSKVDVNTDRRISAKEMQHWIMEKTAEHFQEAVKENKLHFRAVDPDGDG
FT                   HVSWDEYKVKFLASKGHNEREIAEAIKNHEELKVDEETQEVLGNLRDRWYQADNPPADL
FT                   LLTEDEFLSFLHPEHSRGMLKFMVKEIFRDLDQDGDKQLSLPEFISLPVGTVENQQGQD
FT                   IDDNWVKDRKKEFEELIDSNHDGIVTMEELENYMDPMNEYNALNEAKQMIAIADENQNH
FT                   HLEPEEILKYSEFFTGSKLMDYARNVHEEF"
FT   CDS             join(8238746..8239068,8241768..8241904,8243040..8243153,
FT                   8250965..8251123,8251322..8251497,8251952..8252128)
FT                   /codon_start=1
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, isoform CRA_c"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT23170.1
FT                   protein_id=mCP21735.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q61112"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:108079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61112"
FT                   /protein_id="EDL15066.1"
FT                   /translation="MVWLVAMTPRQSSLCGLAAHGLWFLGLVLLMDATARPANHSSTRE
FT                   RAANREENEIMPPDHLNGVKLEMDGHLNKDFHQEVFLGKDMDGFDEDSEPRRSRRKLMV
FT                   IFSKVDVNTDRRISAKEMQHWIMEKTAEHFQEAVKENKLHFRAVDPDGDGHVSWDEYKV
FT                   KFLASKGHNEREIAEAIKNHEELKVDEETQEVLGNLRDRWYQADNPPADLLLTEDEFLS
FT                   FLHPEHSRGMLKFMVKEIFRDLDQDGDKQLSLPEFISLPVGTVENQQGQDIDDNWVKDR
FT                   KKEFEELIDSNHDGIVTMEELENYMDPMNEYNALNEAKQMIAIADENQNHHLEPEEILK
FT                   YSEFFTGSKLMDYARNVHEEF"
FT   gap             8239562..8239581
FT                   /estimated_length=20
FT   gap             8240799..8240986
FT                   /estimated_length=188
FT   gene            8255834..8258740
FT                   /gene="Tnfrsf4"
FT                   /locus_tag="mCG_23346"
FT                   /note="gene_id=mCG23346.0"
FT   mRNA            join(8255834..8256145,8256367..8256489,8257041..8257148,
FT                   8257525..8257591,8258029..8258225,8258305..8258424,
FT                   8258513..8258740)
FT                   /gene="Tnfrsf4"
FT                   /locus_tag="mCG_23346"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 4"
FT                   /note="gene_id=mCG23346.0 transcript_id=mCT23180.1 created
FT                   on 06-DEC-2002"
FT   CDS             join(8256013..8256145,8256367..8256489,8257041..8257148,
FT                   8257525..8257591,8258029..8258225,8258305..8258424,
FT                   8258513..8258583)
FT                   /codon_start=1
FT                   /gene="Tnfrsf4"
FT                   /locus_tag="mCG_23346"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 4"
FT                   /note="gene_id=mCG23346.0 transcript_id=mCT23180.1
FT                   protein_id=mCP21733.1"
FT                   /db_xref="GOA:B1ASL3"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020445"
FT                   /db_xref="MGI:MGI:104512"
FT                   /db_xref="UniProtKB/TrEMBL:B1ASL3"
FT                   /protein_id="EDL15067.1"
FT                   /translation="MYVWVQQPTALLLLGLTLGVTARRLNCVKHTYPSGHKCCRECQPG
FT                   HGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCR
FT                   CRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAV
FT                   CEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLG
FT                   LLAPLTVLLALYLLRKAWRLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI"
FT   gene            complement(8264170..8265986)
FT                   /locus_tag="mCG_142754"
FT                   /note="gene_id=mCG142754.0"
FT   mRNA            complement(join(8264170..8264473,8265553..8265602,
FT                   8265862..8265986))
FT                   /locus_tag="mCG_142754"
FT                   /product="mCG142754"
FT                   /note="gene_id=mCG142754.0 transcript_id=mCT182077.0
FT                   created on 25-APR-2003"
FT   CDS             complement(8264326..8264424)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142754"
FT                   /product="mCG142754"
FT                   /note="gene_id=mCG142754.0 transcript_id=mCT182077.0
FT                   protein_id=mCP104999.0"
FT                   /protein_id="EDL15068.1"
FT                   /translation="MVGREIFICSPLSPRFDEQLPVFPRGLFHRIQ"
FT   gene            8268136..8270814
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /note="gene_id=mCG23344.2"
FT   mRNA            join(8268136..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270814)
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, transcript variant mCT176821"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT176821.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(8268136..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270352,8270420..8270814)
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, transcript variant mCT23178"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT23178.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(8268136..8268466,8269245..8269367,8269891..8269978,
FT                   8270420..8270814)
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, transcript variant mCT133522"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT133522.1 created
FT                   on 06-DEC-2002"
FT   gene            complement(8268226..8273535)
FT                   /locus_tag="mCG_1027457"
FT                   /note="gene_id=mCG1027457.2"
FT   mRNA            complement(join(8268226..8268815,8270400..8270479,
FT                   8272335..8272429,8273491..8273535))
FT                   /locus_tag="mCG_1027457"
FT                   /product="mCG1027457"
FT                   /note="gene_id=mCG1027457.2 transcript_id=mCT181159.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(<8268271..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270352,8270409..8270814)
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, transcript variant mCT190875"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT190875.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8268271..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270352,8270409..8270728)
FT                   /codon_start=1
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, isoform CRA_c"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT190875.0
FT                   protein_id=mCP111843.0 isoform=CRA_c"
FT                   /protein_id="EDL15071.1"
FT                   /translation="RELLKSADRRLRRSTMGAWAMLYGVSMLCVLDLGQPSVVEEPGCG
FT                   PGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVE
FT                   SQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPT
FT                   EQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRVLLQRPSHSRRCSCQLRML
FT                   AASSSLRRNAGSRQKKSVIWGVGGHEAWSSSVPQARRYKTCPAIPLVRAGAMLCTLPWA
FT                   WPCSPQQWRKWVYESGELRLGPMAAFLI"
FT   CDS             join(8268316..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270352,8270420..8270541)
FT                   /codon_start=1
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, isoform CRA_d"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT23178.2
FT                   protein_id=mCP21723.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q540M6"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR022318"
FT                   /db_xref="MGI:MGI:894675"
FT                   /db_xref="UniProtKB/TrEMBL:Q540M6"
FT                   /protein_id="EDL15072.1"
FT                   /translation="MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCC
FT                   SLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACA
FT                   MGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAA
FT                   CIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCH
FT                   LGGRWP"
FT   CDS             join(8268316..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270456)
FT                   /codon_start=1
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, isoform CRA_b"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT176821.0
FT                   protein_id=mCP99743.0 isoform=CRA_b"
FT                   /protein_id="EDL15070.1"
FT                   /translation="MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCC
FT                   SLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACA
FT                   MGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAA
FT                   CIFFLTTVQLGLHIWQLRRQHMCPRGQLCPREGENVSQAPHLPQFYYRDPAIRGGAVVS
FT                   "
FT   CDS             join(8268316..8268466,8269245..8269367,8269891..8269978,
FT                   8270420..8270456)
FT                   /codon_start=1
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, isoform CRA_a"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT133522.1
FT                   protein_id=mCP76909.1 isoform=CRA_a"
FT                   /protein_id="EDL15069.1"
FT                   /translation="MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCC
FT                   SLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACA
FT                   MGTFSAGRDGHCRLWTKDPAIRGGAVVS"
FT   CDS             complement(join(8270414..8270479,8272335..8272429,
FT                   8273491..8273497))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027457"
FT                   /product="mCG1027457"
FT                   /note="gene_id=mCG1027457.2 transcript_id=mCT181159.0
FT                   protein_id=mCP104081.0"
FT                   /protein_id="EDL15073.1"
FT                   /translation="MAFSPRSLCVDVAVSIRGCISTPPHPKSPFTCYEGTGSCKHPQLT
FT                   TAPPRMAGSL"
FT   gene            complement(8276761..8285559)
FT                   /locus_tag="mCG_141922"
FT                   /note="gene_id=mCG141922.0"
FT   mRNA            complement(join(8276761..8277378,8277673..8277766,
FT                   8278064..8278180,8284854..8284994,8285431..8285559))
FT                   /locus_tag="mCG_141922"
FT                   /product="mCG141922"
FT                   /note="gene_id=mCG141922.0 transcript_id=mCT177679.0
FT                   created on 20-DEC-2002"
FT   CDS             complement(join(8276840..8277378,8277673..8277766,
FT                   8278064..8278180,8284854..8284994,8285431..8285547))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141922"
FT                   /product="mCG141922"
FT                   /note="gene_id=mCG141922.0 transcript_id=mCT177679.0
FT                   protein_id=mCP100601.0"
FT                   /protein_id="EDL15074.1"
FT                   /translation="MLIACAMPYMVFFGHGYARLTLSLYNPHSSDLSGHLTNQFMQKKS
FT                   PLYTLLKESTVWTMEHLNRYINDKFRKTKGLPRDWVFTTFTKRMQQIMSHCFLAVKSKL
FT                   ECKLGYFDLIGCDFLIDENFKVWLLEMNANPALHTNCEVLKAVIPGVVIETLDLALETC
FT                   QKSLHSQKMLPLLSQRRFVLLYNGETTDLWPRLASSRPLNRLPNPNPNPNPNANPHPHP
FT                   HPNPHPHPNPHPNANPHPPRPTCEAASSALSSARAAISERPGARKSMPSRGAPVCTPRK
FT                   SRLSDSSGSSIAESEPSLCSGSLEGSRDTAREPSLGPPEEEREEEQRSTSHRGS"
FT   gap             8282363..8283409
FT                   /estimated_length=1047
FT   gene            complement(8285567..8301160)
FT                   /locus_tag="mCG_23345"
FT                   /note="gene_id=mCG23345.2"
FT   mRNA            complement(join(8285567..8285602,8287116..8287201,
FT                   8288665..8288791,8288868..8288986,8289131..8289263,
FT                   8289344..8289424,8289683..8289758,8290073..8290485,
FT                   8291982..8292047,8300810..8301160))
FT                   /locus_tag="mCG_23345"
FT                   /product="mCG23345"
FT                   /note="gene_id=mCG23345.2 transcript_id=mCT23179.2 created
FT                   on 20-DEC-2002"
FT   CDS             complement(join(8285577..8285602,8287116..8287201,
FT                   8288665..8288791,8288868..8288986,8289131..8289263,
FT                   8289344..8289404))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23345"
FT                   /product="mCG23345"
FT                   /note="gene_id=mCG23345.2 transcript_id=mCT23179.2
FT                   protein_id=mCP21722.2"
FT                   /protein_id="EDL15075.1"
FT                   /translation="MGSSVKERLRPELSQLDQDADDLEEEEAARLPVTSPDGLLMEGDK
FT                   QPSPGQGPFFYIGGTNGASIISNYCESKGWQRTQDSHCEDYKLKWCEIKCRDNYCSFRE
FT                   GQQLLFQLPNNKLLTTKIGLLSALREHARTLSKARMLPSTQTKVLKMEEFFPETYRLDI
FT                   RDERQAFFALFDDMSRTRCC"
FT   gene            complement(8294499..8301616)
FT                   /locus_tag="mCG_147507"
FT                   /note="gene_id=mCG147507.0"
FT   mRNA            complement(join(8294499..8295810,8301396..8301616))
FT                   /locus_tag="mCG_147507"
FT                   /product="mCG147507"
FT                   /note="gene_id=mCG147507.0 transcript_id=mCT187770.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8295518..8295703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147507"
FT                   /product="mCG147507"
FT                   /note="gene_id=mCG147507.0 transcript_id=mCT187770.0
FT                   protein_id=mCP109466.0"
FT                   /protein_id="EDL15076.1"
FT                   /translation="MPSIHGLITAGDDILTTSWTLGRDKTLIHLLQLSRAGVIKPSMQI
FT                   DHSLNIQAPLSLTAFL"
FT   gap             8318852..8318952
FT                   /estimated_length=101
FT   gap             8336803..8336822
FT                   /estimated_length=20
FT   gap             8343271..8343290
FT                   /estimated_length=20
FT   gene            8351559..8368880
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /note="gene_id=mCG22598.3"
FT   mRNA            join(8351559..8351600,8355466..8355578,8358605..8358698,
FT                   8360766..8360841,8363548..8363643,8363966..8364031,
FT                   8365156..8365290,8365597..8365622,8365713..8365743,
FT                   8367038..8368879)
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, transcript variant
FT                   mCT23091"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT23091.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8351560..8351600,8355466..8355578,8358605..8358698,
FT                   8360766..8360841,8363548..8364031,8365156..8365290,
FT                   8365597..8365743,8367038..8368880)
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, transcript variant
FT                   mCT190853"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190853.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8351573..8351600,8355466..8355578,8358605..8358698,
FT                   8360766..8360841,8363548..8363643,8363966..8364031,
FT                   8365156..8365290,8365597..8365622,8365713..8365830)
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, transcript variant
FT                   mCT190851"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190851.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8351574..8351600,8355506..8355578,8358605..8358698,
FT                   8360766..8360841,8363966..8364031,8365156..8365290,
FT                   8365597..8365622,8365713..8365743,8367038..8367842)
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, transcript variant
FT                   mCT190852"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190852.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8355577..8355578,8358605..8358698,8360766..8360841,
FT                   8363966..8364031,8365156..8365290,8365597..8365622,
FT                   8365713..8365743,8367038..8367135)
FT                   /codon_start=1
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, isoform CRA_b"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190852.0
FT                   protein_id=mCP111831.0 isoform=CRA_b"
FT                   /protein_id="EDL15078.1"
FT                   /translation="RSPCQLPSMALQCLLLLTGLLTGGVCKSTESQAQQPECCMDVVDF
FT                   NATCLGTGLCGPVTGRGMQLPMNRSTGTPGQPHFGGPHVAASLFLGTLFISTGLILSVA
FT                   GFFYLKRSSKLPEVFYRRDRAPVLQPGETAAMVPLPQSSVRKPRYIRREQHPDKNRDPS
FT                   AFSTVEAHISNV"
FT   CDS             join(<8355577..8355578,8358605..8358698,8360766..8360841,
FT                   8363548..8363643,8363966..8364031,8365156..8365290,
FT                   8365597..8365622,8365713..8365805)
FT                   /codon_start=1
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, isoform CRA_a"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190851.0
FT                   protein_id=mCP111830.0 isoform=CRA_a"
FT                   /protein_id="EDL15077.1"
FT                   /translation="RSPCQLPSMALQCLLLLTGLLTGGVCKSTESQAQQPECCMDVVDF
FT                   NATCLGTGLCGPGCYRHWNADGSASCVRCWNGTLPTYNGSECRILTGRGMQLPMNRSTG
FT                   TPGQPHFGGPHVAASLFLGTLFISTGLILSVAGFFYLKRSSKLPEVFYRRDRAPVLQPG
FT                   ETAAMVPLPQSSGTGCSVVWELGGRVSLWAVF"
FT   CDS             join(<8355577..8355578,8358605..8358698,8360766..8360841,
FT                   8363548..8363798)
FT                   /codon_start=1
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, isoform CRA_c"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190853.0
FT                   protein_id=mCP111832.0 isoform=CRA_c"
FT                   /protein_id="EDL15079.1"
FT                   /translation="RSPCQLPSMALQCLLLLTGLLTGGVCKSTESQAQQPECCMDVVDF
FT                   NATCLGTGLCGPGCYRHWNADGSASCVRCWNGTLPTYNGSECRIRMSSPSYLPQFPQTD
FT                   LTGVLLSNLGRNQGTTVIVFSNCKDNTHLPRSIVYQ"
FT   CDS             join(8358627..8358698,8360766..8360841,8363548..8363643,
FT                   8363966..8364031,8365156..8365290,8365597..8365622,
FT                   8365713..8365743,8367038..8367135)
FT                   /codon_start=1
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, isoform CRA_d"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT23091.2
FT                   protein_id=mCP21721.2 isoform=CRA_d"
FT                   /protein_id="EDL15080.1"
FT                   /translation="MALQCLLLLTGLLTGGVCKSTESQAQQPECCMDVVDFNATCLGTG
FT                   LCGPGCYRHWNADGSASCVRCWNGTLPTYNGSECRILTGRGMQLPMNRSTGTPGQPHFG
FT                   GPHVAASLFLGTLFISTGLILSVAGFFYLKRSSKLPEVFYRRDRAPVLQPGETAAMVPL
FT                   PQSSVRKPRYIRREQHPDKNRDPSAFSTVEAHISNV"
FT   gene            complement(8399378..>8433188)
FT                   /gene="Agrin"
FT                   /locus_tag="mCG_146388"
FT                   /note="gene_id=mCG146388.0"
FT   mRNA            complement(join(8399378..8400737,8400995..8401098,
FT                   8401366..8401590,8404598..8404685,8404768..8404960,
FT                   8405085..8405201,8405635..8405746,8405931..8406095,
FT                   8406180..8406276,8406444..8406578,8406666..8406895,
FT                   8407263..8407478,8407649..8407841,8407936..8408283,
FT                   8408423..8408542,8408629..8408743,8408864..8408991,
FT                   8409404..8409541,8409646..8409951,8410038..8410143,
FT                   8410217..8410341,8410432..8410575,8410717..8410881,
FT                   8410961..8411077,8412080..8412185,8412265..8412413,
FT                   8412495..8412695,8412817..8413011,8413084..8413302,
FT                   8414290..8414496,8414644..8414868,8414959..8415183,
FT                   8415254..8415469,8420952..8420999,8431093..8431354,
FT                   8433063..>8433188))
FT                   /gene="Agrin"
FT                   /locus_tag="mCG_146388"
FT                   /product="agrin"
FT                   /note="gene_id=mCG146388.0 transcript_id=mCT186596.0
FT                   created on 15-JUL-2003"
FT   CDS             complement(join(8400580..8400737,8400995..8401098,
FT                   8401366..8401590,8404598..8404685,8404768..8404960,
FT                   8405085..8405201,8405635..8405746,8405931..8406095,
FT                   8406180..8406276,8406444..8406578,8406666..8406895,
FT                   8407263..8407478,8407649..8407841,8407936..8408283,
FT                   8408423..8408542,8408629..8408743,8408864..8408991,
FT                   8409404..8409541,8409646..8409951,8410038..8410143,
FT                   8410217..8410341,8410432..8410575,8410717..8410881,
FT                   8410961..8411077,8412080..8412185,8412265..8412413,
FT                   8412495..8412695,8412817..8413011,8413084..8413302,
FT                   8414290..8414496,8414644..8414868,8414959..8415183,
FT                   8415254..8415469,8420952..8420999,8431093..8431354,
FT                   8433063..>8433188))
FT                   /codon_start=1
FT                   /gene="Agrin"
FT                   /locus_tag="mCG_146388"
FT                   /product="agrin"
FT                   /note="gene_id=mCG146388.0 transcript_id=mCT186596.0
FT                   protein_id=mCP107831.0"
FT                   /protein_id="EDL15081.1"
FT                   /translation="GASGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRV
FT                   WRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHK
FT                   NELMLNSSLMRITLRNLEEVEFCVEDKPGIHFTAAPSMPPDVCRGMLCGFGAVCEPSVE
FT                   DPGRASCVCKKNVCPAMVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDP
FT                   CANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVCGSDGVDYPSECQLLRHACANQ
FT                   EHIFKKFDGPCDPCQGSMSDLNHICRVNPRTRHPEMLLRPENCPAQHTPICGDDGVTYE
FT                   NDCVMSRIGAARGLLLQKVRSGQCQTRDQCPETCQFNSVCLSRRGRPHCSCDRVTCDGA
FT                   YRPVCAQDGHTYDNDCWRQQAECRQQQTIPPKHQGPCDQTPSPCRGAQCAFGATCTVKN
FT                   GKAVCECQRVCSGGYDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPCDRCGQCRF
FT                   GSLCEVETGRCVCPSECVESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHCQT
FT                   CGETVCTFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEAR
FT                   AGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCG
FT                   SDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNV
FT                   TAAQGVGLAGCPSTCHCNPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIV
FT                   TDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEADPT
FT                   TPVTCVEMHCEFGASCVEEAGFAQCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIAC
FT                   RQRLDISIQSLGPCRESVAPGVSPTSASMTTPRHILSRTLASPHSSLPLSPSTTAHDWP
FT                   TPLPTSPQTVVGTPRSTAATPSDVASLATAIFRESGSTNGSGDEELSGDEEASGGGSGG
FT                   LEPPVGSVVVTHGPPIERASCYNSPLGCCSDGKTPSLDSEGSNCPATKAFQGVLELEGV
FT                   EGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFWSIRLRELGPGKLVRA
FT                   IVDVHFDPTTAFQAPDVGQALLQQIQVSRPWALAVRRPLREHVRFLDFDWFPTFFTGAA
FT                   TGTTAAVATARATTVSRLSASSVTPRVYPSYTSRPVGRTTAPLTTRRPPTTTASIDRPR
FT                   TPGPQRPPKSCDSQPCLHGGTCQDLDSGKGFSCSCTAGRAGTVCEKVQLPSVPAFKGHS
FT                   FLAFPTLRAYHTLRLALEFRALETEGLLLYNGNARGKDFLALALLDGHVQFRFDTGSGP
FT                   AVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTKLYVGGLP
FT                   EEQVATVLDRTSVGIGLKGCIRMLDINNQQLELSDWQRAVVQSSGVGECGDHPCSPNPC
FT                   HGGALCQALEAGVFLCQCPPGRFGPTCADEKNPCQPNPCHGSAPCHVLSRGGAKCVCPL
FT                   GRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGL
FT                   LLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRK
FT                   GALQVGDGPRVLGESPVPHTMLNLKEPLYVGGAPDFSKLARGAAVASGFDGAIQLVSLR
FT                   GHQLLTQEHVLRAVDVAPFAGHPCTQAVDNPCLNGGSCIPREATYECLCPGGFSGLHCE
FT                   KGIVEKSVGDLETLAFDGRTYIEYLNAVTESEKALQSNHFELSLRTEATQGLVLWIGKV
FT                   GERADYMALAIVDGHLQLSYDLGSQPVVLRSTVKVNTNRWLRVRAHREHREGSLQVGNE
FT                   APVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHRQLHLL
FT                   EDAVTKPELRPCPTL"
FT   gap             8403143..8403162
FT                   /estimated_length=20
FT   gap             8420068..8420087
FT                   /estimated_length=20
FT   gap             8433189..8433946
FT                   /estimated_length=758
FT   gene            complement(8435316..8436632)
FT                   /gene="Isg15"
FT                   /locus_tag="mCG_22597"
FT                   /note="gene_id=mCG22597.1"
FT   mRNA            complement(join(8435316..8435902,8436542..8436632))
FT                   /gene="Isg15"
FT                   /locus_tag="mCG_22597"
FT                   /product="ISG15 ubiquitin-like modifier"
FT                   /note="gene_id=mCG22597.1 transcript_id=mCT23090.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(8435420..8435902,8436542..8436544))
FT                   /codon_start=1
FT                   /gene="Isg15"
FT                   /locus_tag="mCG_22597"
FT                   /product="ISG15 ubiquitin-like modifier"
FT                   /note="gene_id=mCG22597.1 transcript_id=mCT23090.1
FT                   protein_id=mCP21769.1"
FT                   /db_xref="GOA:Q4FJR9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="MGI:MGI:1855694"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJR9"
FT                   /protein_id="EDL15082.1"
FT                   /translation="MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRL
FT                   AHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDT
FT                   LKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGGDQCA"
FT   gene            8439105..8446440
FT                   /locus_tag="mCG_1027459"
FT                   /note="gene_id=mCG1027459.2"
FT   mRNA            join(8439105..8439645,8444067..8445424,8445472..8445886)
FT                   /locus_tag="mCG_1027459"
FT                   /product="mCG1027459, transcript variant mCT145163"
FT                   /note="gene_id=mCG1027459.2 transcript_id=mCT145163.1
FT                   created on 13-MAR-2003"
FT   mRNA            join(<8439138..8439645,8444100..8446440)
FT                   /locus_tag="mCG_1027459"
FT                   /product="mCG1027459, transcript variant mCT190881"
FT                   /note="gene_id=mCG1027459.2 transcript_id=mCT190881.0
FT                   created on 08-MAR-2004"
FT   CDS             <8439138..8439623
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027459"
FT                   /product="mCG1027459, isoform CRA_a"
FT                   /note="gene_id=mCG1027459.2 transcript_id=mCT190881.0
FT                   protein_id=mCP111806.0 isoform=CRA_a"
FT                   /protein_id="EDL15083.1"
FT                   /translation="SVSQALAHAVRTGAPGTAWKAGRASQPSLAGPGPQTSGQRCQNPQ
FT                   SRARDNGTPDSSAALPKSPGSWRRGGERASVQAWLCSRPPLRPRAQEGCEWRPGRSPVP
FT                   RPSVALTQSPRFRGKGNSLPCHPSCVPASTAPKLTKPRTADILEMSVKDICSAYTAR"
FT   CDS             8444670..8444870
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027459"
FT                   /product="mCG1027459, isoform CRA_b"
FT                   /note="gene_id=mCG1027459.2 transcript_id=mCT145163.1
FT                   protein_id=mCP76802.1 isoform=CRA_b"
FT                   /protein_id="EDL15084.1"
FT                   /translation="MAIKMTEYRCQNKMSCSQRNNHNKNNSSQKNSPTLPRAEFRKRPQ
FT                   TILTLLEFPVTLIAVTLITDL"
FT   gene            complement(8449173..8450898)
FT                   /locus_tag="mCG_141941"
FT                   /note="gene_id=mCG141941.0"
FT   mRNA            complement(join(8449173..8449499,8449673..8450148,
FT                   8450204..8450898))
FT                   /locus_tag="mCG_141941"
FT                   /product="mCG141941"
FT                   /note="gene_id=mCG141941.0 transcript_id=mCT177835.0
FT                   created on 30-DEC-2002"
FT   CDS             complement(join(8449871..8450148,8450204..8450276))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141941"
FT                   /product="mCG141941"
FT                   /note="gene_id=mCG141941.0 transcript_id=mCT177835.0
FT                   protein_id=mCP100757.0"
FT                   /protein_id="EDL15085.1"
FT                   /translation="MPLRSEGMGSDQKKSWLRASSLSILHKFQLFKQLMLVCVWPHLWG
FT                   DGATELADEGELVLLCVTLHDRATSPHLCHDAPSTPEVMGGPQSSSSGGQAGTTMSPHG
FT                   WCMGWAGSSQLG"
FT   gene            8451812..8457178
FT                   /gene="2310042D19Rik"
FT                   /locus_tag="mCG_22603"
FT                   /note="gene_id=mCG22603.1"
FT   mRNA            join(8451812..8451832,8452576..8455044,8455602..8455727,
FT                   8455980..8457178)
FT                   /gene="2310042D19Rik"
FT                   /locus_tag="mCG_22603"
FT                   /product="RIKEN cDNA 2310042D19"
FT                   /note="gene_id=mCG22603.1 transcript_id=mCT23168.1 created
FT                   on 20-DEC-2002"
FT   CDS             join(8452860..8455044,8455602..8455727,8455980..8456092)
FT                   /codon_start=1
FT                   /gene="2310042D19Rik"
FT                   /locus_tag="mCG_22603"
FT                   /product="RIKEN cDNA 2310042D19"
FT                   /note="gene_id=mCG22603.1 transcript_id=mCT23168.1
FT                   protein_id=mCP21671.2"
FT                   /protein_id="EDL15086.1"
FT                   /translation="MDNFQYSVQLSDREWAEFSATADECGLLQADLASGDEPLSSDIDQ
FT                   GDSSGSSPPGPPPLFTGQLVSQGRGQQSRELEDVAAQQLVSRSQCEPVLALEASHQVAG
FT                   TSTQSEAPLFPSLDSVCPGQALSFPGPATCRDKMQRLLQGPAPSSPSKAPHSPESPGHS
FT                   DNPQSSPDSLEASPRNPGRKKRRAVGAKGTKHSGSLDSAATQMSSPQLTRPKEALMSGT
FT                   LMAKAQQDKPQPDSTSPEQMAREESGLDLSTPILITEQDQIRKTSRAVLHVVSKPVQEV
FT                   HPDVPMASPNVSTRASKPQPDVALPKPASKPQSDIASSTHPFTPDVSLSTLAFKCQPNT
FT                   NQSTPASEPDTALSTPASEPDTALSTPASEPDTALSTPASEPDTALSTPASEPDMALST
FT                   PASACTPGLHVDLSAAGSEIKPEVSSSMPAAVDVLRTDLPRSVSKTESKESVSIPVKPS
FT                   LSPISQAEAAMVDTGVSVPPGGSIEKPAGQFSAGSSGESCLGPVQAPKKKKVRFSMAIP
FT                   SHEDSGSGEPTGSPFLTPEQPPVPRTAAGSRGGSAAWDAVAVAPRLPQPRILKHLPPPV
FT                   SSVSAEAESGNCFAVTLPEAYEFFFCDTIEEEDEDVEDEEAASQALDEVQWPDTCEFFF
FT                   RDSRAQRSRCQRGHSPVSPPRADTVAPVPPEGLVPISIPEVYEHFFTEEGFGHRQPAAT
FT                   PMQTSELSREGGLEASTKPVSPTAEHLSLTVRKAGELRSPLTSFTFSQNDMCLVFVAFA
FT                   TWAVRTSDLQAPDAWKTVLLANIGTISAIRYFRRQVGRGHSGRPRSSSSSNPSC"
FT   gene            complement(8457300..8464917)
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /note="gene_id=mCG145703.0"
FT   mRNA            complement(join(8457300..8457811,8458121..8458348,
FT                   8458510..8458650,8458811..8458951,8459168..8459308,
FT                   8459436..8459584,8459727..8459802,8460408..8460488,
FT                   8460595..8460708,8460787..8460911,8461065..8461137,
FT                   8461218..8461298,8461396..8461542,8464081..8464180,
FT                   8464273..8464917))
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, transcript variant mCT185257"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT185257.0
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(8457325..8457752,8457838..8457886,
FT                   8458121..8458348,8458510..8458650,8458811..8458951,
FT                   8459168..8459308,8459436..8459584,8459727..8459802,
FT                   8460408..8460488,8460595..8460708,8460787..8460911,
FT                   8461065..8461137,8461218..8461298,8461396..8461542,
FT                   8464081..8464180,8464273..8464852))
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, transcript variant mCT185256"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT185256.0
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(8457326..8457752,8457838..8457886,
FT                   8458121..8458259,8458510..8458650,8458811..8458951,
FT                   8459168..8459308,8459436..8459584,8459727..8459802,
FT                   8460408..8460488,8460595..8460708,8460787..8460911,
FT                   8461065..8461137,8461218..8461298,8461396..>8463729))
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, transcript variant mCT190858"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT190858.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(8457649..8457752,8457838..8457886,
FT                   8458121..8458348,8458510..8458650,8458811..8458951,
FT                   8459168..8459308,8459436..8459584,8459727..8459802,
FT                   8460408..8460488,8460595..8460708,8460787..8460911,
FT                   8461065..8461137,8461218..8461298,8461396..8461542,
FT                   8464081..8464180,8464273..8464355))
FT                   /codon_start=1
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, isoform CRA_a"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT185256.0
FT                   protein_id=mCP106515.0 isoform=CRA_a"
FT                   /protein_id="EDL15087.1"
FT                   /translation="MGNSHCVPQAPRRLRASFSRKPSLKGNREDSARKLAGLFGTEARP
FT                   DGDTAANRIFHYIPGTDIPGPEHHPENLEQPFLSVFKKGWRRTPVRNLGKVVHYSKVRL
FT                   RFQHSQDISDCYLELFPSHLYFQAHGSEGLTFQGLLPLTELNICPTDGSREHAFQITGP
FT                   LPAPLLVLCHSEAELSHWLYHLEKQMALLGLQRCHSAPPQGSLGDKPPWTQLRRAYGCG
FT                   SMSGAICASRVKLQHLPSQEQWDRLLVLYPASLAIFSEEPEGLSFKGELPLSAIHINLE
FT                   EKEKEIRSFLIEGHLINTIRVVCASYEDYSQWLLCLRTVSRRDGAHLPPGPESFPGLQK
FT                   PTQLVGRGRGSLSSNGRSSWKLECPVFPTSQSLPESSVPTTIGFPAPPVPNQTDSNCVS
FT                   TGQKKMKPSDSSPSPRGRAQREVSGSTVPLPLPLDLTKMSALNLDSGPEAQDHSLDIPH
FT                   SPLYADPYTPPATSRHKITDIQGLDEFLCAIQTSPGPDLSSPFPPVSVSVPVSESSSGI
FT                   SSSPGPLGSHLLTKKGALQPRASQRHRGSFKSRGPQPSDFPQLVTPAREGKPSSLPPPP
FT                   DEEAPIWNKTSSPSHPKWPQPRKPAVEGGFIQWI"
FT   CDS             complement(join(8457749..8457752,8457838..8457886,
FT                   8458121..8458259,8458510..8458650,8458811..8458951,
FT                   8459168..8459308,8459436..8459584,8459727..8459802,
FT                   8460408..8460488,8460595..8460708,8460787..8460911,
FT                   8461065..8461137,8461218..8461298,8461396..>8461557))
FT                   /codon_start=1
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, isoform CRA_c"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT190858.0
FT                   protein_id=mCP111816.0 isoform=CRA_c"
FT                   /protein_id="EDL15089.1"
FT                   /translation="ALLPQDIPGPEHHPENLEQPFLSVFKKGWRRTPVRNLGKVVHYSK
FT                   VRLRFQHSQDISDCYLELFPSHLYFQAHGSEGLTFQGLLPLTELNICPTDGSREHAFQI
FT                   TGPLPAPLLVLCHSEAELSHWLYHLEKQMALLGLQRCHSAPPQGSLGDKPPWTQLRRAY
FT                   GCGSMSGAICASRVKLQHLPSQEQWDRLLVLYPASLAIFSEEPEGLSFKGELPLSAIHI
FT                   NLEEKEKEIRSFLIEGHLINTIRVVCASYEDYSQWLLCLRTVSRRDGAHLPPGPESFPG
FT                   LQKPTQLVGRGRGSLSSNGRSSWKLECPVFPTSQSLPESSVPTTIGFPAPPVPNQTDSN
FT                   CVSTGQKKMKPSDSSPSPRGRAQREVSGSTVPLPLPLDLTKMSALNLDSGPEAQDHSLD
FT                   IPHSPLYADPYTPPATSRHKITDIQGLDELWHLQLAWASGLPLTHQERCPATQSFPETP
FT                   GFLQEQRPTALRLPSACHPCQRRQTQFPAPSPR"
FT   CDS             complement(join(8457776..8457811,8458121..8458348,
FT                   8458510..8458650,8458811..8458951,8459168..8459308,
FT                   8459436..8459584,8459727..8459802,8460408..8460488,
FT                   8460595..8460708,8460787..8460911,8461065..8461137,
FT                   8461218..8461298,8461396..8461542,8464081..8464180,
FT                   8464273..8464355))
FT                   /codon_start=1
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, isoform CRA_b"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT185257.0
FT                   protein_id=mCP106514.0 isoform=CRA_b"
FT                   /protein_id="EDL15088.1"
FT                   /translation="MGNSHCVPQAPRRLRASFSRKPSLKGNREDSARKLAGLFGTEARP
FT                   DGDTAANRIFHYIPGTDIPGPEHHPENLEQPFLSVFKKGWRRTPVRNLGKVVHYSKVRL
FT                   RFQHSQDISDCYLELFPSHLYFQAHGSEGLTFQGLLPLTELNICPTDGSREHAFQITGP
FT                   LPAPLLVLCHSEAELSHWLYHLEKQMALLGLQRCHSAPPQGSLGDKPPWTQLRRAYGCG
FT                   SMSGAICASRVKLQHLPSQEQWDRLLVLYPASLAIFSEEPEGLSFKGELPLSAIHINLE
FT                   EKEKEIRSFLIEGHLINTIRVVCASYEDYSQWLLCLRTVSRRDGAHLPPGPESFPGLQK
FT                   PTQLVGRGRGSLSSNGRSSWKLECPVFPTSQSLPESSVPTTIGFPAPPVPNQTDSNCVS
FT                   TGQKKMKPSDSSPSPRGRAQREVSGSTVPLPLPLDLTKMSALNLDSGPEAQDHSLDIPH
FT                   SPLYADPYTPPATSRHKITDIQGLDEFLCAIQTSPGPDLSSPFPPVSVSVPVSESSSGI
FT                   SSSPGPLGSHLLTKKGALQPRASQRHRGSFKSRGPQPSDFPQLGRGCYFSKAGA"
FT   gene            complement(8465193..8470726)
FT                   /gene="Klhl17"
FT                   /locus_tag="mCG_132182"
FT                   /note="gene_id=mCG132182.2"
FT   mRNA            complement(join(8465193..8466544,8466759..8466862,
FT                   8466962..8467031,8467405..8467572,8467660..8467804,
FT                   8468045..8468258,8468487..8468603,8469141..8469295,
FT                   8469442..8469563,8469653..8469912,8470580..8470726))
FT                   /gene="Klhl17"
FT                   /locus_tag="mCG_132182"
FT                   /product="kelch-like 17 (Drosophila), transcript variant
FT                   mCT185864"
FT                   /note="gene_id=mCG132182.2 transcript_id=mCT185864.0
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(8465193..8466120,8466363..8466544,
FT                   8466759..8466832,8466943..8467031,8467405..8467572,
FT                   8467660..8467804,8468045..8468258,8468487..8468603,
FT                   8469074..8469295,8469442..8469563,8469653..8469912,
FT                   8470580..8470726))
FT                   /gene="Klhl17"
FT                   /locus_tag="mCG_132182"
FT                   /product="kelch-like 17 (Drosophila), transcript variant
FT                   mCT133531"
FT                   /note="gene_id=mCG132182.2 transcript_id=mCT133531.2
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(8465193..8466120,8466759..8466832,
FT                   8466943..8467031,8467405..8467572,8467660..8467804,
FT                   8468045..8468258,8468487..8468603,8469074..8469295,
FT                   8469442..8469563,8469653..8469912,8470580..8470721))
FT                   /gene="Klhl17"
FT                   /locus_tag="mCG_132182"
FT                   /product="kelch-like 17 (Drosophila), transcript variant
FT                   mCT177832"
FT                   /note="gene_id=mCG132182.2 transcript_id=mCT177832.1
FT                   created on 19-JUN-2003"
FT   CDS             complement(join(8465892..8466120,8466363..8466544,
FT                   8466759..8466832,8466943..8467031,8467405..8467572,
FT                   8467660..8467804,8468045..8468258,8468487..8468603,
FT                   8469074..8469295,8469442..8469563,8469653..8469912,
FT                   8470580..8470680))
FT                   /codon_start=1
FT                   /gene="Klhl17"
FT                   /locus_tag="mCG_132182"
FT                   /product="kelch-like 17 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG132182.2 transcript_id=mCT133531.2
FT                   protein_id=mCP76778.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RTE7"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR011705"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR015916"
FT                   /db_xref="InterPro:IPR017096"
FT                   /db_xref="MGI:MGI:2678948"
FT                   /db_xref="UniProtKB/TrEMBL:B2RTE7"
FT                   /protein_id="EDL15090.1"
FT                   /translation="MQPRGERPAGRTQSPEHSSPGPGPEAPPPPQPPAPEAERARPRQA
FT                   RPAAPMEGAMQLLSREGHSVAHNSKRHYHDAFVAMSRMRQRGLLCDIVLHVAAKEIRAH
FT                   KVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALDQLVQFAYTAEIVVGEGNVQTL
FT                   LPAASLLQLNGVRDACCKFLLSQLDPSNCLGIRGFADTHSCSDLLKAAHRYVLQHFVDV
FT                   AKTEEFMLLPLKQVLELVSSDSLNVPSEEDVYRAVLSWVKHDVDTRRQHVPRLMKCVRL
FT                   PLLSRDFLLGHVDAESLVRHHPDCKDLLIEALKFHLLPEQRGVLGTSRTRPRRCEGAGP
FT                   VLFAVGGGSLFAIHGDCEAYDTRTDRWHVVASMSTRRARVGVAAVGNRLYAVGGYDGTS
FT                   DLATVESYDPVTNTWQPEVSMGTRRSCLGVAALHGLLYAAGGYDGASCLNSAERYDPLT
FT                   GTWTSIAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLATVEKYEPQVNSWTPVASMLSR
FT                   RSSAGVAVLEGALYVAGGNDGTSCLNSVERYSTKAGAWESVAPMNIRRSTHDLVAMDGW
FT                   LYAVGGNDGSSSLNSIEKYNPRTNKWVAASCMFTRRSSVGVAVLELLNFPPPSSPTLSV
FT                   SSTSL"
FT   CDS             complement(join(8466109..8466120,8466759..8466832,
FT                   8466943..8467031,8467405..8467572,8467660..8467804,
FT                   8468045..8468258,8468487..8468603,8469074..8469295,
FT                   8469442..8469563,8469653..8469912,8470580..8470680))
FT                   /codon_start=1
FT                   /gene="Klhl17"
FT                   /locus_tag="mCG_132182"
FT                   /product="kelch-like 17 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG132182.2 transcript_id=mCT177832.1
FT                   protein_id=mCP100754.0 isoform=CRA_b"
FT                   /protein_id="EDL15091.1"
FT                   /translation="MQPRGERPAGRTQSPEHSSPGPGPEAPPPPQPPAPEAERARPRQA
FT                   RPAAPMEGAMQLLSREGHSVAHNSKRHYHDAFVAMSRMRQRGLLCDIVLHVAAKEIRAH
FT                   KVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALDQLVQFAYTAEIVVGEGNVQTL
FT                   LPAASLLQLNGVRDACCKFLLSQLDPSNCLGIRGFADTHSCSDLLKAAHRYVLQHFVDV
FT                   AKTEEFMLLPLKQVLELVSSDSLNVPSEEDVYRAVLSWVKHDVDTRRQHVPRLMKCVRL
FT                   PLLSRDFLLGHVDAESLVRHHPDCKDLLIEALKFHLLPEQRGVLGTSRTRPRRCEGAGP
FT                   VLFAVGGGSLFAIHGDCEAYDTRTDRWHVVASMSTRRARVGVAAVGNRLYAVGGYDGTS
FT                   DLATVESYDPVTNTWQPEVSMGTRRSCLGVAALHGLLYAAGGYDGASCLNSAERYDPLT
FT                   GTWTSIAAMSTRRRYVRVATLDGNLYAVGGYDSSSHLATVEKYEPQEHT"
FT   CDS             complement(join(8466541..8466544,8466759..8466862,
FT                   8466962..8467031,8467405..8467572,8467660..8467804,
FT                   8468045..8468255))
FT                   /codon_start=1
FT                   /gene="Klhl17"
FT                   /locus_tag="mCG_132182"
FT                   /product="kelch-like 17 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG132182.2 transcript_id=mCT185864.0
FT                   protein_id=mCP107122.0 isoform=CRA_c"
FT                   /protein_id="EDL15092.1"
FT                   /translation="MKCVRLPLLSRDFLLGHVDAESLVRHHPDCKDLLIEALKFHLLPE
FT                   QRGVLGTSRTRPRRCEGAGPVLFAVGGGSLFAIHGDCEAYDTRTDRWHVVASMSTRRAR
FT                   VGVAAVGNRLYAVGGYDGTSDLATVESYDPVTNTWQPEVSMGTRRSCLGVAALHGLLYA
FT                   AGGYDGASCLNSAERYDPLTGTWTSIAAMSTRRRYELRGYIAFPQMGTCTPWVVMTARH
FT                   TWPPWRSMSPR"
FT   gap             8470370..8470522
FT                   /estimated_length=153
FT   gene            8471839..8483831
FT                   /gene="Noc2l"
FT                   /locus_tag="mCG_22596"
FT                   /note="gene_id=mCG22596.1"
FT   mRNA            join(8471839..8471991,8472076..8472246,8473241..8473415,
FT                   8473498..8473626,8475074..8475194,8475282..8475372,
FT                   8475986..8476061,8476149..8476259,8476492..8476605,
FT                   8477205..8477393,8477553..8477692,8478457..8478568,
FT                   8479401..8479514,8479932..8480033,8481060..8481203,
FT                   8481323..8481436,8481708..8481843,8482549..8482635,
FT                   8482891..8483831)
FT                   /gene="Noc2l"
FT                   /locus_tag="mCG_22596"
FT                   /product="nucleolar complex associated 2 homolog (S.
FT                   cerevisiae), transcript variant mCT23089"
FT                   /note="gene_id=mCG22596.1 transcript_id=mCT23089.2 created
FT                   on 30-JAN-2003"
FT   CDS             join(8471966..8471991,8472076..8472246,8473241..8473415,
FT                   8473498..8473626,8475074..8475194,8475282..8475372,
FT                   8475986..8476061,8476149..8476259,8476492..8476605,
FT                   8477205..8477393,8477553..8477692,8478457..8478568,
FT                   8479401..8479514,8479932..8480033,8481060..8481203,
FT                   8481323..8481436,8481708..8481843,8482549..8482635,
FT                   8482891..8482991)
FT                   /codon_start=1
FT                   /gene="Noc2l"
FT                   /locus_tag="mCG_22596"
FT                   /product="nucleolar complex associated 2 homolog (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG22596.1 transcript_id=mCT23089.2
FT                   protein_id=mCP21704.2 isoform=CRA_b"
FT                   /protein_id="EDL15094.1"
FT                   /translation="MAASRAPRRRLEDLSVDEFLASGFESGSESELEGAAEAAAEERRA
FT                   RGAAWNRERRGARTSPGPAGRPRKGRASEHKDQLSRLKDRDPEFYKFLQENDRSLLDFS
FT                   DSDSSAEEEEPFHSLPDTLEEASETEEDGGEDSDALPRGLRSKKNEPVPVTLAMVERWR
FT                   QGSRHHLSPRLFHEVVQAFRAAVATTQGEQEAAETCRFQVADSAVFNALVTFCIRDLCG
FT                   CLQKLLFGKTPKDSNRLLPSSSPLWGKLRVDVKTYLSAVVQLVACLAEATVSAAVLQHI
FT                   SSLVPYYLTFPKQCRMLLKRMVVLWSTGEESLRVLAFLVLIRVCRHKKEAFLGPILKQM
FT                   YIMYVRNCKFTSPSTLPLISFMQRTLTEMLALDPSVSYQHAFLYIRQLAVHLRNAMTAG
FT                   KKETHQSVYNWQYVHCLYLWCRVLSTLGSSEILQPLLYPLSQIIIGCIKLLPTARFYPL
FT                   RMHCVRALTLLSQTIGTFIPVLPFILEIFQQVDFNRRPGRMSSKPINFSVILKLSSTNL
FT                   QEKAYRDGLLEQLCDLTLEYLHSQAHSIAFPELVLPTVLQLKSFLRECKVANYCRQVRQ
FT                   LLEKVQENARHIQSLRQSATFSVSDRTAVDAWEKQVREEGTPLTRYYGHWKKLRDREIQ
FT                   LEISGKERLEDLNFPEIKRRKVEDRKDEDRKELKDLFELDSSEGEDSTDFFERGVPRLP
FT                   EAHQGLKEDQEEEDKEEGDSDSEDGDTDTGVDLSELWQLAQGPQDELEDLQLSEED"
FT   mRNA            join(8472072..8472246,8473241..8473626,8475074..8475194,
FT                   8475282..8475372,8475986..8476061,8476149..8476259,
FT                   8476492..8476605,8477205..8477393,8477553..8477692,
FT                   8478457..8478568,8479401..8479514,8479932..8480033,
FT                   8481060..8481203,8481323..8481436,8481708..8481843,
FT                   8482549..8482635,8482891..8483704)
FT                   /gene="Noc2l"
FT                   /locus_tag="mCG_22596"
FT                   /product="nucleolar complex associated 2 homolog (S.
FT                   cerevisiae), transcript variant mCT179355"
FT                   /note="gene_id=mCG22596.1 transcript_id=mCT179355.0 created
FT                   on 30-JAN-2003"
FT   CDS             join(8473597..8473626,8475074..8475194,8475282..8475372,
FT                   8475986..8476061,8476149..8476259,8476492..8476605,
FT                   8477205..8477393,8477553..8477692,8478457..8478568,
FT                   8479401..8479514,8479932..8480033,8481060..8481203,
FT                   8481323..8481436,8481708..8481843,8482549..8482635,
FT                   8482891..8482991)
FT                   /codon_start=1
FT                   /gene="Noc2l"
FT                   /locus_tag="mCG_22596"
FT                   /product="nucleolar complex associated 2 homolog (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG22596.1 transcript_id=mCT179355.0
FT                   protein_id=mCP102277.0 isoform=CRA_a"
FT                   /protein_id="EDL15093.1"
FT                   /translation="MVERWRQGSRHHLSPRLFHEVVQAFRAAVATTQGEQEAAETCRFQ
FT                   VADSAVFNALVTFCIRDLCGCLQKLLFGKTPKDSNRLLPSSSPLWGKLRVDVKTYLSAV
FT                   VQLVACLAEATVSAAVLQHISSLVPYYLTFPKQCRMLLKRMVVLWSTGEESLRVLAFLV
FT                   LIRVCRHKKEAFLGPILKQMYIMYVRNCKFTSPSTLPLISFMQRTLTEMLALDPSVSYQ
FT                   HAFLYIRQLAVHLRNAMTAGKKETHQSVYNWQYVHCLYLWCRVLSTLGSSEILQPLLYP
FT                   LSQIIIGCIKLLPTARFYPLRMHCVRALTLLSQTIGTFIPVLPFILEIFQQVDFNRRPG
FT                   RMSSKPINFSVILKLSSTNLQEKAYRDGLLEQLCDLTLEYLHSQAHSIAFPELVLPTVL
FT                   QLKSFLRECKVANYCRQVRQLLEKVQENARHIQSLRQSATFSVSDRTAVDAWEKQVREE
FT                   GTPLTRYYGHWKKLRDREIQLEISGKERLEDLNFPEIKRRKVEDRKDEDRKELKDLFEL
FT                   DSSEGEDSTDFFERGVPRLPEAHQGLKEDQEEEDKEEGDSDSEDGDTDTGVDLSELWQL
FT                   AQGPQDELEDLQLSEED"
FT   gene            complement(8483049..8493787)
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /note="gene_id=mCG22601.3"
FT   mRNA            complement(join(8483049..8483854,8483973..8484083,
FT                   8484232..8485007,8485080..8485158,8485270..8485385,
FT                   8486225..8486387,8487836..8487970,8488085..8488201,
FT                   8491041..8491132,8491765..>8491880))
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /product="sterile alpha motif domain containing 11,
FT                   transcript variant mCT190896"
FT                   /note="gene_id=mCG22601.3 transcript_id=mCT190896.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(8483178..8483854,8483973..8484083,
FT                   8484222..8484343,8484505..8485007,8485080..8485158,
FT                   8485270..8485385,8486225..8486387,8487836..8487970,
FT                   8488085..8488201,8491041..8491859))
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /product="sterile alpha motif domain containing 11,
FT                   transcript variant mCT23164"
FT                   /note="gene_id=mCG22601.3 transcript_id=mCT23164.1 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(8483179..8483854,8483973..8484083,
FT                   8484222..8484343,8484505..8485007,8485080..8485158,
FT                   8485270..8485385,8486225..8486387,8487836..8487970,
FT                   8488115..8488201,8491041..8491132,8493714..8493787))
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /product="sterile alpha motif domain containing 11,
FT                   transcript variant mCT177834"
FT                   /note="gene_id=mCG22601.3 transcript_id=mCT177834.0 created
FT                   on 30-DEC-2002"
FT   mRNA            complement(join(8483179..8483854,8483973..8484083,
FT                   8484222..8484343,8484505..8485007,8485080..8485158,
FT                   8485270..8485385,8486225..8486387,8487836..8487970,
FT                   8488085..8488201,8491041..8491132,8491863..8491912))
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /product="sterile alpha motif domain containing 11,
FT                   transcript variant mCT177833"
FT                   /note="gene_id=mCG22601.3 transcript_id=mCT177833.0 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(8483609..8483854,8483973..8484083,
FT                   8484222..8484343,8484505..8485007,8485080..8485158,
FT                   8485270..8485385,8486225..8486387,8487836..8487970,
FT                   8488115..8488201,8491041..8491107))
FT                   /codon_start=1
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /product="sterile alpha motif domain containing 11, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22601.3 transcript_id=mCT177834.0
FT                   protein_id=mCP100755.0 isoform=CRA_b"
FT                   /protein_id="EDL15096.1"
FT                   /translation="MPERPRHCDFQRGNVEIGLGPGGDLLGKRLSCPCITSHCSSEKKA
FT                   RSKDPQATSLLPKLESTMAPEDHYHQLMSALSEASSFEETQRLYHLGIPSHDLLRVRQE
FT                   VATATLRGPSGLEVHLPSSTADHRRKQGLVQRREGAVPAAATSFSEREMSQPPPLLSPQ
FT                   NAAHITMSSHLPPPFLGMPTAVCQTPGFSFLPSAQAEMLARQQELLRKQSLARLEMSEL
FT                   LRQKELGSVHRPLLPAPEVALHIPEGPDELQRRGSMLVLKHSSAPLLALPPQGPPGPGP
FT                   PIPPKESARSRSEKGSLGVQPSQPKETTGAGLWAQEVSEEPSKDSDGEDPETAAAREGT
FT                   STPSQVPAGGTRAEGRGLLSGSTLPPPLPLGFPCGAVSPYFHTGTMGGLFTDEETTTLE
FT                   DVNKWTVDDVCNFVGGLSGCGEYARVFREQGIDGETLPLLTEEHLLNTMGLKLGPALKI
FT                   RAQVAKRLGRVFYMASFPVALPLQPPSLQAPELSPGHQPLSPATTTSPYEGTHLPTGQA
FT                   SPKQENGSGTIALLSGAPDPSQLLQ"
FT   CDS             complement(join(8483609..8483854,8483973..8484083,
FT                   8484222..8484343,8484505..8485007,8485080..8485158,
FT                   8485270..8485385,8486225..8486387,8487836..8487970,
FT                   8488085..8488201,8491041..8491107))
FT                   /codon_start=1
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /product="sterile alpha motif domain containing 11, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22601.3 transcript_id=mCT177833.0
FT                   protein_id=mCP100756.0 isoform=CRA_a"
FT                   /protein_id="EDL15095.1"
FT                   /translation="MPERPRHCDFQRGNVEIGLGPGGDLLGKRLSCPCITSHCSSEKKA
FT                   RSKDPQGESPTLEKDAATSLLPKLESTMAPEDHYHQLMSALSEASSFEETQRLYHLGIP
FT                   SHDLLRVRQEVATATLRGPSGLEVHLPSSTADHRRKQGLVQRREGAVPAAATSFSEREM
FT                   SQPPPLLSPQNAAHITMSSHLPPPFLGMPTAVCQTPGFSFLPSAQAEMLARQQELLRKQ
FT                   SLARLEMSELLRQKELGSVHRPLLPAPEVALHIPEGPDELQRRGSMLVLKHSSAPLLAL
FT                   PPQGPPGPGPPIPPKESARSRSEKGSLGVQPSQPKETTGAGLWAQEVSEEPSKDSDGED
FT                   PETAAAREGTSTPSQVPAGGTRAEGRGLLSGSTLPPPLPLGFPCGAVSPYFHTGTMGGL
FT                   FTDEETTTLEDVNKWTVDDVCNFVGGLSGCGEYARVFREQGIDGETLPLLTEEHLLNTM
FT                   GLKLGPALKIRAQVAKRLGRVFYMASFPVALPLQPPSLQAPELSPGHQPLSPATTTSPY
FT                   EGTHLPTGQASPKQENGSGTIALLSGAPDPSQLLQ"
FT   CDS             complement(join(8483609..8483854,8483973..8484083,
FT                   8484222..8484343,8484505..8485007,8485080..8485158,
FT                   8485270..8485385,8486225..8486387,8487836..8487970,
FT                   8488085..8488201,8491041..8491107))
FT                   /codon_start=1
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /product="sterile alpha motif domain containing 11, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22601.3 transcript_id=mCT23164.1
FT                   protein_id=mCP21734.2 isoform=CRA_a"
FT                   /protein_id="EDL15098.1"
FT                   /translation="MPERPRHCDFQRGNVEIGLGPGGDLLGKRLSCPCITSHCSSEKKA
FT                   RSKDPQGESPTLEKDAATSLLPKLESTMAPEDHYHQLMSALSEASSFEETQRLYHLGIP
FT                   SHDLLRVRQEVATATLRGPSGLEVHLPSSTADHRRKQGLVQRREGAVPAAATSFSEREM
FT                   SQPPPLLSPQNAAHITMSSHLPPPFLGMPTAVCQTPGFSFLPSAQAEMLARQQELLRKQ
FT                   SLARLEMSELLRQKELGSVHRPLLPAPEVALHIPEGPDELQRRGSMLVLKHSSAPLLAL
FT                   PPQGPPGPGPPIPPKESARSRSEKGSLGVQPSQPKETTGAGLWAQEVSEEPSKDSDGED
FT                   PETAAAREGTSTPSQVPAGGTRAEGRGLLSGSTLPPPLPLGFPCGAVSPYFHTGTMGGL
FT                   FTDEETTTLEDVNKWTVDDVCNFVGGLSGCGEYARVFREQGIDGETLPLLTEEHLLNTM
FT                   GLKLGPALKIRAQVAKRLGRVFYMASFPVALPLQPPSLQAPELSPGHQPLSPATTTSPY
FT                   EGTHLPTGQASPKQENGSGTIALLSGAPDPSQLLQ"
FT   CDS             complement(join(8484491..8485007,8485080..8485158,
FT                   8485270..8485385,8486225..8486387,8487836..8487970,
FT                   8488085..8488201,8491041..8491132,8491765..>8491790))
FT                   /codon_start=1
FT                   /gene="Samd11"
FT                   /locus_tag="mCG_22601"
FT                   /product="sterile alpha motif domain containing 11, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG22601.3 transcript_id=mCT190896.0
FT                   protein_id=mCP111833.0 isoform=CRA_c"
FT                   /protein_id="EDL15097.1"
FT                   /translation="CGCSYRPSGAHRSRCLVMPERPRHCDFQRGNVEIGLGPGGDLLGK
FT                   RLSCPCITSHCSSEKKARSKDPQGESPTLEKDAATSLLPKLESTMAPEDHYHQLMSALS
FT                   EASSFEETQRLYHLGIPSHDLLRVRQEVATATLRGPSGLEVHLPSSTADHRRKQGLVQR
FT                   REGAVPAAATSFSEREMSQPPPLLSPQNAAHITMSSHLPPPFLGMPTAVCQTPGFSFLP
FT                   SAQAEMLARQQELLRKQSLARLEMSELLRQKELGSVHRPLLPAPEVALHIPEGPDELQR
FT                   RGSMLVLKHSSAPLLALPPQGPPGPGPPIPPKESARSRSEKGSLGVQPSQPKETTGAGL
FT                   WAQEVSEEPSKDSDGEDPETAAAREGTSTPSQVPAGGTRAEGRGLLSGSTLPPPLPLGF
FT                   PCGAVSPYFHTGGQP"
FT   gap             8489436..8490262
FT                   /estimated_length=827
FT   gap             8493986..8495165
FT                   /estimated_length=1180
FT   gap             8496343..8496685
FT                   /estimated_length=343
XX
CO   join(AAHY01041853.1:1..18907,gap(20),AAHY01041854.1:1..6392,gap(1304),
CO   AAHY01041855.1:1..1210,gap(20),AAHY01041856.1:1..3519,gap(184),
CO   AAHY01041857.1:1..1072,gap(20),AAHY01041858.1:1..2200,gap(20),
CO   AAHY01041859.1:1..6212,gap(567),AAHY01041860.1:1..1310,gap(20),
CO   AAHY01041861.1:1..688,gap(713),complement(AAHY01041862.1:1..964),gap(371),
CO   AAHY01041863.1:1..1818,gap(20),AAHY01041864.1:1..1651,gap(20),
CO   complement(AAHY01041865.1:1..1452),gap(20),AAHY01041866.1:1..5054,gap(20),
CO   AAHY01041867.1:1..1041,gap(20),AAHY01041868.1:1..12307,gap(517),
CO   AAHY01041869.1:1..2122,gap(68),complement(AAHY01041870.1:1..2154),gap(20),
CO   complement(AAHY01041871.1:1..1231),gap(761),
CO   complement(AAHY01041872.1:1..4846),gap(1268),
CO   complement(AAHY01041873.1:1..1415),gap(3065),
CO   complement(AAHY01041874.1:1..1240),gap(20),
CO   complement(AAHY01041875.1:1..2661),gap(1267),AAHY01041876.1:1..967,
CO   gap(234),complement(AAHY01041877.1:1..1489),gap(3688),
CO   AAHY01041878.1:1..1171,gap(20),AAHY01041879.1:1..809,gap(258),
CO   AAHY01041880.1:1..1648,gap(51),AAHY01041881.1:1..2877,gap(226),
CO   AAHY01041882.1:1..5485,gap(1004),AAHY01041883.1:1..2219,gap(2256),
CO   AAHY01041884.1:1..14585,gap(20),AAHY01041885.1:1..1446,gap(20),
CO   complement(AAHY01041886.1:1..1688),gap(20),AAHY01041887.1:1..38049,gap(66),
CO   AAHY01041888.1:1..12485,gap(469),AAHY01041889.1:1..1239,gap(669),
CO   AAHY01041890.1:1..7866,gap(746),AAHY01041891.1:1..39057,gap(20),
CO   AAHY01041892.1:1..1257,gap(20),complement(AAHY01041893.1:1..2161),gap(20),
CO   complement(AAHY01041894.1:1..1407),gap(20),AAHY01041895.1:1..38911,
CO   gap(1002),AAHY01041896.1:1..32000,gap(285),AAHY01041897.1:1..4127,gap(377),
CO   AAHY01041898.1:1..12212,gap(97),AAHY01041899.1:1..7898,gap(685),
CO   AAHY01041900.1:1..3450,gap(2771),AAHY01041901.1:1..28342,gap(182),
CO   AAHY01041902.1:1..26700,gap(260),AAHY01041903.1:1..1460,gap(1074),
CO   AAHY01041904.1:1..6627,gap(20),AAHY01041905.1:1..3410,gap(51),
CO   AAHY01041906.1:1..29738,gap(1709),AAHY01041907.1:1..7139,gap(20),
CO   AAHY01041908.1:1..8544,gap(552),AAHY01041909.1:1..39771,gap(140),
CO   AAHY01041910.1:1..2317,gap(667),AAHY01041911.1:1..17283,gap(129),
CO   AAHY01041912.1:1..24842,gap(20),AAHY01041913.1:1..22127,gap(20),
CO   complement(AAHY01041914.1:1..2168),gap(1050),AAHY01041915.1:1..1082,
CO   gap(20),AAHY01041916.1:1..7382,gap(28),AAHY01041917.1:1..2777,gap(243),
CO   AAHY01041918.1:1..7750,gap(116),AAHY01041919.1:1..8559,gap(20),
CO   complement(AAHY01041920.1:1..1125),gap(100),
CO   complement(AAHY01041921.1:1..1869),gap(341),
CO   complement(AAHY01041922.1:1..908),gap(41),
CO   complement(AAHY01041923.1:1..8149),gap(20),AAHY01041924.1:1..16174,
CO   gap(253),complement(AAHY01041925.1:1..5265),gap(20),
CO   complement(AAHY01041926.1:1..9718),gap(20),
CO   complement(AAHY01041927.1:1..7371),gap(683),AAHY01041928.1:1..18341,
CO   gap(109),AAHY01041929.1:1..23940,gap(20),AAHY01041930.1:1..187206,
CO   gap(2342),AAHY01041931.1:1..11026,gap(587),AAHY01041932.1:1..12938,gap(20),
CO   AAHY01041933.1:1..8386,gap(3919),AAHY01041934.1:1..8592,gap(41),
CO   AAHY01041935.1:1..23419,gap(20),complement(AAHY01041936.1:1..3367),gap(29),
CO   AAHY01041937.1:1..6011,gap(85),AAHY01041938.1:1..1495,gap(347),
CO   AAHY01041939.1:1..1933,gap(247),complement(AAHY01041940.1:1..1343),
CO   gap(288),AAHY01041941.1:1..2381,gap(111),AAHY01041942.1:1..14655,gap(94),
CO   AAHY01041943.1:1..16598,gap(789),AAHY01041944.1:1..7256,gap(838),
CO   AAHY01041945.1:1..23489,gap(133),AAHY01041946.1:1..10337,gap(1685),
CO   AAHY01041947.1:1..8250,gap(119),complement(AAHY01041948.1:1..743),gap(32),
CO   AAHY01041949.1:1..2927,gap(972),AAHY01041950.1:1..915,gap(511),
CO   AAHY01041951.1:1..11873,gap(124),AAHY01041952.1:1..19994,gap(134),
CO   AAHY01041953.1:1..6555,gap(52),AAHY01041954.1:1..8116,gap(385),
CO   AAHY01041955.1:1..4120,gap(188),complement(AAHY01041956.1:1..4329),
CO   gap(305),AAHY01041957.1:1..28797,gap(532),AAHY01041958.1:1..6969,gap(20),
CO   AAHY01041959.1:1..3198,gap(199),AAHY01041960.1:1..925,gap(117),
CO   complement(AAHY01041961.1:1..2351),gap(215),AAHY01041962.1:1..5138,
CO   gap(179),AAHY01041963.1:1..57481,gap(20),
CO   complement(AAHY01041964.1:1..14497),gap(20),AAHY01041965.1:1..15627,
CO   gap(20),AAHY01041966.1:1..2482,gap(20),AAHY01041967.1:1..5521,gap(295),
CO   AAHY01041968.1:1..16232,gap(20),AAHY01041969.1:1..10330,gap(20),
CO   AAHY01041970.1:1..8753,gap(102),AAHY01041971.1:1..26632,gap(20),
CO   complement(AAHY01041972.1:1..2656),gap(20),
CO   complement(AAHY01041973.1:1..1149),gap(20),AAHY01041974.1:1..1082,gap(20),
CO   complement(AAHY01041975.1:1..1765),gap(20),
CO   complement(AAHY01041976.1:1..7057),gap(20),AAHY01041977.1:1..12199,gap(86),
CO   AAHY01041978.1:1..6379,gap(353),complement(AAHY01041979.1:1..836),
CO   gap(1929),AAHY01041980.1:1..1338,gap(2117),AAHY01041981.1:1..23803,
CO   gap(406),AAHY01041982.1:1..1705,gap(275),AAHY01041983.1:1..53030,gap(20),
CO   AAHY01041984.1:1..28151,gap(1124),AAHY01041985.1:1..44243,gap(20),
CO   AAHY01041986.1:1..1188,gap(20),complement(AAHY01041987.1:1..18542),
CO   gap(124),AAHY01041988.1:1..24924,gap(91),
CO   complement(AAHY01041989.1:1..6469),gap(100),AAHY01041990.1:1..21496,
CO   gap(20),complement(AAHY01041991.1:1..2159),gap(20),
CO   complement(AAHY01041992.1:1..10791),gap(455),AAHY01041993.1:1..37013,
CO   gap(124),AAHY01041994.1:1..44153,gap(20),AAHY01041995.1:1..1308,gap(20),
CO   AAHY01041996.1:1..12347,gap(20),AAHY01041997.1:1..14476,gap(164),
CO   AAHY01041998.1:1..51749,gap(75),AAHY01041999.1:1..16056,gap(20),
CO   AAHY01042000.1:1..39728,gap(20),AAHY01042001.1:1..13521,gap(588),
CO   complement(AAHY01042002.1:1..8054),gap(20),AAHY01042003.1:1..1575,gap(20),
CO   AAHY01042004.1:1..9062,gap(20),AAHY01042005.1:1..2190,gap(20),
CO   AAHY01042006.1:1..2144,gap(20),AAHY01042007.1:1..27560,gap(20),
CO   AAHY01042008.1:1..8927,gap(44),AAHY01042009.1:1..15539,gap(20),
CO   complement(AAHY01042010.1:1..2378),gap(208),AAHY01042011.1:1..1387,gap(20),
CO   AAHY01042012.1:1..25538,gap(306),AAHY01042013.1:1..1463,gap(244),
CO   AAHY01042014.1:1..5467,gap(3380),AAHY01042015.1:1..3858,gap(1454),
CO   AAHY01042016.1:1..3186,gap(669),AAHY01042017.1:1..2914,gap(28),
CO   AAHY01042018.1:1..29328,gap(151),complement(AAHY01042019.1:1..1544),
CO   gap(81),AAHY01042020.1:1..13827,gap(80),AAHY01042021.1:1..8895,gap(816),
CO   AAHY01042022.1:1..1240,gap(443),AAHY01042023.1:1..1350,gap(20),
CO   AAHY01042024.1:1..2881,gap(1269),AAHY01042025.1:1..27862,gap(20),
CO   complement(AAHY01042026.1:1..18433),gap(20),
CO   complement(AAHY01042027.1:1..1222),gap(20),AAHY01042028.1:1..1276,gap(20),
CO   AAHY01042029.1:1..24349,gap(47),complement(AAHY01042030.1:1..26166),
CO   gap(20),AAHY01042031.1:1..1539,gap(138),complement(AAHY01042032.1:1..6589),
CO   gap(20),complement(AAHY01042033.1:1..1072),gap(20),
CO   complement(AAHY01042034.1:1..8067),gap(451),AAHY01042035.1:1..35516,
CO   gap(50),AAHY01042036.1:1..2039,gap(72),complement(AAHY01042037.1:1..13532),
CO   gap(96),AAHY01042038.1:1..3018,gap(217),
CO   complement(AAHY01042039.1:1..11495),gap(147),
CO   complement(AAHY01042040.1:1..6708),gap(20),AAHY01042041.1:1..2364,gap(20),
CO   complement(AAHY01042042.1:1..1524),gap(20),AAHY01042043.1:1..1149,gap(20),
CO   AAHY01042044.1:1..13283,gap(749),AAHY01042045.1:1..13964,gap(156),
CO   AAHY01042046.1:1..16054,gap(46),complement(AAHY01042047.1:1..26189),
CO   gap(96),AAHY01042048.1:1..26413,gap(20),complement(AAHY01042049.1:1..1817),
CO   gap(20),AAHY01042050.1:1..19191,gap(266),AAHY01042051.1:1..17629,gap(20),
CO   AAHY01042052.1:1..8468,gap(161),AAHY01042053.1:1..11200,gap(338),
CO   AAHY01042054.1:1..13342,gap(71),AAHY01042055.1:1..777,gap(675),
CO   AAHY01042056.1:1..6259,gap(20),AAHY01042057.1:1..11642,gap(21),
CO   AAHY01042058.1:1..11080,gap(438),AAHY01042059.1:1..4531,gap(237),
CO   complement(AAHY01042060.1:1..2989),gap(525),AAHY01042061.1:1..5891,gap(23),
CO   AAHY01042062.1:1..3461,gap(591),AAHY01042063.1:1..599,gap(3301),
CO   AAHY01042064.1:1..4220,gap(347),AAHY01042065.1:1..27928,gap(328),
CO   AAHY01042066.1:1..11883,gap(60),complement(AAHY01042067.1:1..788),gap(448),
CO   AAHY01042068.1:1..15372,gap(20),AAHY01042069.1:1..24811,gap(448),
CO   complement(AAHY01042070.1:1..869),gap(167),AAHY01032601.1:1..2748,
CO   gap(1611),AAHY01032602.1:1..22149,gap(29),AAHY01032603.1:1..35112,gap(20),
CO   AAHY01032604.1:1..14855,gap(122),AAHY01032605.1:1..8846,gap(20),
CO   AAHY01032606.1:1..10911,gap(154),complement(AAHY01032607.1:1..13461),
CO   gap(28),AAHY01032608.1:1..78151,gap(136),AAHY01032609.1:1..19078,gap(147),
CO   AAHY01032610.1:1..15239,gap(597),AAHY01032611.1:1..31320,gap(251),
CO   AAHY01032612.1:1..5880,gap(310),AAHY01032613.1:1..2915,gap(20),
CO   AAHY01032614.1:1..13783,gap(20),AAHY01032615.1:1..1769,gap(20),
CO   AAHY01032616.1:1..19430,gap(359),AAHY01032617.1:1..4625,gap(345),
CO   AAHY01032618.1:1..6481,gap(21),AAHY01032619.1:1..58200,gap(442),
CO   complement(AAHY01032620.1:1..1914),gap(20),
CO   complement(AAHY01032621.1:1..1183),gap(153),AAHY01032622.1:1..10613,
CO   gap(325),complement(AAHY01032623.1:1..5173),gap(20),
CO   complement(AAHY01032624.1:1..18615),gap(20),
CO   complement(AAHY01032625.1:1..8357),gap(20),
CO   complement(AAHY01032626.1:1..7820),gap(43),AAHY01032627.1:1..16809,gap(28),
CO   AAHY01032628.1:1..4534,gap(827),complement(AAHY01032629.1:1..3329),gap(20),
CO   complement(AAHY01032630.1:1..3200),gap(41),AAHY01032631.1:1..4398,gap(371),
CO   complement(AAHY01032632.1:1..2052),gap(1063),AAHY01032633.1:1..19630,
CO   gap(87),AAHY01032634.1:1..3384,gap(98),complement(AAHY01032635.1:1..4296),
CO   gap(20),AAHY01032636.1:1..3678,gap(934),AAHY01032637.1:1..12793,gap(20),
CO   complement(AAHY01032638.1:1..3370),gap(468),AAHY01032639.1:1..657,gap(20),
CO   complement(AAHY01032640.1:1..4686),gap(20),AAHY01032641.1:1..5093,gap(236),
CO   complement(AAHY01032642.1:1..1511),gap(189),AAHY01032643.1:1..1479,gap(83),
CO   AAHY01032644.1:1..9519,gap(2650),AAHY01032645.1:1..16474,gap(181),
CO   AAHY01032646.1:1..4724,gap(236),AAHY01032647.1:1..15218,gap(20),
CO   AAHY01032648.1:1..10015,gap(1874),AAHY01032649.1:1..1296,gap(88),
CO   AAHY01032650.1:1..26675,gap(20),AAHY01032651.1:1..4623,gap(266),
CO   complement(AAHY01032652.1:1..4735),gap(346),AAHY01032653.1:1..71266,
CO   gap(20),AAHY01032654.1:1..29349,gap(20),AAHY01032655.1:1..44431,gap(76),
CO   AAHY01032656.1:1..33583,gap(20),AAHY01032657.1:1..1187,gap(20),
CO   AAHY01032658.1:1..1018,gap(503),AAHY01032659.1:1..1123,gap(20),
CO   complement(AAHY01032660.1:1..1058),gap(20),AAHY01032661.1:1..5641,gap(20),
CO   AAHY01032662.1:1..39777,gap(148),AAHY01032663.1:1..23710,gap(202),
CO   AAHY01032664.1:1..4905,gap(266),AAHY01032665.1:1..6428,gap(71),
CO   AAHY01032666.1:1..1672,gap(142),AAHY01032667.1:1..25787,gap(46),
CO   AAHY01032668.1:1..2408,gap(65),AAHY01032669.1:1..27863,gap(35),
CO   complement(AAHY01032670.1:1..5586),gap(20),
CO   complement(AAHY01032671.1:1..10394),gap(323),
CO   complement(AAHY01032672.1:1..962),gap(347),AAHY01032673.1:1..1809,gap(173),
CO   complement(AAHY01032674.1:1..8580),gap(20),AAHY01032675.1:1..45844,
CO   gap(131),AAHY01032676.1:1..15068,gap(20),AAHY01032677.1:1..31076,gap(161),
CO   AAHY01032678.1:1..44670,gap(20),AAHY01032679.1:1..45483,gap(107),
CO   AAHY01032680.1:1..24089,gap(20),AAHY01032681.1:1..3696,gap(47),
CO   AAHY01032682.1:1..15074,gap(20),complement(AAHY01032683.1:1..1329),gap(20),
CO   complement(AAHY01032684.1:1..1101),gap(20),
CO   complement(AAHY01032685.1:1..1609),gap(20),AAHY01032686.1:1..17628,
CO   gap(511),AAHY01032687.1:1..11726,gap(26),AAHY01032688.1:1..16663,gap(20),
CO   AAHY01032689.1:1..6469,gap(20),AAHY01032690.1:1..3925,gap(20),
CO   AAHY01032691.1:1..15692,gap(20),AAHY01032692.1:1..5121,gap(178),
CO   AAHY01032693.1:1..6768,gap(1055),AAHY01032694.1:1..22035,gap(511),
CO   AAHY01032695.1:1..9620,gap(157),AAHY01032696.1:1..1193,gap(20),
CO   complement(AAHY01032697.1:1..4241),gap(370),
CO   complement(AAHY01032698.1:1..1439),gap(20),AAHY01032699.1:1..28913,gap(66),
CO   complement(AAHY01032700.1:1..4480),gap(2725),AAHY01032701.1:1..1136,
CO   gap(20),AAHY01032702.1:1..2407,gap(20),AAHY01032703.1:1..11641,gap(84),
CO   AAHY01032704.1:1..967,gap(186),AAHY01032705.1:1..7964,gap(20),
CO   AAHY01032706.1:1..30369,gap(1743),AAHY01032707.1:1..7284,gap(20),
CO   AAHY01032708.1:1..1653,gap(1178),AAHY01032709.1:1..11936,gap(20),
CO   AAHY01032710.1:1..112334,gap(109),AAHY01032711.1:1..14190,gap(217),
CO   AAHY01032712.1:1..5742,gap(429),AAHY01032713.1:1..12756,gap(15100),
CO   AAHY01032714.1:1..24829,gap(828),complement(AAHY01032715.1:1..6480),
CO   gap(20),complement(AAHY01032716.1:1..8563),gap(210),
CO   complement(AAHY01032717.1:1..20911),gap(20),AAHY01032718.1:1..5601,gap(24),
CO   complement(AAHY01032719.1:1..336),gap(383),AAHY01032720.1:1..3934,gap(20),
CO   AAHY01032721.1:1..7816,gap(74),complement(AAHY01032722.1:1..41316),gap(20),
CO   complement(AAHY01032723.1:1..3901),gap(20),AAHY01032724.1:1..3672,gap(707),
CO   AAHY01032725.1:1..3290,gap(152),AAHY01032726.1:1..2441,gap(20),
CO   complement(AAHY01032727.1:1..3262),gap(20),
CO   complement(AAHY01032728.1:1..25706),gap(49),AAHY01032729.1:1..6963,
CO   gap(176),complement(AAHY01032730.1:1..18187),gap(480),
CO   AAHY01032731.1:1..1943,gap(109),complement(AAHY01032732.1:1..6620),gap(37),
CO   AAHY01032733.1:1..9021,gap(411),AAHY01032734.1:1..7436,gap(62),
CO   complement(AAHY01032735.1:1..5813),gap(408),
CO   complement(AAHY01032736.1:1..10796),gap(20),
CO   complement(AAHY01032737.1:1..43808),gap(1344),AAHY01032738.1:1..506,
CO   gap(936),AAHY01032739.1:1..44765,gap(116),AAHY01032740.1:1..7974,gap(557),
CO   AAHY01032741.1:1..4997,gap(20),AAHY01032742.1:1..10191,gap(20),
CO   AAHY01032743.1:1..19544,gap(20),AAHY01032744.1:1..20409,gap(20),
CO   AAHY01032745.1:1..21417,gap(344),AAHY01032746.1:1..64170,gap(1042),
CO   AAHY01032747.1:1..19593,gap(46),AAHY01032748.1:1..10615,gap(20),
CO   AAHY01032749.1:1..65145,gap(20),AAHY01032750.1:1..39074,gap(158),
CO   complement(AAHY01032751.1:1..6453),gap(54),AAHY01032752.1:1..5160,gap(124),
CO   AAHY01032753.1:1..4622,gap(20),complement(AAHY01032754.1:1..17250),gap(86),
CO   AAHY01032755.1:1..19805,gap(53),complement(AAHY01032756.1:1..37654),
CO   gap(275),complement(AAHY01032757.1:1..3732),gap(501),
CO   AAHY01032758.1:1..8156,gap(20),AAHY01032759.1:1..5993,gap(20),
CO   complement(AAHY01032760.1:1..1316),gap(20),AAHY01032761.1:1..3472,gap(20),
CO   complement(AAHY01032762.1:1..1157),gap(3811),
CO   complement(AAHY01032763.1:1..7493),gap(988),
CO   complement(AAHY01032764.1:1..22171),gap(545),
CO   complement(AAHY01032765.1:1..4816),gap(20),AAHY01032766.1:1..12652,
CO   gap(1186),AAHY01032767.1:1..5945,gap(899),
CO   complement(AAHY01032768.1:1..923),gap(245),AAHY01032769.1:1..27453,gap(20),
CO   AAHY01032770.1:1..9165,gap(20),AAHY01032771.1:1..2616,gap(20),
CO   AAHY01032772.1:1..8809,gap(427),AAHY01032773.1:1..5645,gap(20),
CO   AAHY01032774.1:1..8632,gap(20),AAHY01032775.1:1..14270,gap(101),
CO   complement(AAHY01032776.1:1..957),gap(392),AAHY01032777.1:1..14694,gap(20),
CO   AAHY01032778.1:1..16464,gap(534),complement(AAHY01032779.1:1..3361),
CO   gap(123),AAHY01032780.1:1..9721,gap(230),AAHY01032781.1:1..4499,gap(20),
CO   AAHY01032782.1:1..36369,gap(500),complement(AAHY01032783.1:1..1472),
CO   gap(29),complement(AAHY01032784.1:1..4603),gap(540),
CO   complement(AAHY01032785.1:1..26921),gap(20),
CO   complement(AAHY01032786.1:1..3408),gap(75),
CO   complement(AAHY01032787.1:1..17327),gap(651),AAHY01032788.1:1..7810,
CO   gap(21),complement(AAHY01032789.1:1..11383),gap(238),
CO   complement(AAHY01032790.1:1..924),gap(582),
CO   complement(AAHY01032791.1:1..3689),gap(46),
CO   complement(AAHY01032792.1:1..8436),gap(20),
CO   complement(AAHY01032793.1:1..5935),gap(20),
CO   complement(AAHY01032794.1:1..1480),gap(953),AAHY01032795.1:1..1351,
CO   gap(1229),AAHY01032796.1:1..13708,gap(206),AAHY01032797.1:1..988,gap(415),
CO   AAHY01032798.1:1..24570,gap(22),AAHY01032799.1:1..3206,gap(432),
CO   complement(AAHY01032800.1:1..2044),gap(20),
CO   complement(AAHY01032801.1:1..18705),gap(20),
CO   complement(AAHY01032802.1:1..33824),gap(20),AAHY01032803.1:1..56646,
CO   gap(20),complement(AAHY01032804.1:1..11821),gap(20),
CO   complement(AAHY01032805.1:1..3276),gap(20),
CO   complement(AAHY01032806.1:1..11404),gap(39),
CO   complement(AAHY01032807.1:1..8626),gap(102),
CO   complement(AAHY01032808.1:1..16134),gap(30707),
CO   complement(AAHY01032809.1:1..7882),gap(20),
CO   complement(AAHY01032810.1:1..3942),gap(20),
CO   complement(AAHY01032811.1:1..12467),gap(60),
CO   complement(AAHY01032812.1:1..8401),gap(20),AAHY01032813.1:1..9875,gap(124),
CO   AAHY01032814.1:1..2424,gap(191),AAHY01032815.1:1..3552,gap(589),
CO   AAHY01032816.1:1..6909,gap(20),complement(AAHY01032817.1:1..1595),gap(315),
CO   complement(AAHY01032818.1:1..1326),gap(20),
CO   complement(AAHY01032819.1:1..1494),gap(20),
CO   complement(AAHY01032820.1:1..3323),gap(90),
CO   complement(AAHY01032821.1:1..1164),gap(62),
CO   complement(AAHY01032822.1:1..8170),gap(20),AAHY01032823.1:1..8974,gap(184),
CO   complement(AAHY01032824.1:1..23637),gap(20),AAHY01032825.1:1..4937,gap(20),
CO   complement(AAHY01032826.1:1..10387),gap(20),AAHY01032827.1:1..33510,
CO   gap(94),complement(AAHY01032828.1:1..25020),gap(297),
CO   AAHY01032829.1:1..1480,gap(20),complement(AAHY01032830.1:1..4997),gap(20),
CO   complement(AAHY01032831.1:1..5252),gap(126),
CO   complement(AAHY01032832.1:1..775),gap(20),
CO   complement(AAHY01032833.1:1..11392),gap(20),AAHY01032834.1:1..32252,
CO   gap(288),AAHY01032835.1:1..2346,gap(20),AAHY01032836.1:1..11128,gap(679),
CO   AAHY01032837.1:1..14074,gap(113),AAHY01032838.1:1..24010,gap(152),
CO   AAHY01032839.1:1..1697,gap(20),AAHY01032840.1:1..3342,gap(108),
CO   AAHY01032841.1:1..6557,gap(131),AAHY01032842.1:1..24692,gap(127),
CO   AAHY01032843.1:1..2292,gap(372),complement(AAHY01032844.1:1..578),gap(20),
CO   complement(AAHY01032845.1:1..3471),gap(20),
CO   complement(AAHY01032846.1:1..7646),gap(20),
CO   complement(AAHY01032847.1:1..4849),gap(121),
CO   complement(AAHY01032848.1:1..6685),gap(20),AAHY01032849.1:1..4473,
CO   gap(1107),AAHY01032850.1:1..15962,gap(20),
CO   complement(AAHY01032851.1:1..24777),gap(188),
CO   complement(AAHY01032852.1:1..2683),gap(35),AAHY01032853.1:1..1074,gap(20),
CO   complement(AAHY01032854.1:1..5003),gap(282),
CO   complement(AAHY01032855.1:1..36817),gap(20),
CO   complement(AAHY01032856.1:1..11316),gap(20),
CO   complement(AAHY01032857.1:1..20140),gap(20),
CO   complement(AAHY01032858.1:1..6248),gap(90),
CO   complement(AAHY01032859.1:1..38428),gap(20),AAHY01032860.1:1..9954,gap(20),
CO   complement(AAHY01032861.1:1..1159),gap(20),
CO   complement(AAHY01032862.1:1..2080),gap(309),AAHY01032863.1:1..16696,
CO   gap(91),complement(AAHY01032864.1:1..4450),gap(181),
CO   complement(AAHY01032865.1:1..9002),gap(67),AAHY01032866.1:1..14044,
CO   gap(202),AAHY01032867.1:1..13679,gap(1354),AAHY01032868.1:1..4053,gap(139),
CO   complement(AAHY01032869.1:1..5461),gap(20),
CO   complement(AAHY01032870.1:1..5076),gap(217),
CO   complement(AAHY01032871.1:1..7719),gap(116),
CO   complement(AAHY01032872.1:1..13875),gap(20),AAHY01032873.1:1..7121,gap(93),
CO   AAHY01032874.1:1..10007,gap(20),AAHY01032875.1:1..1317,gap(323),
CO   AAHY01032876.1:1..46709,gap(414),complement(AAHY01032877.1:1..5204),
CO   gap(106),AAHY01032878.1:1..6997,gap(20),AAHY01032879.1:1..1693,gap(255),
CO   AAHY01032880.1:1..9898,gap(351),AAHY01032881.1:1..16471,gap(300),
CO   complement(AAHY01032882.1:1..1859),gap(347),AAHY01032883.1:1..3633,gap(20),
CO   complement(AAHY01032884.1:1..3881),gap(20),
CO   complement(AAHY01032885.1:1..18892),gap(1305),
CO   complement(AAHY01032886.1:1..5993),gap(75),
CO   complement(AAHY01032887.1:1..19026),gap(20),AAHY01032888.1:1..10256,
CO   gap(20),AAHY01032889.1:1..37354,gap(42),AAHY01032890.1:1..17529,gap(63),
CO   AAHY01032891.1:1..5492,gap(233),AAHY01032892.1:1..13892,gap(14291),
CO   AAHY01032893.1:1..15599,gap(20),AAHY01032894.1:1..6231,gap(138),
CO   complement(AAHY01032895.1:1..3190),gap(398),
CO   complement(AAHY01032896.1:1..7899),gap(91),
CO   complement(AAHY01032897.1:1..10839),gap(1063),
CO   complement(AAHY01032898.1:1..29911),gap(142),AAHY01032899.1:1..3119,
CO   gap(20),AAHY01032900.1:1..1500,gap(167),
CO   complement(AAHY01032901.1:1..10138),gap(48),AAHY01032902.1:1..28299,
CO   gap(23),AAHY01032903.1:1..23187,gap(2195),AAHY01032904.1:1..1329,gap(20),
CO   AAHY01032905.1:1..17579,gap(2012),AAHY01032906.1:1..19341,gap(171),
CO   AAHY01032907.1:1..6995,gap(20),AAHY01032908.1:1..9059,gap(20),
CO   complement(AAHY01032909.1:1..2261),gap(20),AAHY01032910.1:1..4741,gap(178),
CO   AAHY01032911.1:1..28549,gap(20),complement(AAHY01032912.1:1..5987),
CO   gap(8669),complement(AAHY01032913.1:1..5211),gap(110),
CO   complement(AAHY01032914.1:1..6314),gap(215),AAHY01032915.1:1..9667,gap(43),
CO   complement(AAHY01032916.1:1..32584),gap(20),
CO   complement(AAHY01032917.1:1..12335),gap(137),AAHY01032918.1:1..23146,
CO   gap(20),complement(AAHY01032919.1:1..24330),gap(12847),
CO   AAHY01032920.1:1..28583,gap(93),complement(AAHY01032921.1:1..12898),
CO   gap(34),AAHY01032922.1:1..8675,gap(1142),AAHY01032923.1:1..22363,gap(20),
CO   complement(AAHY01032924.1:1..9522),gap(20),AAHY01032925.1:1..10221,
CO   gap(106),AAHY01032926.1:1..3967,gap(115),
CO   complement(AAHY01032927.1:1..6995),gap(285),AAHY01032928.1:1..21349,
CO   gap(20),AAHY01032929.1:1..8173,gap(841),AAHY01032930.1:1..68128,gap(1100),
CO   AAHY01032931.1:1..7815,gap(20),AAHY01032932.1:1..19636,gap(20),
CO   AAHY01032933.1:1..5333,gap(20),complement(AAHY01032934.1:1..3775),gap(158),
CO   complement(AAHY01032935.1:1..13161),gap(343),
CO   complement(AAHY01032936.1:1..4294),gap(168),AAHY01032937.1:1..1465,
CO   gap(435),AAHY01032938.1:1..27360,gap(20),AAHY01032939.1:1..4069,gap(20),
CO   AAHY01032940.1:1..2206,gap(20),AAHY01032941.1:1..7160,gap(859),
CO   AAHY01032942.1:1..3143,gap(20),complement(AAHY01032943.1:1..18090),gap(20),
CO   complement(AAHY01032944.1:1..12768),gap(81),AAHY01032945.1:1..2026,gap(83),
CO   complement(AAHY01032946.1:1..27099),gap(96),AAHY01032947.1:1..54172,
CO   gap(4809),AAHY01032948.1:1..4822,gap(648),
CO   complement(AAHY01032949.1:1..1645),gap(810),
CO   complement(AAHY01032950.1:1..4811),gap(20),
CO   complement(AAHY01032951.1:1..28912),gap(131),AAHY01032952.1:1..34939,
CO   gap(20),complement(AAHY01032953.1:1..4978),gap(20),
CO   complement(AAHY01032954.1:1..8539),gap(158),
CO   complement(AAHY01032955.1:1..3034),gap(20),AAHY01032956.1:1..1922,gap(146),
CO   complement(AAHY01032957.1:1..10152),gap(139),
CO   complement(AAHY01032958.1:1..61283),gap(59),
CO   complement(AAHY01032959.1:1..10085),gap(493),
CO   complement(AAHY01032960.1:1..29937),gap(345),
CO   complement(AAHY01032961.1:1..4778),gap(30),
CO   complement(AAHY01032962.1:1..8583),gap(20),
CO   complement(AAHY01032963.1:1..14617),gap(20),
CO   complement(AAHY01032964.1:1..6161),gap(821),
CO   complement(AAHY01032965.1:1..1455),gap(30),
CO   complement(AAHY01032966.1:1..4285),gap(434),AAHY01032967.1:1..23187,
CO   gap(654),complement(AAHY01032968.1:1..9411),gap(63),AAHY01032969.1:1..5004,
CO   gap(190),complement(AAHY01032970.1:1..23364),gap(20),
CO   complement(AAHY01032971.1:1..32267),gap(132),
CO   complement(AAHY01032972.1:1..15718),gap(755),
CO   complement(AAHY01032973.1:1..9469),gap(186),
CO   complement(AAHY01032974.1:1..2992),gap(20),
CO   complement(AAHY01032975.1:1..20922),gap(20),
CO   complement(AAHY01032976.1:1..22162),gap(20),
CO   complement(AAHY01032977.1:1..4312),gap(20),AAHY01032978.1:1..87435,gap(70),
CO   AAHY01032979.1:1..2417,gap(20),AAHY01032980.1:1..29511,gap(3111),
CO   complement(AAHY01032981.1:1..7535),gap(287),
CO   complement(AAHY01032982.1:1..3206),gap(138),
CO   complement(AAHY01032983.1:1..16444),gap(276),
CO   complement(AAHY01032984.1:1..6324),gap(20),
CO   complement(AAHY01032985.1:1..49013),gap(20),
CO   complement(AAHY01032986.1:1..2872),gap(20),
CO   complement(AAHY01032987.1:1..558),gap(126),AAHY01032988.1:1..8234,gap(90),
CO   AAHY01032989.1:1..63301,gap(93),complement(AAHY01032990.1:1..9471),
CO   gap(292),complement(AAHY01032991.1:1..21429),gap(1077),
CO   complement(AAHY01032992.1:1..21077),gap(20),
CO   complement(AAHY01032993.1:1..4459),gap(20),
CO   complement(AAHY01032994.1:1..24163),gap(20),
CO   complement(AAHY01032995.1:1..26904),gap(7079),AAHY01032996.1:1..12115,
CO   gap(61),AAHY01032997.1:1..13341,gap(696),AAHY01032998.1:1..4249,gap(638),
CO   AAHY01032999.1:1..21022,gap(291),AAHY01033000.1:1..39194,gap(20),
CO   AAHY01033001.1:1..5156,gap(218),AAHY01033002.1:1..5483,gap(20),
CO   AAHY01033003.1:1..41088,gap(20),AAHY01033004.1:1..9672,gap(103),
CO   AAHY01033005.1:1..78397,gap(623),complement(AAHY01033006.1:1..1273),
CO   gap(20),AAHY01033007.1:1..654,gap(2911),complement(AAHY01033008.1:1..7382),
CO   gap(20),complement(AAHY01033009.1:1..1027),gap(20),
CO   complement(AAHY01033010.1:1..1373),gap(20),AAHY01033011.1:1..4604,gap(70),
CO   AAHY01033012.1:1..2943,gap(20),AAHY01033013.1:1..35466,gap(20),
CO   AAHY01033014.1:1..5823,gap(20),AAHY01033015.1:1..9702,gap(20),
CO   complement(AAHY01033016.1:1..1217),gap(188),AAHY01033017.1:1..41376,
CO   gap(1047),AAHY01033018.1:1..35442,gap(101),AAHY01033019.1:1..17850,gap(20),
CO   AAHY01033020.1:1..6448,gap(20),AAHY01033021.1:1..59852,gap(20),
CO   AAHY01033022.1:1..16905,gap(20),AAHY01033023.1:1..13101,gap(758),
CO   AAHY01033024.1:1..36423,gap(153),AAHY01033025.1:1..18913,gap(827),
CO   AAHY01033026.1:1..3723,gap(1180),complement(AAHY01033027.1:1..1177),
CO   gap(343),AAHY01033028.1:1..1617)
//


spacer
spacer