
ID   CH466594; SV 1; linear; genomic DNA; CON; MUS; 8498302 BP.
AC   CH466594;
PR   Project:PRJNA11785;
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
DE   Mus musculus 232000009773910 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-8498302
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-8498302
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; 74184317c5350a5c32a811abd3026f49.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000212.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000006442; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023153; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023286; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024793; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028940; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028963; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028967; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028972; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028976; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028992; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028996; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029001; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029016; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029029; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029049; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029050; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029053; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029063; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029064; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029068; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029075; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000029076; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035692; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039577; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039662; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039759; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039936; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041616; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041954; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047719; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047875; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048001; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055401; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059040; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063077; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063524; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073680; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073700; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073705; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078485; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078490; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000084845; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029107; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029113; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029114; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029115; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029116; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029119; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029120; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029123; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029127; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029129; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029135; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029137; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029139; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029140; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029144; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029149; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029150; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029152; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029153; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029156; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029158; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029160; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029165; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029167; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029169; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029172; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029174; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029178; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029192; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029203; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029206; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029208; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029211; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029215; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029216; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029224; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029225; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029227; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029230; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029233; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029242; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029243; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029244; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029248; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029252; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029072; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029078; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029079; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029080; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029081; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029084; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029085; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029088; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029092; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029094; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029100; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029102; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029104; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029105; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029109; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029114; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029115; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029117; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029118; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029121; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029123; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029125; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029130; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029132; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029134; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029137; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029139; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029143; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029157; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029168; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029171; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029173; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029176; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029180; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029181; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029189; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029190; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029192; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029195; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029198; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029207; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029208; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029209; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029213; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0029217; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029026; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029027; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029028; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029029; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029032; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029033; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029036; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029040; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029042; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029048; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029050; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029053; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029057; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029062; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029063; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029065; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029066; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029069; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029071; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029073; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029078; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029080; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029082; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029085; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029087; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029091; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029105; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029116; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029119; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029121; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029124; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029128; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029129; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029137; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029138; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029140; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029143; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029146; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029152; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029155; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029156; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029157; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029161; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0029165; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029088; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029094; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029095; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029096; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029097; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029100; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029101; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029104; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029108; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029116; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029118; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029120; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029121; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029125; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029130; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029131; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029133; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029134; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029137; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029139; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029141; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029146; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029148; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029150; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029153; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029155; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029159; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029173; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029184; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029187; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029189; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029192; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029196; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029197; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029205; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029206; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029208; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029211; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029214; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029223; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029224; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029225; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029229; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029233; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028809; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028815; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028816; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028817; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028818; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028821; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028822; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028825; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028829; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028831; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028837; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028839; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028841; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028842; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028846; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028851; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028852; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028854; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028855; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028858; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028860; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028862; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028867; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028869; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028871; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028874; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028876; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028880; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028894; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028905; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028908; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028910; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028913; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028917; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028918; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028926; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028927; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028929; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028932; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028935; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028941; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028944; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028945; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028946; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028950; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029537; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029543; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029544; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029545; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029546; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029549; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029550; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029553; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029557; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029565; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029567; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029569; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029570; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029574; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029579; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029580; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029582; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029586; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029588; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029590; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029595; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029597; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029599; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029602; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029604; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029608; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029622; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029633; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029636; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029638; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029641; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029645; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029646; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029654; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029655; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029657; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029660; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029663; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029669; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029672; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029673; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029674; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029678; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029682; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028222; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028228; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028229; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028230; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028231; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028234; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028235; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028238; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028242; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028244; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028250; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028252; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028254; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028255; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028264; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028265; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028267; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028268; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028271; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028273; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028275; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028280; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028282; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028284; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028287; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028289; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028307; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028318; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028321; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028323; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028324; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028326; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028330; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028331; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028338; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028339; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028341; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028344; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028347; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028356; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028357; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028358; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028362; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028366; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028771; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028777; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028778; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028779; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028780; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028783; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028784; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028787; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028791; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028793; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028799; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028801; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028803; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028804; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028808; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028813; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028816; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028820; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028822; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028824; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028829; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028831; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028833; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028836; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028838; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028842; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028856; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028867; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028870; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028872; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028875; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028879; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028880; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028888; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028889; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028891; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028894; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028897; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028906; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028907; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028908; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028912; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0028916; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028919; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028925; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028926; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028927; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028928; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028931; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028932; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028936; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028940; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028942; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028948; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028950; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028952; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028953; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028957; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028962; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028963; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028965; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028966; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028969; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028971; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028973; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028978; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028980; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028982; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028985; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028987; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0028991; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029005; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029016; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029019; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029021; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029024; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029028; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029029; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029037; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029038; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029040; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029043; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029046; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029052; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029055; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029056; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029057; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029061; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0029065; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028884; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028890; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028891; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028892; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028893; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028896; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028897; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028900; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028904; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028906; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028912; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028914; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028916; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028917; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028921; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028926; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028927; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028929; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028930; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028933; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028935; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028937; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028942; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028944; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028946; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028949; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028951; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028955; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028969; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028980; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028983; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028985; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028988; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028992; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0028993; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029000; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029001; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029003; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029006; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029009; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029015; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029018; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029019; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029020; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029024; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0029028; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029010; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029016; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029017; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029018; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029019; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029022; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029023; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029026; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029030; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029032; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029038; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029040; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029042; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029043; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029052; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029053; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029055; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029061; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029063; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029068; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029070; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029072; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029075; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029077; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029081; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029095; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029106; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029109; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029111; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029114; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029118; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029119; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029127; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029130; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029133; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029136; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029142; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029145; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029146; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029147; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029151; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0029155; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028911; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028917; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028918; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028919; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028920; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028923; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028924; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028927; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028931; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028933; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028939; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028941; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028943; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028944; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028948; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028953; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028954; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028956; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028957; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028960; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028962; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028964; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028969; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028971; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028973; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028976; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028978; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028982; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028996; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029007; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029010; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029012; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029015; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029019; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029020; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029027; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029028; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029030; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029033; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029036; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029042; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029045; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029046; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029047; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029051; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029055; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029569; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029575; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029576; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029577; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029578; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029581; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029582; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029585; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029589; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029591; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029597; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029599; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029601; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029602; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029606; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029611; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029612; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029614; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029615; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029618; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029620; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029622; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029627; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029629; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029631; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029634; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029636; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029640; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029654; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029665; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029668; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029670; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029673; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029677; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029678; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029686; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029687; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029689; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029692; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029695; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029701; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029704; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029705; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029706; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029714; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027942; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027948; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027949; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027950; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027951; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027954; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027955; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027958; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027962; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027964; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027970; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027972; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027974; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027975; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027979; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027984; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027985; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027987; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027991; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027993; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027995; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028000; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028002; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028004; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028007; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028009; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028018; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028027; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028038; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028041; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028043; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028044; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028046; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028047; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028050; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028051; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028059; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028060; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028062; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028065; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028068; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028074; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028077; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028078; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028086; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028302; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028308; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028309; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028311; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028314; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028315; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028318; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028322; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028324; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028330; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028332; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028334; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028335; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028339; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028344; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028345; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028347; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028348; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028351; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028353; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028355; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028360; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028362; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028364; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028367; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028369; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028373; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028398; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028401; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028403; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028406; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028410; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028411; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028418; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028419; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028421; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028424; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028427; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028433; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028436; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028437; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028438; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028442; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028446; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000006611; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030848; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030865; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030886; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030903; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030917; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030940; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030944; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030952; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036680; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049621; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069604; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073600; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080926; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094451; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097788; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103180; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105569; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105578; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105579; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105689; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105696; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123952; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000139685; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167160; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168552; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172710; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176637; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189048; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069173; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069198; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069203; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069210; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069219; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069227; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069241; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069256; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069263; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069309; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069320; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069343; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069346; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069360; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069395; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069396; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069402; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069406; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069428; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069441; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069451; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069484; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069488; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069497; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069510; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069533; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069546; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069638; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069715; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069723; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069744; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069771; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069780; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069818; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069821; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069830; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069838; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069857; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069901; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069907; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069910; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069939; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069944; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0069237; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069262; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069263; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069268; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069273; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069283; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069291; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069305; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069320; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069327; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069372; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069383; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069407; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069409; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069424; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069459; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069460; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069466; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069470; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069492; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069505; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069515; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069548; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069552; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069561; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069574; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069597; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069610; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069702; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069759; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069781; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069810; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069837; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069846; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069884; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069887; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069897; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069906; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069925; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069976; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069982; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0069985; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070014; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0070019; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0069140; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069164; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069165; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069170; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069177; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069187; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069195; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069209; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069226; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069279; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069290; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069314; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069316; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069331; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069366; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069367; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069373; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069377; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069399; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069412; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069422; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069455; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069459; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069468; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069481; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069504; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069517; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069610; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069667; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069688; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069696; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069717; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069745; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069754; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069792; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069795; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069805; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069814; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069833; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069868; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069883; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069889; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069892; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069921; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0069926; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069153; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069177; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069178; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069183; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069190; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069200; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069208; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069222; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069237; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069244; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069290; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069301; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069325; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069328; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069344; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069379; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069380; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069386; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069390; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069411; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069425; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069435; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069468; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069472; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069481; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069494; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069517; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069530; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069622; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069679; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069700; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069708; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069729; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069757; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069766; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069804; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069807; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069817; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069826; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069845; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069897; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069903; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069906; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069935; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069940; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068822; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068846; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068847; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068852; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068859; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068869; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068877; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068891; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068906; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068913; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068950; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068985; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068987; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069001; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069036; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069037; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069043; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069047; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069068; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069081; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069091; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069124; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069128; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069137; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069150; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069173; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069186; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069280; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069336; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069357; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069365; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069387; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069424; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069462; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069465; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069475; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069484; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069503; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069538; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069549; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069555; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069558; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069587; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069649; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069673; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069674; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069679; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069686; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069696; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069704; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069718; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069733; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069740; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069786; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069796; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069819; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069821; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069836; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069871; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069872; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069878; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069903; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069916; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069926; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069959; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069963; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069972; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069985; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070008; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070021; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070111; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070166; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070187; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070195; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070216; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070242; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070251; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070289; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070292; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070302; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070311; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070329; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070364; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070373; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070379; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070382; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070411; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0070416; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069287; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069311; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069312; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069317; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069324; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069334; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069342; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069355; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069371; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069381; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069429; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069439; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069464; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069467; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069481; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069517; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069518; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069524; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069528; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069554; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069568; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069578; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069613; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069617; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069628; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069645; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069673; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069788; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069847; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069868; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069877; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069885; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069898; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069925; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069934; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069976; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069979; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069993; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070002; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070024; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070077; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070084; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070087; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070116; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0070121; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0068762; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068786; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068787; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068792; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068799; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068809; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068817; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068831; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068846; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068853; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068896; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068907; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068929; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068932; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068947; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068982; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068983; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0068989; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069009; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069022; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069032; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069065; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069069; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069078; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069091; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069114; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069127; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069219; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069274; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069295; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069303; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069324; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069352; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069361; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069399; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069402; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069412; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069421; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069440; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069484; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069490; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069493; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069522; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0069527; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0068897; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068921; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068922; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068927; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068934; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068944; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068952; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068967; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068982; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0068989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069034; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069045; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069069; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069071; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069085; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069120; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069121; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069127; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069131; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069147; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069160; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069170; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069203; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069207; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069216; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069229; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069252; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069265; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069412; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069433; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069441; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069462; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069489; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069498; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069536; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069539; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069549; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069558; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069577; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069612; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069627; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069633; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069636; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069664; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0069669; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0068798; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068822; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068823; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068828; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068835; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068845; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068853; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068867; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068882; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068935; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068945; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068969; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068972; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0068986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069021; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069022; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069028; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069032; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069055; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069068; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069078; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069111; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069115; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069124; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069137; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069160; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069173; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069266; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069321; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069342; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069350; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069371; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069399; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069408; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069445; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069448; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069458; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069467; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069487; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069522; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069539; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069545; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069548; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069576; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0069581; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0068983; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069007; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069008; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069013; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069021; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069031; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069039; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069053; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069069; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069076; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069108; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069119; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069142; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069144; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069160; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069195; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069196; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069202; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069226; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069239; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069282; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069286; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069295; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069308; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069331; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069344; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069436; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069493; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069514; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069522; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069543; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069571; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069580; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069618; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069629; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069638; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069656; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069691; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069702; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069708; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069711; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069740; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0069745; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068815; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068839; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068840; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068845; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068852; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068862; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068870; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068884; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068899; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068906; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068952; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068963; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068987; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068990; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069005; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069040; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069041; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069047; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069051; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069073; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069086; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069096; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069128; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069141; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069154; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069177; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069190; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069285; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069340; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069361; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069369; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069390; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069418; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069427; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069464; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069467; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069478; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069487; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069506; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069541; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069556; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069562; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069565; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069594; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069599; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069833; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069857; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069858; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069870; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069880; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069888; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069902; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069917; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069924; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069970; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069980; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070004; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070007; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070022; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070057; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070058; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070064; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070068; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070091; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070104; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070114; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070147; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070151; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070160; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070196; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070209; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070301; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070355; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070376; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070384; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070406; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070434; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070444; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070482; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070485; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070495; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070503; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070522; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070557; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070572; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070578; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070581; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070610; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070615; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068779; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068804; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068805; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068810; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068817; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068827; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068835; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068850; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068867; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068877; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068912; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068923; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068948; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068950; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068963; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068999; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069000; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069006; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069033; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069047; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069058; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069092; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069096; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069107; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069122; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069149; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069207; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069261; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069316; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069346; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069355; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069369; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069379; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069398; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069407; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069450; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069453; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069475; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069496; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069532; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069546; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069553; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0069590; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0067987; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068011; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068012; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068024; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068034; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068042; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068055; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068070; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068077; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068118; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068128; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068151; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068154; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068167; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068202; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068203; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068209; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068213; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068235; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068248; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068258; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068291; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068295; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068304; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068317; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068340; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068353; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068500; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068521; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068529; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068550; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068578; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068587; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068624; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068627; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068637; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068645; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068663; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068698; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068715; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068721; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068724; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068752; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068757; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..8498302
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    18908..18927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25320..26623
FT                   /estimated_length=1304
FT                   /gap_type="unknown"
FT   assembly_gap    27834..27853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31373..31556
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    32629..32648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    34849..34868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    41081..41647
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    42958..42977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    43666..44378
FT                   /estimated_length=713
FT                   /gap_type="unknown"
FT   assembly_gap    45343..45713
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    47532..47551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    49203..49222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    50675..50694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(51602..52104)
FT                   /pseudo
FT                   /locus_tag="mCG_133672"
FT                   /note="gene_id=mCG133672.1"
FT   mRNA            complement(51602..52104)
FT                   /pseudo
FT                   /locus_tag="mCG_133672"
FT                   /note="gene_id=mCG133672.1 transcript_id=mCT135042.1
FT                   created on 26-DEC-2002"
FT   assembly_gap    55749..55768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    56810..56829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(60491..>63559)
FT                   /gene="MGC67181"
FT                   /locus_tag="mCG_133680"
FT                   /note="gene_id=mCG133680.1"
FT   mRNA            complement(join(60491..61724,63173..63233,63433..>63559))
FT                   /gene="MGC67181"
FT                   /locus_tag="mCG_133680"
FT                   /product="zinc finger-like protein"
FT                   /note="gene_id=mCG133680.1 transcript_id=mCT135050.1
FT                   created on 26-DEC-2002"
FT   CDS             complement(join(60509..61724,63173..63233,63433..>63559))
FT                   /codon_start=1
FT                   /gene="MGC67181"
FT                   /locus_tag="mCG_133680"
FT                   /product="zinc finger-like protein"
FT                   /note="gene_id=mCG133680.1 transcript_id=mCT135050.1
FT                   protein_id=mCP76897.1"
FT                   /protein_id="EDL14781.1"
FT                   THTGEKHFE"
FT   assembly_gap    69137..69653
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    71776..71843
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    73998..74017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    75249..76009
FT                   /estimated_length=761
FT                   /gap_type="unknown"
FT   assembly_gap    80856..82123
FT                   /estimated_length=1268
FT                   /gap_type="unknown"
FT   assembly_gap    83539..86603
FT                   /estimated_length=3065
FT                   /gap_type="unknown"
FT   assembly_gap    87844..87863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    90525..91791
FT                   /estimated_length=1267
FT                   /gap_type="unknown"
FT   assembly_gap    92759..92992
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    94482..98169
FT                   /estimated_length=3688
FT                   /gap_type="unknown"
FT   gene            complement(<98226..109020)
FT                   /locus_tag="mCG_11728"
FT                   /note="gene_id=mCG11728.2"
FT   mRNA            complement(join(<98226..98297,98566..98703,102522..102618,
FT                   102714..102843,103173..103225,103304..103412,
FT                   105660..105741,106126..106485,106709..106893,
FT                   108842..109020))
FT                   /locus_tag="mCG_11728"
FT                   /product="mCG11728, transcript variant mCT11924"
FT                   /note="gene_id=mCG11728.2 transcript_id=mCT11924.2 created
FT                   on 20-NOV-2002"
FT   CDS             complement(join(98226..98297,98566..98703,102522..102618,
FT                   102714..102843,103173..103225,103304..103412,
FT                   105660..105741,106126..106485,106709..106831))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11728"
FT                   /product="mCG11728, isoform CRA_a"
FT                   /note="gene_id=mCG11728.2 transcript_id=mCT11924.2
FT                   protein_id=mCP19369.2 isoform=CRA_a"
FT                   /db_xref="GOA:C0KL25"
FT                   /db_xref="InterPro:IPR031466"
FT                   /db_xref="MGI:MGI:106506"
FT                   /db_xref="UniProtKB/TrEMBL:C0KL25"
FT                   /protein_id="EDL14782.1"
FT   assembly_gap    99341..99360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    100170..100427
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   mRNA            complement(join(101447..101753,102023..102075,
FT                   102522..102618,102714..102843,103173..103225,
FT                   103304..103412,105660..105741,106126..106485,
FT                   106709..106893,108842..109020))
FT                   /locus_tag="mCG_11728"
FT                   /product="mCG11728, transcript variant mCT176126"
FT                   /note="gene_id=mCG11728.2 transcript_id=mCT176126.0 created
FT                   on 20-NOV-2002"
FT   CDS             complement(join(101618..101753,102023..102075,
FT                   102522..102618,102714..102843,103173..103225,
FT                   103304..103412,105660..105741,106126..106485,
FT                   106709..106831))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11728"
FT                   /product="mCG11728, isoform CRA_b"
FT                   /note="gene_id=mCG11728.2 transcript_id=mCT176126.0
FT                   protein_id=mCP99048.0 isoform=CRA_b"
FT                   /protein_id="EDL14783.1"
FT   assembly_gap    102076..102126
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    105004..105229
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            <109452..>110699
FT                   /locus_tag="mCG_133676"
FT                   /note="gene_id=mCG133676.0"
FT   mRNA            <109452..>110699
FT                   /locus_tag="mCG_133676"
FT                   /product="mCG133676"
FT                   /note="gene_id=mCG133676.0 transcript_id=mCT135046.0
FT                   created on 20-NOV-2002"
FT   CDS             109452..>110699
FT                   /codon_start=1
FT                   /locus_tag="mCG_133676"
FT                   /product="mCG133676"
FT                   /note="gene_id=mCG133676.0 transcript_id=mCT135046.0
FT                   protein_id=mCP76752.0"
FT                   /protein_id="EDL14784.1"
FT                   ETWKSFVFSLLCIKDIT"
FT   assembly_gap    110715..111718
FT                   /estimated_length=1004
FT                   /gap_type="unknown"
FT   assembly_gap    113938..116193
FT                   /estimated_length=2256
FT                   /gap_type="unknown"
FT   gene            complement(116194..148891)
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /note="gene_id=mCG11730.2"
FT   mRNA            complement(join(116194..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147116..147198,147543..147685,148844..148891))
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, transcript variant mCT11928"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT11928.2 created
FT                   on 20-NOV-2002"
FT   mRNA            complement(join(116194..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147543..147685,148844..>148877))
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, transcript variant mCT190891"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT190891.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(116299..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147543..147685,148636..>148836))
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, transcript variant mCT190890"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT190890.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(117676..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147543..>147595))
FT                   /codon_start=1
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, isoform CRA_b"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT190890.0
FT                   protein_id=mCP111807.0 isoform=CRA_b"
FT                   /protein_id="EDL14786.1"
FT   CDS             complement(join(117676..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142827,
FT                   147543..>147595))
FT                   /codon_start=1
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, isoform CRA_b"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT190891.0
FT                   protein_id=mCP111808.0 isoform=CRA_b"
FT                   /protein_id="EDL14787.1"
FT   CDS             complement(join(117676..117745,119238..119372,
FT                   120966..121162,122249..122404,123982..124202,
FT                   124857..124959,125194..125298,125603..125729,
FT                   127422..127543,127650..127717,128240..128393,
FT                   129181..129288,129390..129498,132464..132588,
FT                   134402..134564,138747..138882,142649..142823))
FT                   /codon_start=1
FT                   /gene="Mfn2"
FT                   /locus_tag="mCG_11730"
FT                   /product="mitofusin 2, isoform CRA_a"
FT                   /note="gene_id=mCG11730.2 transcript_id=mCT11928.2
FT                   protein_id=mCP19376.2 isoform=CRA_a"
FT                   /protein_id="EDL14785.1"
FT                   QPSR"
FT   assembly_gap    130779..130798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    132245..132264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    133953..133972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(153900..180543)
FT                   /gene="Plod1"
FT                   /locus_tag="mCG_11727"
FT                   /note="gene_id=mCG11727.2"
FT   mRNA            complement(join(153900..155017,157159..157284,
FT                   159737..159883,161245..161349,162075..162140,
FT                   162721..162834,164110..164251,164935..165060,
FT                   165326..165430,167052..167173,169406..169537,
FT                   170036..170137,170912..171009,172259..172322,
FT                   173341..173453,174923..175086,175428..175564,
FT                   176532..176623,180406..180543))
FT                   /gene="Plod1"
FT                   /locus_tag="mCG_11727"
FT                   /product="procollagen-lysine, 2-oxoglutarate 5-dioxygenase
FT                   1"
FT                   /note="gene_id=mCG11727.2 transcript_id=mCT11923.2 created
FT                   on 21-NOV-2002"
FT   CDS             complement(join(154862..155017,157159..157284,
FT                   159737..159883,161245..161349,162075..162140,
FT                   162721..162834,164110..164251,164935..165060,
FT                   165326..165430,167052..167173,169406..169537,
FT                   170036..170137,170912..171009,172259..172322,
FT                   173341..173453,174923..175086,175428..175564,
FT                   176532..176623,180406..180481))
FT                   /codon_start=1
FT                   /gene="Plod1"
FT                   /locus_tag="mCG_11727"
FT                   /product="procollagen-lysine, 2-oxoglutarate 5-dioxygenase
FT                   1"
FT                   /note="gene_id=mCG11727.2 transcript_id=mCT11923.2
FT                   protein_id=mCP19360.2"
FT                   /protein_id="EDL14788.1"
FT   assembly_gap    172022..172087
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    184573..185041
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   gene            <185042..191288
FT                   /gene="2510039O18Rik"
FT                   /locus_tag="mCG_11733"
FT                   /note="gene_id=mCG11733.2"
FT   mRNA            join(<185042..185963,188582..189435,190575..191288)
FT                   /gene="2510039O18Rik"
FT                   /locus_tag="mCG_11733"
FT                   /product="RIKEN cDNA 2510039O18"
FT                   /note="gene_id=mCG11733.2 transcript_id=mCT11929.2 created
FT                   on 21-NOV-2002"
FT   CDS             join(<185042..185963,188582..189435,190575..190592)
FT                   /codon_start=1
FT                   /gene="2510039O18Rik"
FT                   /locus_tag="mCG_11733"
FT                   /product="RIKEN cDNA 2510039O18"
FT                   /note="gene_id=mCG11733.2 transcript_id=mCT11929.2
FT                   protein_id=mCP19395.2"
FT                   /protein_id="EDL14789.1"
FT   assembly_gap    186281..186949
FT                   /estimated_length=669
FT                   /gap_type="unknown"
FT   assembly_gap    194816..195561
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   gene            229695..230995
FT                   /gene="Nppb"
FT                   /locus_tag="mCG_11731"
FT                   /note="gene_id=mCG11731.2"
FT   mRNA            join(229695..229898,230093..230315,230759..230995)
FT                   /gene="Nppb"
FT                   /locus_tag="mCG_11731"
FT                   /product="natriuretic peptide precursor type B"
FT                   /note="gene_id=mCG11731.2 transcript_id=mCT11925.2 created
FT                   on 21-NOV-2002"
FT   CDS             join(229773..229898,230093..230315,230759..230775)
FT                   /codon_start=1
FT                   /gene="Nppb"
FT                   /locus_tag="mCG_11731"
FT                   /product="natriuretic peptide precursor type B"
FT                   /note="gene_id=mCG11731.2 transcript_id=mCT11925.2
FT                   protein_id=mCP19391.1"
FT                   /db_xref="GOA:O55086"
FT                   /db_xref="InterPro:IPR000663"
FT                   /db_xref="InterPro:IPR002408"
FT                   /db_xref="InterPro:IPR030480"
FT                   /db_xref="UniProtKB/TrEMBL:O55086"
FT                   /protein_id="EDL14790.1"
FT                   DRIGSVSRLGCNALKLL"
FT   assembly_gap    234619..234638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    235896..235915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    238077..238096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    239504..239523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            246404..247884
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /note="gene_id=mCG11724.1"
FT   mRNA            join(246404..246712,246816..247142,247533..247884)
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /product="natriuretic peptide precursor type A, transcript
FT                   variant mCT11920"
FT                   /note="gene_id=mCG11724.1 transcript_id=mCT11920.1 created
FT                   on 26-DEC-2002"
FT   mRNA            join(246506..246712,247103..247142,247533..247780)
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /product="natriuretic peptide precursor type A, transcript
FT                   variant mCT178502"
FT                   /note="gene_id=mCG11724.1 transcript_id=mCT178502.0 created
FT                   on 26-DEC-2002"
FT   CDS             join(246593..246712,247103..247142,247533..247579)
FT                   /codon_start=1
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /product="natriuretic peptide precursor type A, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11724.1 transcript_id=mCT178502.0
FT                   protein_id=mCP101424.0 isoform=CRA_a"
FT                   /protein_id="EDL14791.1"
FT   CDS             join(246593..246712,246816..247142,247533..247544)
FT                   /codon_start=1
FT                   /gene="Nppa"
FT                   /locus_tag="mCG_11724"
FT                   /product="natriuretic peptide precursor type A, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11724.1 transcript_id=mCT11920.1
FT                   protein_id=mCP19397.2 isoform=CRA_b"
FT                   /db_xref="GOA:P05125"
FT                   /db_xref="InterPro:IPR000663"
FT                   /db_xref="InterPro:IPR002407"
FT                   /db_xref="InterPro:IPR030480"
FT                   /db_xref="MGI:MGI:97367"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05125"
FT                   /protein_id="EDL14792.1"
FT   gene            complement(251834..284779)
FT                   /gene="Clcn6"
FT                   /locus_tag="mCG_11729"
FT                   /note="gene_id=mCG11729.2"
FT   mRNA            complement(join(251834..252614,254434..254559,
FT                   254652..254759,256407..256563,256725..256882,
FT                   258370..258556,259429..259535,259620..259779,
FT                   259885..260038,260254..260380,262602..262728,
FT                   263246..263412,263653..263766,264591..264723,
FT                   265493..265551,267231..267298,269144..269270,
FT                   269886..269992,272339..272405,274360..274425,
FT                   275121..275186,283896..283955,284663..284779))
FT                   /gene="Clcn6"
FT                   /locus_tag="mCG_11729"
FT                   /product="chloride channel 6"
FT                   /note="gene_id=mCG11729.2 transcript_id=mCT11927.2 created
FT                   on 21-NOV-2002"
FT   CDS             complement(join(252534..252614,254434..254559,
FT                   254652..254759,256407..256563,256725..256882,
FT                   258370..258556,259429..259535,259620..259779,
FT                   259885..260038,260254..260380,262602..262728,
FT                   263246..263412,263653..263766,264591..264723,
FT                   265493..265551,267231..267298,269144..269270,
FT                   269886..269992,272339..272405,274360..274425,
FT                   275121..275186,283896..283955,284663..284749))
FT                   /codon_start=1
FT                   /gene="Clcn6"
FT                   /locus_tag="mCG_11729"
FT                   /product="chloride channel 6"
FT                   /note="gene_id=mCG11729.2 transcript_id=mCT11927.2
FT                   protein_id=mCP19377.0"
FT                   /db_xref="GOA:Q3UM91"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002248"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:1347049"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UM91"
FT                   /protein_id="EDL14793.1"
FT   assembly_gap    278435..279436
FT                   /estimated_length=1002
FT                   /gap_type="unknown"
FT   gene            284299..302096
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /note="gene_id=mCG11725.2"
FT   mRNA            join(284299..284506,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT176125"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176125.0 created
FT                   on 21-NOV-2002"
FT   CDS             join(284418..284506,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176125.0
FT                   protein_id=mCP99047.0 isoform=CRA_c"
FT                   /protein_id="EDL14798.1"
FT   mRNA            join(285059..285114,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT176124"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176124.0 created
FT                   on 21-NOV-2002"
FT   mRNA            join(285108..285391,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT176123"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176123.0 created
FT                   on 21-NOV-2002"
FT   mRNA            join(286792..287811,289407..289645,290427..290537,
FT                   294020..294213,297319..297569,297812..297946,
FT                   298046..298226,298461..298643,299502..299603,
FT                   300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT11921"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT11921.2 created
FT                   on 21-NOV-2002"
FT   mRNA            join(287173..287303,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..302096)
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   transcript variant mCT176122"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176122.0 created
FT                   on 21-NOV-2002"
FT   CDS             join(287194..287303,287566..287811,289407..289645,
FT                   290427..290537,294020..294213,297319..297569,
FT                   297812..297946,298046..298226,298461..298643,
FT                   299502..299603,300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176122.0
FT                   protein_id=mCP99046.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2A7F7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="MGI:MGI:106639"
FT                   /db_xref="UniProtKB/TrEMBL:A2A7F7"
FT                   /protein_id="EDL14795.1"
FT                   P"
FT   CDS             join(287579..287811,289407..289645,290427..290537,
FT                   294020..294213,297319..297569,297812..297946,
FT                   298046..298226,298461..298643,299502..299603,
FT                   300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT11921.2
FT                   protein_id=mCP19354.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WU20"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="MGI:MGI:106639"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WU20"
FT                   /protein_id="EDL14794.1"
FT   CDS             join(287579..287811,289407..289645,290427..290537,
FT                   294020..294213,297319..297569,297812..297946,
FT                   298046..298226,298461..298643,299502..299603,
FT                   300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176123.0
FT                   protein_id=mCP99045.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WU20"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="MGI:MGI:106639"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WU20"
FT                   /protein_id="EDL14796.1"
FT   CDS             join(287579..287811,289407..289645,290427..290537,
FT                   294020..294213,297319..297569,297812..297946,
FT                   298046..298226,298461..298643,299502..299603,
FT                   300873..300992,301261..301476)
FT                   /codon_start=1
FT                   /gene="Mthfr"
FT                   /locus_tag="mCG_11725"
FT                   /product="5,10-methylenetetrahydrofolate reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11725.2 transcript_id=mCT176124.0
FT                   protein_id=mCP99044.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WU20"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="MGI:MGI:106639"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WU20"
FT                   /protein_id="EDL14797.1"
FT   gene            complement(302261..303998)
FT                   /locus_tag="mCG_16670"
FT                   /note="gene_id=mCG16670.1"
FT   mRNA            complement(join(302261..302325,302904..303998))
FT                   /locus_tag="mCG_16670"
FT                   /product="mCG16670"
FT                   /note="gene_id=mCG16670.1 transcript_id=mCT12589.1 created
FT                   on 13-MAR-2003"
FT   CDS             complement(303168..303329)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16670"
FT                   /product="mCG16670"
FT                   /note="gene_id=mCG16670.1 transcript_id=mCT12589.1
FT                   protein_id=mCP19379.2"
FT                   /protein_id="EDL14799.1"
FT                   PRPVPPPG"
FT   assembly_gap    311437..311721
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   gene            complement(313778..314492)
FT                   /pseudo
FT                   /locus_tag="mCG_1027345"
FT                   /note="gene_id=mCG1027345.2"
FT   mRNA            complement(313778..314492)
FT                   /pseudo
FT                   /locus_tag="mCG_1027345"
FT                   /note="gene_id=mCG1027345.2 transcript_id=mCT145049.2
FT                   created on 02-JUL-2003"
FT   assembly_gap    315849..316225
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   gene            complement(325895..333976)
FT                   /gene="Agtrap"
FT                   /locus_tag="mCG_133678"
FT                   /note="gene_id=mCG133678.1"
FT   mRNA            complement(join(325895..326646,327605..327800,
FT                   328313..328418,329920..329954,333879..333976))
FT                   /gene="Agtrap"
FT                   /locus_tag="mCG_133678"
FT                   /product="angiotensin II, type I receptor-associated
FT                   protein"
FT                   /note="gene_id=mCG133678.1 transcript_id=mCT135048.1
FT                   created on 21-NOV-2002"
FT   CDS             complement(join(326525..326646,327605..327800,
FT                   328313..328418,329920..329954,333879..333905))
FT                   /codon_start=1
FT                   /gene="Agtrap"
FT                   /locus_tag="mCG_133678"
FT                   /product="angiotensin II, type I receptor-associated
FT                   protein"
FT                   /note="gene_id=mCG133678.1 transcript_id=mCT135048.1
FT                   protein_id=mCP76881.0"
FT                   /db_xref="GOA:Q9WVK0"
FT                   /db_xref="InterPro:IPR009436"
FT                   /db_xref="MGI:MGI:1339977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVK0"
FT                   /protein_id="EDL14800.1"
FT   assembly_gap    328438..328534
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    336433..337117
FT                   /estimated_length=685
FT                   /gap_type="unknown"
FT   assembly_gap    340568..343338
FT                   /estimated_length=2771
FT                   /gap_type="unknown"
FT   gene            complement(343340..371659)
FT                   /gene="2610109H07Rik"
FT                   /locus_tag="mCG_133693"
FT                   /note="gene_id=mCG133693.1"
FT   mRNA            complement(join(343340..343593,348939..349028,
FT                   350608..350697,351031..351142,353697..353890,
FT                   356541..356982,371539..371659))
FT                   /gene="2610109H07Rik"
FT                   /locus_tag="mCG_133693"
FT                   /product="RIKEN cDNA 2610109H07"
FT                   /note="gene_id=mCG133693.1 transcript_id=mCT135063.1
FT                   created on 26-DEC-2002"
FT   CDS             complement(join(343481..343593,348939..349028,
FT                   350608..350697,351031..351142,353697..353890,
FT                   356541..356973))
FT                   /codon_start=1
FT                   /gene="2610109H07Rik"
FT                   /locus_tag="mCG_133693"
FT                   /product="RIKEN cDNA 2610109H07"
FT                   /note="gene_id=mCG133693.1 transcript_id=mCT135063.1
FT                   protein_id=mCP76844.1"
FT                   /protein_id="EDL14801.1"
FT                   INI"
FT   assembly_gap    371681..371862
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   gene            380552..386417
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /note="gene_id=mCG16659.2"
FT   mRNA            join(380552..380738,381503..381552,381633..381751,
FT                   383702..383773,384258..384358,384980..385081,
FT                   385370..385443,385842..385912,386088..386405)
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /product="MAD2 mitotic arrest deficient-like 2 (yeast),
FT                   transcript variant mCT176349"
FT                   /note="gene_id=mCG16659.2 transcript_id=mCT176349.0 created
FT                   on 26-NOV-2002"
FT   mRNA            join(381205..381552,381633..381751,383702..383773,
FT                   384258..384358,384980..385074,385370..385443,
FT                   385820..385912,386088..386417)
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /product="MAD2 mitotic arrest deficient-like 2 (yeast),
FT                   transcript variant mCT12924"
FT                   /note="gene_id=mCG16659.2 transcript_id=mCT12924.1 created
FT                   on 26-NOV-2002"
FT   CDS             join(381513..381552,381633..381751,383702..383773,
FT                   384258..384358,384980..385081,385370..385443,
FT                   385842..385912,386088..386129)
FT                   /codon_start=1
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /product="MAD2 mitotic arrest deficient-like 2 (yeast),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16659.2 transcript_id=mCT176349.0
FT                   protein_id=mCP99271.0 isoform=CRA_b"
FT                   /protein_id="EDL14803.1"
FT   CDS             join(381513..381552,381633..381751,383702..383773,
FT                   384258..384358,384980..385074,385370..385443,
FT                   385820..385912,386088..386129)
FT                   /codon_start=1
FT                   /gene="Mad2l2"
FT                   /locus_tag="mCG_16659"
FT                   /product="MAD2 mitotic arrest deficient-like 2 (yeast),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16659.2 transcript_id=mCT12924.1
FT                   protein_id=mCP19374.2 isoform=CRA_a"
FT                   /protein_id="EDL14802.1"
FT   gene            complement(386492..392845)
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /note="gene_id=mCG16668.2"
FT   mRNA            complement(join(386492..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390381,
FT                   392742..392845))
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, transcript variant
FT                   mCT176352"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT176352.0 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(386503..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390381,
FT                   391805..391887,392742..392823))
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, transcript variant
FT                   mCT176353"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT176353.0 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(386504..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390381,
FT                   392671..>392720))
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, transcript variant
FT                   mCT190866"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT190866.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(386504..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390381,
FT                   392343..392553))
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, transcript variant
FT                   mCT12587"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT12587.1 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(386632..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..>390367))
FT                   /codon_start=1
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, isoform CRA_b"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT190866.0
FT                   protein_id=mCP111820.0 isoform=CRA_b"
FT                   /protein_id="EDL14806.1"
FT   CDS             complement(join(386632..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390352))
FT                   /codon_start=1
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, isoform CRA_a"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT12587.1
FT                   protein_id=mCP19390.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9QZN4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354743"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN4"
FT                   /protein_id="EDL14804.1"
FT                   EGFFWQGLWQRLRR"
FT   CDS             complement(join(386632..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390352))
FT                   /codon_start=1
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, isoform CRA_a"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT176352.0
FT                   protein_id=mCP99275.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9QZN4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354743"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN4"
FT                   /protein_id="EDL14805.1"
FT                   EGFFWQGLWQRLRR"
FT   CDS             complement(join(386632..386901,387037..387172,
FT                   387556..387651,388011..388137,390094..390352))
FT                   /codon_start=1
FT                   /gene="Fbxo6b"
FT                   /locus_tag="mCG_16668"
FT                   /product="F-box only protein 6b, isoform CRA_a"
FT                   /note="gene_id=mCG16668.2 transcript_id=mCT176353.0
FT                   protein_id=mCP99274.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9QZN4"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354743"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZN4"
FT                   /protein_id="EDL14807.1"
FT                   EGFFWQGLWQRLRR"
FT   gene            complement(393529..399756)
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /note="gene_id=mCG48975.2"
FT   mRNA            complement(join(393529..394373,396876..397011,
FT                   397125..397220,397310..397436,399467..399755))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT49158"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT49158.1 created
FT                   on 21-FEB-2003"
FT   mRNA            complement(join(393705..394373,396876..397011,
FT                   397125..397220,397387..397436,399467..399754))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT177688"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT177688.0 created
FT                   on 21-FEB-2003"
FT   mRNA            complement(join(394123..394373,396876..397011,
FT                   397339..397436,399467..399754))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT177689"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT177689.0 created
FT                   on 21-FEB-2003"
FT   CDS             complement(join(394198..394373,396876..397011,
FT                   397339..397436,399467..399731))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_e"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT177689.0
FT                   protein_id=mCP100610.0 isoform=CRA_e"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354744"
FT                   /db_xref="UniProtKB/TrEMBL:A2A7H6"
FT                   /protein_id="EDL14812.1"
FT                   EP"
FT   CDS             complement(join(394230..394373,396876..397011,
FT                   397125..397220,397310..397436,399467..399731))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_d"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT49158.1
FT                   protein_id=mCP39813.2 isoform=CRA_d"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354744"
FT                   /db_xref="UniProtKB/TrEMBL:A2A7H5"
FT                   /protein_id="EDL14811.1"
FT   CDS             complement(join(394230..394373,396876..397011,
FT                   397125..397220,397387..397406))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_a"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT177688.0
FT                   protein_id=mCP100611.0 isoform=CRA_a"
FT                   /protein_id="EDL14808.1"
FT   mRNA            complement(join(394995..395162,396876..397011,
FT                   397125..397220,397310..397436,399467..399756))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT180685"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT180685.0 created
FT                   on 21-FEB-2003"
FT   CDS             complement(join(395151..395162,396876..397011,
FT                   397125..397220,397310..397436,399467..399731))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_c"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT180685.0
FT                   protein_id=mCP103607.0 isoform=CRA_c"
FT                   /protein_id="EDL14810.1"
FT   mRNA            complement(join(396227..397011,397125..397220,
FT                   397310..397436,399467..399756))
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, transcript variant mCT180684"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT180684.0 created
FT                   on 21-FEB-2003"
FT   CDS             complement(join(396669..397011,397125..397220,
FT                   397310..397436,399467..399731))
FT                   /codon_start=1
FT                   /gene="Fbxo44"
FT                   /locus_tag="mCG_48975"
FT                   /product="F-box protein 44, isoform CRA_b"
FT                   /note="gene_id=mCG48975.2 transcript_id=mCT180684.0
FT                   protein_id=mCP103606.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="MGI:MGI:1354744"
FT                   /db_xref="UniProtKB/TrEMBL:G3UYF5"
FT                   /protein_id="EDL14809.1"
FT   assembly_gap    398563..398822
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    400283..401356
FT                   /estimated_length=1074
FT                   /gap_type="unknown"
FT   gene            401357..407270
FT                   /gene="Fbxo2"
FT                   /locus_tag="mCG_16665"
FT                   /note="gene_id=mCG16665.2"
FT   mRNA            join(401357..401553,404915..405295,405666..405795,
FT                   405868..405963,406499..406628,406820..407270)
FT                   /gene="Fbxo2"
FT                   /locus_tag="mCG_16665"
FT                   /product="F-box only protein 2"
FT                   /note="gene_id=mCG16665.2 transcript_id=mCT12293.2 created
FT                   on 05-FEB-2003"
FT   CDS             join(401532..401553,404915..405295,405666..405795,
FT                   405868..405963,406499..406628,406820..406954)
FT                   /codon_start=1
FT                   /gene="Fbxo2"
FT                   /locus_tag="mCG_16665"
FT                   /product="F-box only protein 2"
FT                   /note="gene_id=mCG16665.2 transcript_id=mCT12293.2
FT                   protein_id=mCP19355.2"
FT                   /protein_id="EDL14813.1"
FT                   GWFGARVTNSSVWVEP"
FT   assembly_gap    407984..408003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    411414..411464
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    441203..442911
FT                   /estimated_length=1709
FT                   /gap_type="unknown"
FT   assembly_gap    450051..450070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    458615..459166
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   gene            complement(482425..529667)
FT                   /locus_tag="mCG_16661"
FT                   /note="gene_id=mCG16661.2"
FT   mRNA            complement(join(482425..483515,484621..484787,
FT                   485207..485320,485982..486141,491019..491164,
FT                   491620..491746,492498..492670,492764..492894,
FT                   494555..494739,496112..496248,496998..497111,
FT                   498667..498828,499758..499919,500098..500246,
FT                   500708..500850,502452..502588,503038..503174,
FT                   511992..512211,513064..514027,529434..529667))
FT                   /locus_tag="mCG_16661"
FT                   /product="mCG16661"
FT                   /note="gene_id=mCG16661.2 transcript_id=mCT12290.2 created
FT                   on 04-APR-2003"
FT   CDS             complement(join(483153..483515,484621..484787,
FT                   485207..485320,485982..486141,491019..491164,
FT                   491620..491746,492498..492670,492764..492894,
FT                   494555..494739,496112..496248,496998..497111,
FT                   498667..498828,499758..499919,500098..500246,
FT                   500708..500850,502452..502588,503038..503174,
FT                   511992..512211,513064..514024))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16661"
FT                   /product="mCG16661"
FT                   /note="gene_id=mCG16661.2 transcript_id=mCT12290.2
FT                   protein_id=mCP19382.2"
FT                   /protein_id="EDL14814.1"
FT                   YKIPLPSGATL"
FT   assembly_gap    498938..499077
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    501395..502061
FT                   /estimated_length=667
FT                   /gap_type="unknown"
FT   assembly_gap    519345..519473
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    544316..544335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            548274..557895
FT                   /locus_tag="mCG_1050988"
FT                   /note="gene_id=mCG1050988.0"
FT   mRNA            join(548274..548493,550246..550371,553565..553627,
FT                   557281..557895)
FT                   /locus_tag="mCG_1050988"
FT                   /product="mCG1050988"
FT                   /note="gene_id=mCG1050988.0 transcript_id=mCT194777.0
FT                   created on 27-JAN-2005"
FT   CDS             557411..557671
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050988"
FT                   /product="mCG1050988"
FT                   /note="gene_id=mCG1050988.0 transcript_id=mCT194777.0
FT                   protein_id=mCP115806.0"
FT                   /protein_id="EDL14815.1"
FT   assembly_gap    566463..566482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    568651..569700
FT                   /estimated_length=1050
FT                   /gap_type="unknown"
FT   assembly_gap    570783..570802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    578185..578212
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    580990..581232
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    588983..589098
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            complement(595276..598349)
FT                   /locus_tag="mCG_1027379"
FT                   /note="gene_id=mCG1027379.1"
FT   mRNA            complement(join(595276..595454,598299..598349))
FT                   /locus_tag="mCG_1027379"
FT                   /product="mCG1027379"
FT                   /note="gene_id=mCG1027379.1 transcript_id=mCT145083.1
FT                   created on 07-MAR-2003"
FT   CDS             complement(join(595337..595454,598299..598324))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027379"
FT                   /product="mCG1027379"
FT                   /note="gene_id=mCG1027379.1 transcript_id=mCT145083.1
FT                   protein_id=mCP76738.1"
FT                   /protein_id="EDL14816.1"
FT                   KH"
FT   assembly_gap    597658..597677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    598803..598902
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    600772..601112
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    602021..602061
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    610211..610230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    626405..626657
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    631923..631942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    641661..641680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    649052..649734
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   assembly_gap    668076..668184
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            complement(674318..684684)
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /note="gene_id=mCG16655.1"
FT   mRNA            complement(join(674318..676465,683858..684684))
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /product="UbiA prenyltransferase domain containing 1,
FT                   transcript variant mCT12922"
FT                   /note="gene_id=mCG16655.1 transcript_id=mCT12922.1 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(674465..676465,683858..684059,
FT                   684472..684654))
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /product="UbiA prenyltransferase domain containing 1,
FT                   transcript variant mCT176347"
FT                   /note="gene_id=mCG16655.1 transcript_id=mCT176347.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(675978..676465,683858..684380))
FT                   /codon_start=1
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /product="UbiA prenyltransferase domain containing 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16655.1 transcript_id=mCT12922.1
FT                   protein_id=mCP19394.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DC60"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="MGI:MGI:1918957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DC60"
FT                   /protein_id="EDL14817.1"
FT   CDS             complement(675978..676397)
FT                   /codon_start=1
FT                   /gene="Ubiad1"
FT                   /locus_tag="mCG_16655"
FT                   /product="UbiA prenyltransferase domain containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16655.1 transcript_id=mCT176347.0
FT                   protein_id=mCP99269.0 isoform=CRA_b"
FT                   /protein_id="EDL14818.1"
FT   gene            <688742..798685
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /note="gene_id=mCG16666.1"
FT   mRNA            join(688742..688822,692535..692710,693300..693408,
FT                   694030..694262,694874..695074,696307..696441,
FT                   699602..699877,699959..700067,703542..703728,
FT                   704447..704575,705058..705302,705702..705917,
FT                   706652..706857,709011..709133,709750..709839,
FT                   710129..710221,710981..711115,711331..711460,
FT                   712674..712924,721615..721701,724305..724472,
FT                   725060..725172,725376..725538,726792..726884,
FT                   727519..727669,730223..730365,732085..732247,
FT                   732371..732516,752472..752547,755522..755661,
FT                   762050..762150,765121..765236,766353..766430,
FT                   766627..766734,771111..771236,771307..771438,
FT                   774489..774604,775547..775664,777150..777398,
FT                   778001..778101,778503..778599,778916..779014,
FT                   779103..779225,779368..779550,780623..780757,
FT                   780927..781101,785095..785230,786388..786535,
FT                   787279..787401,788485..788567,790219..790291,
FT                   790642..790716,790940..791075,791785..791850,
FT                   793725..793805,794044..794124,797276..797381,
FT                   797854..798685)
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /product="FK506 binding protein 12-rapamycin associated
FT                   protein 1, transcript variant mCT12294"
FT                   /note="gene_id=mCG16666.1 transcript_id=mCT12294.1 created
FT                   on 26-NOV-2002"
FT   mRNA            join(<688742..688822,692535..692710,693300..693408,
FT                   694030..694262,694874..695074,696307..696441,
FT                   699602..699877,699959..700067,703542..703728,
FT                   704447..704575,705058..705302,705702..705917,
FT                   706652..706857,709011..709133,709750..709839,
FT                   710129..710221,710981..711115,711331..711460,
FT                   712674..712924,721615..721701,724305..724472,
FT                   725060..725172,725376..725538,726792..726884,
FT                   727519..727665,730223..730365,732085..732247,
FT                   732371..732516,752472..752547,755522..755661,
FT                   762050..762150,765121..765236,766353..766430,
FT                   766627..766734,771111..771236,771307..771438,
FT                   774489..774604,775547..775664,777150..777398,
FT                   778001..778101,778503..778599,778916..779014,
FT                   779103..779225,779368..779550,780623..780757,
FT                   780927..781101,785095..785230,786388..786535,
FT                   787279..787401,788485..788567,790219..790291,
FT                   790642..790716,790940..791075,791785..791850,
FT                   793725..793805,794044..794124,797276..797381,
FT                   797854..798685)
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /product="FK506 binding protein 12-rapamycin associated
FT                   protein 1, transcript variant mCT190862"
FT                   /note="gene_id=mCG16666.1 transcript_id=mCT190862.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<688744..688822,692535..692710,693300..693408,
FT                   694030..694262,694874..695074,696307..696441,
FT                   699602..699877,699959..700067,703542..703728,
FT                   704447..704575,705058..705302,705702..705917,
FT                   706652..706857,709011..709133,709750..709839,
FT                   710129..710221,710981..711115,711331..711460,
FT                   712674..712924,721615..721701,724305..724472,
FT                   725060..725172,725376..725538,726792..726884,
FT                   727519..727665,730223..730365,732085..732247,
FT                   732371..732516,752472..752547,755522..755661,
FT                   762050..762150,765121..765236,766353..766430,
FT                   766627..766734,771111..771236,771307..771438,
FT                   774489..774604,775547..775664,777150..777398,
FT                   778001..778101,778503..778599,778916..779014,
FT                   779103..779225,779368..779550,780623..780757,
FT                   780927..781101,785095..785230,786388..786535,
FT                   787279..787401,788485..788567,790219..790291,
FT                   790642..790716,790940..791075,791785..791850,
FT                   793725..793805,794044..794124,797276..797381,
FT                   797854..797869)
FT                   /codon_start=1
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /product="FK506 binding protein 12-rapamycin associated
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG16666.1 transcript_id=mCT190862.0
FT                   protein_id=mCP111819.0 isoform=CRA_a"
FT                   /protein_id="EDL14819.1"
FT   assembly_gap    692125..692144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(692549..692710,693300..693408,694030..694262,
FT                   694874..695074,696307..696441,699602..699877,
FT                   699959..700067,703542..703728,704447..704575,
FT                   705058..705302,705702..705917,706652..706857,
FT                   709011..709133,709750..709839,710129..710221,
FT                   710981..711115,711331..711460,712674..712924,
FT                   721615..721701,724305..724472,725060..725172,
FT                   725376..725538,726792..726884,727519..727669,
FT                   730223..730365,732085..732123)
FT                   /codon_start=1
FT                   /gene="Frap1"
FT                   /locus_tag="mCG_16666"
FT                   /product="FK506 binding protein 12-rapamycin associated
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG16666.1 transcript_id=mCT12294.1
FT                   protein_id=mCP19396.1 isoform=CRA_b"
FT                   /protein_id="EDL14820.1"
FT   gene            complement(736014..741235)
FT                   /locus_tag="mCG_16663"
FT                   /note="gene_id=mCG16663.2"
FT   mRNA            complement(join(736014..736675,736719..737102,
FT                   737271..737469,738061..738255,738766..738866,
FT                   740714..741235))
FT                   /locus_tag="mCG_16663"
FT                   /product="mCG16663"
FT                   /note="gene_id=mCG16663.2 transcript_id=mCT12292.2 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(736933..737102,737271..737469,
FT                   738061..738255,738766..738866,740714..741062))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16663"
FT                   /product="mCG16663"
FT                   /note="gene_id=mCG16663.2 transcript_id=mCT12292.2
FT                   protein_id=mCP19352.1"
FT                   /protein_id="EDL14821.1"
FT   gene            <799435..823309
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /note="gene_id=mCG16664.2"
FT   mRNA            join(<799435..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   817018..817092,819292..819379,820291..820367,
FT                   821272..821443,822016..822077,822676..822748,
FT                   823198..>823307)
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, transcript variant
FT                   mCT190859"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT190859.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(799462..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   817018..817092,819292..819379,820291..820367,
FT                   821272..821443,822016..822077,822672..822748,
FT                   823198..823309)
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, transcript variant
FT                   mCT12586"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT12586.1 created
FT                   on 26-NOV-2002"
FT   CDS             join(<799463..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   817018..817092,819292..819379,820291..820367,
FT                   821272..821443,822016..822077,822676..822748,
FT                   823198..>823307)
FT                   /codon_start=1
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, isoform CRA_a"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT190859.0
FT                   protein_id=mCP111817.0 isoform=CRA_a"
FT                   /protein_id="EDL14822.1"
FT   mRNA            join(<799466..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   819292..819379,820291..820367,821272..821443,
FT                   822016..822077,822672..822748,823198..823307)
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, transcript variant
FT                   mCT190860"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT190860.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<799466..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   819292..819379,820291..820367,821272..821443,
FT                   822016..822077,822672..822748,823198..823228)
FT                   /codon_start=1
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, isoform CRA_b"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT190860.0
FT                   protein_id=mCP111818.0 isoform=CRA_b"
FT                   /protein_id="EDL14823.1"
FT   CDS             join(799472..799582,800548..800684,801896..802019,
FT                   803175..803279,803581..803746,803889..804003,
FT                   804706..804781,804975..805085,805461..805604,
FT                   806066..806256,807140..807296,809227..809375,
FT                   809511..809561,811258..811369,813761..813811,
FT                   813953..814031,814120..814226,816677..816772,
FT                   817018..817092,819292..819379,820291..820367,
FT                   821272..821443,822016..822077,822672..822748,
FT                   823198..823228)
FT                   /codon_start=1
FT                   /gene="Exosc10"
FT                   /locus_tag="mCG_16664"
FT                   /product="exosome component 10, isoform CRA_c"
FT                   /note="gene_id=mCG16664.2 transcript_id=mCT12586.1
FT                   protein_id=mCP19385.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UNK6"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012588"
FT                   /db_xref="MGI:MGI:1355322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UNK6"
FT                   /protein_id="EDL14824.1"
FT                   AVGKSDRGFRHNWPKR"
FT   gene            complement(809918..810670)
FT                   /pseudo
FT                   /locus_tag="mCG_133682"
FT                   /note="gene_id=mCG133682.1"
FT   mRNA            complement(809918..810670)
FT                   /pseudo
FT                   /locus_tag="mCG_133682"
FT                   /note="gene_id=mCG133682.1 transcript_id=mCT135052.1
FT                   created on 26-DEC-2002"
FT   gene            complement(825673..826923)
FT                   /locus_tag="mCG_1027381"
FT                   /note="gene_id=mCG1027381.0"
FT   mRNA            complement(join(825673..825967,826761..826923))
FT                   /locus_tag="mCG_1027381"
FT                   /product="mCG1027381"
FT                   /note="gene_id=mCG1027381.0 transcript_id=mCT145085.0
FT                   created on 07-MAR-2003"
FT   CDS             complement(825829..825924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027381"
FT                   /product="mCG1027381"
FT                   /note="gene_id=mCG1027381.0 transcript_id=mCT145085.0
FT                   protein_id=mCP76743.1"
FT                   /protein_id="EDL14825.1"
FT                   /translation="MLITGQRMVLTVSLLHALTVVTGESLLGLCS"
FT   gene            832443..835548
FT                   /locus_tag="mCG_16662"
FT                   /note="gene_id=mCG16662.1"
FT   mRNA            join(832443..832727,832985..833105,833423..833515,
FT                   834235..834388,834716..834945,835031..835153,
FT                   835235..835548)
FT                   /locus_tag="mCG_16662"
FT                   /product="mCG16662"
FT                   /note="gene_id=mCG16662.1 transcript_id=mCT12291.1 created
FT                   on 19-SEP-2002"
FT   CDS             join(832561..832727,832985..833105,833423..833515,
FT                   834235..834388,834716..834945,835031..835153,
FT                   835235..835255)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16662"
FT                   /product="mCG16662"
FT                   /note="gene_id=mCG16662.1 transcript_id=mCT12291.1
FT                   protein_id=mCP19378.1"
FT                   /db_xref="GOA:Q543H0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR030668"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="MGI:MGI:102690"
FT                   /db_xref="UniProtKB/TrEMBL:Q543H0"
FT                   /protein_id="EDL14826.1"
FT   gene            843199..856166
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /note="gene_id=mCG16660.1"
FT   mRNA            join(843199..843558,843659..843836,844354..844485,
FT                   846265..846461,846714..846861,848607..848725,
FT                   850787..850865,852700..852831,853316..853390,
FT                   854418..856166)
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2,
FT                   transcript variant mCT176350"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT176350.0 created
FT                   on 26-NOV-2002"
FT   mRNA            join(843221..843257,843335..843563,843659..843836,
FT                   844354..844485,846265..846461,846714..846861,
FT                   848607..848725,850787..850865,852700..852831,
FT                   853316..853390,854418..856166)
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2,
FT                   transcript variant mCT176351"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT176351.0 created
FT                   on 26-NOV-2002"
FT   mRNA            join(843221..843257,843335..843563,843659..843836,
FT                   844354..844485,844923..845080)
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2,
FT                   transcript variant mCT12289"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT12289.0 created
FT                   on 26-NOV-2002"
FT   CDS             join(843253..843257,843335..843563,843659..843836,
FT                   844354..844485,846265..846461,846714..846861,
FT                   848607..848725,850787..850865,852700..852831,
FT                   853316..853390,854418..855181)
FT                   /codon_start=1
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT176351.0
FT                   protein_id=mCP99272.0 isoform=CRA_c"
FT                   /protein_id="EDL14829.1"
FT   CDS             join(843253..843257,843335..843563,843659..843836,
FT                   844354..844485,844923..844936)
FT                   /codon_start=1
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT12289.0
FT                   protein_id=mCP19370.1 isoform=CRA_b"
FT                   /protein_id="EDL14828.1"
FT   CDS             join(843550..843558,843659..843836,844354..844485,
FT                   846265..846461,846714..846861,848607..848725,
FT                   850787..850865,852700..852831,853316..853390,
FT                   854418..855181)
FT                   /codon_start=1
FT                   /gene="Masp2"
FT                   /locus_tag="mCG_16660"
FT                   /product="mannan-binding lectin serine peptidase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG16660.1 transcript_id=mCT176350.0
FT                   protein_id=mCP99273.0 isoform=CRA_a"
FT                   /protein_id="EDL14827.1"
FT   gene            complement(855413..867722)
FT                   /locus_tag="mCG_16669"
FT                   /note="gene_id=mCG16669.2"
FT   mRNA            complement(join(855413..857511,858233..858372,
FT                   859332..859458,859855..860025,861263..861403,
FT                   862627..862790,865830..866084,867383..867722))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT12588"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT12588.2 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(855977..857511,858233..858492,
FT                   859332..859458,859855..860025,861263..861403,
FT                   862627..862790,865830..866081,867383..867471))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT176356"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176356.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(856109..859458,859855..860025,
FT                   861263..861403,862627..862790,865830..866081,
FT                   867383..867460))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT176355"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176355.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(856586..857511,858233..858372,
FT                   859332..859458,859855..860025,861263..861403,
FT                   862627..862790,865830..866081,867383..>867468))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT190868"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190868.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(857393..858372,859341..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..866081,867383..867460))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT176354"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176354.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(857393..857511,858233..858404,
FT                   859411..859458,859855..860025,861263..861403,
FT                   862627..862790,865830..866081,867383..>867459))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT190867"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190867.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(857400..859458,859855..860025,
FT                   861263..861403,862627..862790,865830..866079,
FT                   867383..>867460))
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, transcript variant mCT190869"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190869.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(858303..858404,859411..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..>866073))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_c"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190867.0
FT                   protein_id=mCP111821.0 isoform=CRA_c"
FT                   /protein_id="EDL14832.1"
FT                   SSAVNILP"
FT   CDS             complement(join(858317..858372,859332..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..>866073))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_d"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190868.0
FT                   protein_id=mCP111822.0 isoform=CRA_d"
FT                   /protein_id="EDL14833.1"
FT   CDS             complement(join(858317..858372,859341..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..866067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_a"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176354.1
FT                   protein_id=mCP99278.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R0B4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R0B4"
FT                   /protein_id="EDL14830.1"
FT                   SNVYGRSTSLKVVL"
FT   CDS             complement(join(858317..858372,859332..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..866067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_f"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT12588.2
FT                   protein_id=mCP19362.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q8BLD4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BLD4"
FT                   /protein_id="EDL14835.1"
FT                   HLISNVYGRSTSLKVVL"
FT   CDS             complement(join(858467..858492,859332..859458,
FT                   859855..860025,861263..861403,862627..862790,
FT                   865830..866067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_g"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176356.1
FT                   protein_id=mCP99277.1 isoform=CRA_g"
FT                   /protein_id="EDL14836.1"
FT                   KSPFGRS"
FT   CDS             complement(join(858928..859458,859855..860025,
FT                   861263..861403,862627..862790,865830..>866073))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_e"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT190869.0
FT                   protein_id=mCP111823.0 isoform=CRA_e"
FT                   /protein_id="EDL14834.1"
FT                   NGGFGSSMDSKSSGWGM"
FT   CDS             complement(join(858928..859458,859855..860025,
FT                   861263..861403,862627..862790,865830..866067))
FT                   /codon_start=1
FT                   /locus_tag="mCG_16669"
FT                   /product="mCG16669, isoform CRA_b"
FT                   /note="gene_id=mCG16669.2 transcript_id=mCT176355.1
FT                   protein_id=mCP99276.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q544R5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q544R5"
FT                   /protein_id="EDL14831.1"
FT                   GFGSSMDSKSSGWGM"
FT   assembly_gap    879351..881692
FT                   /estimated_length=2342
FT                   /gap_type="unknown"
FT   gene            <884378..912710
FT                   /locus_tag="mCG_54852"
FT                   /note="gene_id=mCG54852.2"
FT   mRNA            join(<884378..884444,892283..892383,896046..896144,
FT                   899229..899353,900123..900268,908113..908170,
FT                   908762..908846,909833..910029,910264..910387,
FT                   912452..912710)
FT                   /locus_tag="mCG_54852"
FT                   /product="mCG54852"
FT                   /note="gene_id=mCG54852.2 transcript_id=mCT55035.2 created
FT                   on 07-MAR-2003"
FT   CDS             join(<884383..884444,892283..892383,896046..896144,
FT                   899229..899353,900123..900268,908113..908170,
FT                   908762..908846,909833..910029,910264..910387,
FT                   912452..912576)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54852"
FT                   /product="mCG54852"
FT                   /note="gene_id=mCG54852.2 transcript_id=mCT55035.2
FT                   protein_id=mCP39810.2"
FT                   /protein_id="EDL14837.1"
FT   assembly_gap    892719..893305
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    906244..906263
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    914650..918568
FT                   /estimated_length=3919
FT                   /gap_type="unknown"
FT   assembly_gap    927161..927201
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    950621..950640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    954008..954036
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    960048..960132
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    961628..961974
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    963908..964154
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    965498..965785
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    968167..968277
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    982933..983026
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    999625..1000413
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   assembly_gap    1007670..1008507
FT                   /estimated_length=838
FT                   /gap_type="unknown"
FT   assembly_gap    1031997..1032129
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    1042467..1044151
FT                   /estimated_length=1685
FT                   /gap_type="unknown"
FT   assembly_gap    1052402..1052520
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    1053264..1053295
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    1056223..1057194
FT                   /estimated_length=972
FT                   /gap_type="unknown"
FT   assembly_gap    1058110..1058620
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   gene            1067756..1090076
FT                   /locus_tag="mCG_61360"
FT                   /note="gene_id=mCG61360.2"
FT   mRNA            join(1067756..1067877,1077658..1077763,1081393..1081547,
FT                   1084388..1084510,1087554..1087710,1089732..1090076)
FT                   /locus_tag="mCG_61360"
FT                   /product="mCG61360"
FT                   /note="gene_id=mCG61360.2 transcript_id=mCT61543.2 created
FT                   on 26-DEC-2002"
FT   CDS             join(1067839..1067877,1077658..1077763,1081393..1081547,
FT                   1084388..1084510,1087554..1087710,1089732..1089979)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61360"
FT                   /product="mCG61360"
FT                   /note="gene_id=mCG61360.2 transcript_id=mCT61543.2
FT                   protein_id=mCP39821.2"
FT                   /protein_id="EDL14838.1"
FT   assembly_gap    1070494..1070617
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    1090612..1090745
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    1097301..1097352
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    1105469..1105853
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    1109974..1110161
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    1114491..1114795
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   gene            <1132158..1134712
FT                   /locus_tag="mCG_145234"
FT                   /note="gene_id=mCG145234.0"
FT   mRNA            join(<1132158..1132261,1133099..1133153,1133733..1134712)
FT                   /locus_tag="mCG_145234"
FT                   /product="mCG145234"
FT                   /note="gene_id=mCG145234.0 transcript_id=mCT184658.0
FT                   created on 05-JUN-2003"
FT   CDS             <1133812..1134132
FT                   /codon_start=1
FT                   /locus_tag="mCG_145234"
FT                   /product="mCG145234"
FT                   /note="gene_id=mCG145234.0 transcript_id=mCT184658.0
FT                   protein_id=mCP105936.0"
FT                   /protein_id="EDL14839.1"
FT                   WP"
FT   assembly_gap    1143593..1144124
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   gene            <1144416..1196219
FT                   /locus_tag="mCG_132113"
FT                   /note="gene_id=mCG132113.1"
FT   mRNA            join(<1144416..1144470,1171994..1172143,1172294..1172482,
FT                   1175668..1176502,1177491..1177559,1179077..1179167,
FT                   1179870..1180034,1181046..1181218,1181380..1182227,
FT                   1184188..1184320,1184573..1184636,1185809..1185963,
FT                   1186108..1186230,1187164..1187502,1188929..1189127,
FT                   1189896..1190067,1191430..1191581,1191699..1191840,
FT                   1194358..1196219)
FT                   /locus_tag="mCG_132113"
FT                   /product="mCG132113"
FT                   /note="gene_id=mCG132113.1 transcript_id=mCT133461.1
FT                   created on 16-DEC-2002"
FT   CDS             join(1144416..1144470,1171994..1172143,1172294..1172482,
FT                   1175668..1176502,1177491..1177559,1179077..1179167,
FT                   1179870..1180034,1181046..1181218,1181380..1182227,
FT                   1184188..1184320,1184573..1184636,1185809..1185963,
FT                   1186108..1186230,1187164..1187502,1188929..1189127,
FT                   1189896..1190067,1191430..1191581,1191699..1191840,
FT                   1194358..1195481)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132113"
FT                   /product="mCG132113"
FT                   /note="gene_id=mCG132113.1 transcript_id=mCT133461.1
FT                   protein_id=mCP76850.1"
FT                   /protein_id="EDL14840.1"
FT   assembly_gap    1151094..1151113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1154312..1154510
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    1155436..1155552
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    1157904..1158118
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    1163257..1163435
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            <1203161..1227689
FT                   /locus_tag="mCG_132114"
FT                   /note="gene_id=mCG132114.2"
FT   mRNA            join(<1203161..1203286,1214879..1215055,1225035..1227689)
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, transcript variant mCT185863"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT185863.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(<1203161..1203286,1209587..1209767,1210564..1210815)
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, transcript variant mCT133462"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT133462.2
FT                   created on 19-JUN-2003"
FT   mRNA            join(<1203161..1203286,1204246..1206682,1209587..1209852)
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, transcript variant mCT185862"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT185862.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<1203207..1203286,1204246..1205059)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, isoform CRA_a"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT185862.0
FT                   protein_id=mCP107121.0 isoform=CRA_a"
FT                   /protein_id="EDL14841.1"
FT                   KEDQGWEPGSPWLMCP"
FT   gene            complement(1203399..1346789)
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /note="gene_id=mCG16658.2"
FT   mRNA            complement(join(1203399..1204654,1206310..1206401,
FT                   1209076..1209173,1210380..1210482,1213406..1213491,
FT                   1227055..1227183,1284730..1284814,1319259..1319306,
FT                   1346740..1346789))
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /product="peroxisomal biogenesis factor 14, transcript
FT                   variant mCT12288"
FT                   /note="gene_id=mCG16658.2 transcript_id=mCT12288.1 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(1203399..1204654,1206310..1206401,
FT                   1209076..1209173,1210380..1210482,1213406..1213491,
FT                   1227055..1227183,1319259..1319306,1346740..1346781))
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /product="peroxisomal biogenesis factor 14, transcript
FT                   variant mCT176348"
FT                   /note="gene_id=mCG16658.2 transcript_id=mCT176348.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1204201..1204654,1206310..1206401,
FT                   1209076..1209173,1210380..1210482,1213406..1213491,
FT                   1227055..1227183,1284730..1284814,1319259..1319306,
FT                   1346740..1346775))
FT                   /codon_start=1
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /product="peroxisomal biogenesis factor 14, isoform CRA_b"
FT                   /note="gene_id=mCG16658.2 transcript_id=mCT12288.1
FT                   protein_id=mCP19361.1 isoform=CRA_b"
FT                   /protein_id="EDL14845.1"
FT   CDS             complement(join(1204201..1204654,1206310..1206401,
FT                   1209076..1209173,1210380..1210482,1213406..1213444))
FT                   /codon_start=1
FT                   /gene="Pex14"
FT                   /locus_tag="mCG_16658"
FT                   /product="peroxisomal biogenesis factor 14, isoform CRA_a"
FT                   /note="gene_id=mCG16658.2 transcript_id=mCT176348.0
FT                   protein_id=mCP99270.0 isoform=CRA_a"
FT                   /protein_id="EDL14844.1"
FT   CDS             join(<1209744..1209767,1210564..1210761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, isoform CRA_c"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT133462.2
FT                   protein_id=mCP76861.2 isoform=CRA_c"
FT                   /protein_id="EDL14843.1"
FT   assembly_gap    1220917..1220936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <1227188..1227646
FT                   /codon_start=1
FT                   /locus_tag="mCG_132114"
FT                   /product="mCG132114, isoform CRA_b"
FT                   /note="gene_id=mCG132114.2 transcript_id=mCT185863.0
FT                   protein_id=mCP107120.0 isoform=CRA_b"
FT                   /protein_id="EDL14842.1"
FT   assembly_gap    1235434..1235453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1251081..1251100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1253583..1253602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1259124..1259418
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    1275651..1275670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1286001..1286020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1294774..1294875
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1321508..1321527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1324184..1324203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1325353..1325372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1326455..1326474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1328240..1328259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1335317..1335336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1347536..1347621
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            <1351154..1366252
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /note="gene_id=mCG17410.3"
FT   mRNA            join(<1351154..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1364384)
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit,
FT                   transcript variant mCT190886"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190886.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1351164..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363452)
FT                   /codon_start=1
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190886.0
FT                   protein_id=mCP111829.0 isoform=CRA_c"
FT                   /protein_id="EDL14848.1"
FT                   GKN"
FT   mRNA            join(<1351167..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363639,1364314..1364376)
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit,
FT                   transcript variant mCT190884"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190884.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1351167..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363452)
FT                   /codon_start=1
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190884.0
FT                   protein_id=mCP111827.0 isoform=CRA_a"
FT                   /protein_id="EDL14846.1"
FT                   KN"
FT   mRNA            join(<1351182..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363437,1364681..1366252)
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit,
FT                   transcript variant mCT190885"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190885.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1351182..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363437,1364681..1364893)
FT                   /codon_start=1
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT190885.0
FT                   protein_id=mCP111828.0 isoform=CRA_b"
FT                   /protein_id="EDL14847.1"
FT                   RDSS"
FT   mRNA            join(<1351221..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363452,1364681..1366249)
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit,
FT                   transcript variant mCT12731"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT12731.1 created
FT                   on 26-NOV-2002"
FT   CDS             join(1351221..1351356,1353123..1353284,1354853..1354995,
FT                   1362922..1363111,1363286..1363452)
FT                   /codon_start=1
FT                   /gene="Dffa"
FT                   /locus_tag="mCG_17410"
FT                   /product="DNA fragmentation factor, alpha subunit, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG17410.3 transcript_id=mCT12731.1
FT                   protein_id=mCP19359.1 isoform=CRA_d"
FT                   /protein_id="EDL14849.1"
FT   assembly_gap    1354001..1354353
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    1355190..1357118
FT                   /estimated_length=1929
FT                   /gap_type="unknown"
FT   assembly_gap    1358457..1360573
FT                   /estimated_length=2117
FT                   /gap_type="unknown"
FT   gene            complement(1370530..1372231)
FT                   /gene="Cort"
FT                   /locus_tag="mCG_17408"
FT                   /note="gene_id=mCG17408.1"
FT   mRNA            complement(join(1370530..1370958,1372016..1372231))
FT                   /gene="Cort"
FT                   /locus_tag="mCG_17408"
FT                   /product="cortistatin"
FT                   /note="gene_id=mCG17408.1 transcript_id=mCT12729.1 created
FT                   on 03-JAN-2003"
FT   CDS             complement(join(1370758..1370958,1372016..1372135))
FT                   /codon_start=1
FT                   /gene="Cort"
FT                   /locus_tag="mCG_17408"
FT                   /product="cortistatin"
FT                   /note="gene_id=mCG17408.1 transcript_id=mCT12729.1
FT                   protein_id=mCP19357.1"
FT                   /protein_id="EDL14850.1"
FT                   CK"
FT   gene            complement(1372606..1382999)
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /note="gene_id=mCG17407.2"
FT   mRNA            complement(join(1372606..1372634,1372771..1372926,
FT                   1377048..1377081,1377629..1377752,1382853..1382999))
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /product="RIKEN cDNA 2610040C18, transcript variant
FT                   mCT176357"
FT                   /note="gene_id=mCG17407.2 transcript_id=mCT176357.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1372824..1372926,1377048..1377081,
FT                   1377629..1377752,1382853..1382900))
FT                   /codon_start=1
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /product="RIKEN cDNA 2610040C18, isoform CRA_b"
FT                   /note="gene_id=mCG17407.2 transcript_id=mCT176357.0
FT                   protein_id=mCP99279.0 isoform=CRA_b"
FT                   /db_xref="GOA:A6PWQ2"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR029003"
FT                   /db_xref="InterPro:IPR033554"
FT                   /db_xref="MGI:MGI:1917178"
FT                   /db_xref="UniProtKB/TrEMBL:A6PWQ2"
FT                   /protein_id="EDL14852.1"
FT   mRNA            complement(join(1373776..1374341,1375566..1375632,
FT                   1377048..1377081,1377629..1377752,1382853..1382998))
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /product="RIKEN cDNA 2610040C18, transcript variant
FT                   mCT12750"
FT                   /note="gene_id=mCG17407.2 transcript_id=mCT12750.1 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1374186..1374341,1375566..1375632,
FT                   1377048..1377081,1377629..1377752,1382853..1382900))
FT                   /codon_start=1
FT                   /gene="2610040C18Rik"
FT                   /locus_tag="mCG_17407"
FT                   /product="RIKEN cDNA 2610040C18, isoform CRA_a"
FT                   /note="gene_id=mCG17407.2 transcript_id=mCT12750.1
FT                   protein_id=mCP19383.2 isoform=CRA_a"
FT                   /db_xref="GOA:B2KFX4"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR029003"
FT                   /db_xref="InterPro:IPR033554"
FT                   /db_xref="MGI:MGI:1917178"
FT                   /db_xref="UniProtKB/TrEMBL:B2KFX4"
FT                   /protein_id="EDL14851.1"
FT   assembly_gap    1384377..1384782
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    1386488..1386762
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   gene            complement(1387943..1388977)
FT                   /pseudo
FT                   /locus_tag="mCG_17396"
FT                   /note="gene_id=mCG17396.0"
FT   mRNA            complement(1387943..1388977)
FT                   /pseudo
FT                   /locus_tag="mCG_17396"
FT                   /note="gene_id=mCG17396.0 transcript_id=mCT12523.1 created
FT                   on 26-DEC-2002"
FT   gene            complement(1395482..>1412168)
FT                   /locus_tag="mCG_141692"
FT                   /note="gene_id=mCG141692.1"
FT   mRNA            complement(join(1395482..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399489,1399658..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1407124..1407189,1410539..1410718,
FT                   1411496..1411571,1412080..1412165))
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, transcript variant mCT176358"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT176358.0
FT                   created on 26-NOV-2002"
FT   mRNA            complement(join(1395483..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399374,1399742..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1407124..1407189,1410539..1410718,
FT                   1411496..1411571,1412080..>1412168))
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, transcript variant mCT190854"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT190854.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(1395695..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399489,1399658..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1410536..1410718,1411496..1411571,
FT                   1412080..1412165))
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, transcript variant mCT176360"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT176360.0
FT                   created on 26-NOV-2002"
FT   CDS             complement(join(1396134..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399489,1399658..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1407124..1407189,1410539..1410718,
FT                   1411496..1411571,1412080..1412087))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, isoform CRA_a"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT176358.0
FT                   protein_id=mCP99281.0 isoform=CRA_a"
FT                   /protein_id="EDL14853.1"
FT   CDS             complement(join(1396134..1396253,1396343..1396465,
FT                   1396603..1396702,1399356..1399489,1399658..1399788,
FT                   1402099..1402288,1403453..1403587,1405551..1405620,
FT                   1406327..1406445,1410536..1410718,1411496..1411571,
FT                   1412080..1412087))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, isoform CRA_b"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT176360.0
FT                   protein_id=mCP99280.0 isoform=CRA_b"
FT                   /protein_id="EDL14854.1"
FT                   SYNA"
FT   CDS             complement(join(1396638..1396702,1399356..1399374,
FT                   1399742..1399788,1402099..1402288,1403453..1403587,
FT                   1405551..1405620,1406327..1406445,1407124..1407189,
FT                   1410539..1410718,1411496..1411571,1412080..>1412168))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141692"
FT                   /product="mCG141692, isoform CRA_c"
FT                   /note="gene_id=mCG141692.1 transcript_id=mCT190854.0
FT                   protein_id=mCP111815.0 isoform=CRA_c"
FT                   /protein_id="EDL14855.1"
FT                   LSETQNFRTYC"
FT   gene            complement(1421590..1554005)
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /note="gene_id=mCG141691.0"
FT   mRNA            complement(join(1421590..1426079,1426753..1426871,
FT                   1427078..1427270,1427537..1427686,1429578..1429699,
FT                   1431372..1431443,1432860..1433099,1433268..1433413,
FT                   1434993..1435054,1436419..1436552,1437843..1437957,
FT                   1443634..1443739,1444457..1444541,1447709..1447775,
FT                   1449387..1449489,1451919..1451974,1453040..1453158,
FT                   1455213..1455303,1458467..1458629,1458794..1458923,
FT                   1459250..1459335,1460078..1460196,1465711..1465959,
FT                   1467396..1467556,1467722..1467749,1470219..1470369,
FT                   1471394..1471487,1490489..1490561,1490693..1490873,
FT                   1491488..1491571,1492379..1492485,1492955..1493034,
FT                   1496889..1496964,1498819..1498898,1503017..1503150,
FT                   1507289..1507431,1507852..1507930,1508768..1508843,
FT                   1511405..1511470,1514107..1514184,1516617..1516728,
FT                   1517504..1517682,1520540..1520605,1521675..1521854,
FT                   1523606..1523682,1537837..1538011,1553743..1554005))
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, transcript variant
FT                   mCT176359"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT176359.0
FT                   created on 03-JAN-2003"
FT   mRNA            complement(join(1421591..1426079,1426753..1426871,
FT                   1427078..1427270,1427537..1427686,1429578..1429699,
FT                   1431372..1431443,1432860..1433099,1433268..1433413,
FT                   1434993..1435054,1436419..1436552,1437843..1437957,
FT                   1443634..1443739,1444457..1444541,1447709..1447775,
FT                   1449387..1449495,1451919..1451974,1453040..1453158,
FT                   1455213..1455303,1458467..1458629,1458794..1458923,
FT                   1459250..1459335,1460078..1460196,1465711..1465959,
FT                   1467396..1467533,1467722..1467749,1470219..1470369,
FT                   1471394..1471487,1490489..1490561,1490693..1490873,
FT                   1491488..1491571,1492379..1492485,1492955..1493034,
FT                   1496889..1496964,1498819..1498898,1503017..1503228,
FT                   1506307..1506348,1507289..1507431,1507852..1507930,
FT                   1508768..1508843,1511394..1511470,1514107..1514184,
FT                   1516617..1516728,1517504..1517682,1520540..1520605,
FT                   1521675..1521854,1523606..1523682,1537837..1538011,
FT                   1553743..1553938))
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, transcript variant
FT                   mCT178252"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT178252.0
FT                   created on 03-JAN-2003"
FT   CDS             complement(join(1426037..1426079,1426753..1426871,
FT                   1427078..1427270,1427537..1427686,1429578..1429699,
FT                   1431372..1431443,1432860..1433099,1433268..1433413,
FT                   1434993..1435054,1436419..1436552,1437843..1437957,
FT                   1443634..1443739,1444457..1444541,1447709..1447775,
FT                   1449387..1449489,1451919..1451974,1453040..1453158,
FT                   1455213..1455303,1458467..1458629,1458794..1458923,
FT                   1459250..1459335,1460078..1460196,1465711..1465959,
FT                   1467396..1467556,1467722..1467749,1470219..1470369,
FT                   1471394..1471487,1490489..1490561,1490693..1490873,
FT                   1491488..1491571,1492379..1492485,1492955..1493034,
FT                   1496889..1496964,1498819..1498898,1503017..1503150,
FT                   1507289..1507431,1507852..1507930,1508768..1508843,
FT                   1511405..1511470,1514107..1514184,1516617..1516728,
FT                   1517504..1517682,1520540..1520605,1521675..1521854,
FT                   1523606..1523682,1537837..1537942))
FT                   /codon_start=1
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, isoform CRA_b"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT176359.0
FT                   protein_id=mCP99282.0 isoform=CRA_b"
FT                   /protein_id="EDL14857.1"
FT   assembly_gap    1439793..1439812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1467964..1469087
FT                   /estimated_length=1124
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1481053..1483634,1490489..1490561,
FT                   1490693..1490873,1491488..1491571,1492379..1492485,
FT                   1492955..1493034,1496889..1496964,1498819..1498898,
FT                   1503017..1503150,1507289..1507431,1507852..1507930,
FT                   1508768..1508843,1511405..1511470,1514107..1514184,
FT                   1516617..1516728,1517504..1517682,1520540..1520605,
FT                   1521675..1521854,1523606..1523682,1537837..1538011,
FT                   1553743..1553938))
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, transcript variant
FT                   mCT178253"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT178253.0
FT                   created on 03-JAN-2003"
FT   CDS             complement(join(1482159..1483634,1490489..1490561,
FT                   1490693..1490873,1491488..1491571,1492379..1492485,
FT                   1492955..1493034,1496889..1496964,1498819..1498898,
FT                   1503017..1503150,1507289..1507431,1507852..1507930,
FT                   1508768..1508843,1511405..1511470,1514107..1514184,
FT                   1516617..1516728,1517504..1517682,1520540..1520605,
FT                   1521675..1521854,1523606..1523682,1537837..1537942))
FT                   /codon_start=1
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, isoform CRA_a"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT178253.0
FT                   protein_id=mCP101174.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AH75"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032405"
FT                   /db_xref="MGI:MGI:108426"
FT                   /db_xref="UniProtKB/TrEMBL:A2AH75"
FT                   /protein_id="EDL14856.1"
FT   CDS             complement(join(1507895..1507930,1508768..1508843,
FT                   1511394..1511470,1514107..1514184,1516617..1516728,
FT                   1517504..1517682,1520540..1520605,1521675..1521854,
FT                   1523606..1523682,1537837..1537942))
FT                   /codon_start=1
FT                   /gene="Kif1b"
FT                   /locus_tag="mCG_141691"
FT                   /product="kinesin family member 1B, isoform CRA_c"
FT                   /note="gene_id=mCG141691.0 transcript_id=mCT178252.0
FT                   protein_id=mCP101175.0 isoform=CRA_c"
FT                   /protein_id="EDL14858.1"
FT   assembly_gap    1513331..1513350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1514539..1514558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1533101..1533224
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    1558149..1558239
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    1564709..1564808
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            complement(1574667..1673225)
FT                   /gene="Ube4b"
FT                   /locus_tag="mCG_132104"
FT                   /note="gene_id=mCG132104.0"
FT   mRNA            complement(join(1574667..1575985,1576439..1576585,
FT                   1577571..1577745,1581368..1581559,1583641..1583775,
FT                   1589280..1589424,1590916..1591042,1594328..1594563,
FT                   1597048..1597146,1597848..1597975,1601789..1601927,
FT                   1603994..1604192,1605566..1605679,1606651..1606749,
FT                   1606833..1606949,1607657..1607713,1611793..1611876,
FT                   1614640..1614754,1617494..1617594,1619163..1619304,
FT                   1627422..1627650,1629977..1630121,1631379..1631466,
FT                   1633363..1633498,1645174..1645360,1672357..1673225))
FT                   /gene="Ube4b"
FT                   /locus_tag="mCG_132104"
FT                   /product="ubiquitination factor E4B, UFD2 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG132104.0 transcript_id=mCT133452.1
FT                   created on 26-NOV-2002"
FT   assembly_gap    1586305..1586324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1588484..1588503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1597918..1597975,1601789..1601927,
FT                   1603994..1604192,1605566..1605679,1606651..1606749,
FT                   1606833..1606949,1607657..1607713,1611793..1611876,
FT                   1614640..1614754,1617494..1617594,1619163..1619304,
FT                   1627422..1627650,1629977..1630121,1631379..1631466,
FT                   1633363..1633498,1645174..1645360,1672357..1672380))
FT                   /codon_start=1
FT                   /gene="Ube4b"
FT                   /locus_tag="mCG_132104"
FT                   /product="ubiquitination factor E4B, UFD2 homolog (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG132104.0 transcript_id=mCT133452.1
FT                   protein_id=mCP76710.1"
FT                   /protein_id="EDL14859.1"
FT   gene            1598322..1611625
FT                   /locus_tag="mCG_1050987"
FT                   /note="gene_id=mCG1050987.0"
FT   mRNA            join(1598322..1598561,1603956..1604087,1610979..1611625)
FT                   /locus_tag="mCG_1050987"
FT                   /product="mCG1050987"
FT                   /note="gene_id=mCG1050987.0 transcript_id=mCT194776.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    1599295..1599749
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   CDS             1611296..1611556
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050987"
FT                   /product="mCG1050987"
FT                   /note="gene_id=mCG1050987.0 transcript_id=mCT194776.0
FT                   protein_id=mCP115805.0"
FT                   /protein_id="EDL14860.1"
FT   assembly_gap    1636763..1636886
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            1680573..1682753
FT                   /locus_tag="mCG_147510"
FT                   /note="gene_id=mCG147510.0"
FT   mRNA            join(1680573..1680843,1682507..1682753)
FT                   /locus_tag="mCG_147510"
FT                   /product="mCG147510"
FT                   /note="gene_id=mCG147510.0 transcript_id=mCT187773.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    1681040..1681059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1682368..1682387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             1682509..1682709
FT                   /codon_start=1
FT                   /locus_tag="mCG_147510"
FT                   /product="mCG147510"
FT                   /note="gene_id=mCG147510.0 transcript_id=mCT187773.0
FT                   protein_id=mCP109469.0"
FT                   /protein_id="EDL14861.1"
FT   gene            complement(1693221..1698362)
FT                   /gene="Rbp7"
FT                   /locus_tag="mCG_17412"
FT                   /note="gene_id=mCG17412.1"
FT   mRNA            complement(join(1693221..1693443,1696242..1696343,
FT                   1696749..1696927,1698271..1698362))
FT                   /gene="Rbp7"
FT                   /locus_tag="mCG_17412"
FT                   /product="retinol binding protein 7, cellular"
FT                   /note="gene_id=mCG17412.1 transcript_id=mCT12733.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(1693393..1693443,1696242..1696343,
FT                   1696749..1696927,1698271..1698343))
FT                   /codon_start=1
FT                   /gene="Rbp7"
FT                   /locus_tag="mCG_17412"
FT                   /product="retinol binding protein 7, cellular"
FT                   /note="gene_id=mCG17412.1 transcript_id=mCT12733.0
FT                   protein_id=mCP19363.1"
FT                   /db_xref="GOA:Q540P4"
FT                   /db_xref="InterPro:IPR000463"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR031259"
FT                   /db_xref="InterPro:IPR033075"
FT                   /db_xref="MGI:MGI:1890409"
FT                   /db_xref="UniProtKB/TrEMBL:Q540P4"
FT                   /protein_id="EDL14862.1"
FT   assembly_gap    1694735..1694754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1700694..1701271
FT                   /locus_tag="mCG_132103"
FT                   /note="gene_id=mCG132103.0"
FT   mRNA            1700694..1701271
FT                   /locus_tag="mCG_132103"
FT                   /product="mCG132103"
FT                   /note="gene_id=mCG132103.0 transcript_id=mCT133451.0
FT                   created on 16-DEC-2002"
FT   CDS             1700728..1701105
FT                   /codon_start=1
FT                   /locus_tag="mCG_132103"
FT                   /product="mCG132103"
FT                   /note="gene_id=mCG132103.0 transcript_id=mCT133451.0
FT                   protein_id=mCP76706.1"
FT                   /protein_id="EDL14863.1"
FT   assembly_gap    1709231..1709394
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            complement(1711494..1728093)
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /note="gene_id=mCG17404.2"
FT   mRNA            complement(join(1711494..1712073,1712502..1712644,
FT                   1716145..1716328,1717244..1717411,1727906..1728093))
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /product="nicotinamide nucleotide adenylyltransferase 1,
FT                   transcript variant mCT12766"
FT                   /note="gene_id=mCG17404.2 transcript_id=mCT12766.2 created
FT                   on 26-NOV-2002"
FT   mRNA            complement(join(1711494..1712073,1712502..1712644,
FT                   1716145..1716328,1717244..1717411,1727700..>1727969))
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /product="nicotinamide nucleotide adenylyltransferase 1,
FT                   transcript variant mCT190911"
FT                   /note="gene_id=mCG17404.2 transcript_id=mCT190911.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1711658..1712073,1712502..1712644,
FT                   1716145..1716328,1717244..1717411,1727700..>1727721))
FT                   /codon_start=1
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /product="nicotinamide nucleotide adenylyltransferase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG17404.2 transcript_id=mCT190911.0
FT                   protein_id=mCP111867.0 isoform=CRA_b"
FT                   /protein_id="EDL14865.1"
FT   CDS             complement(join(1711658..1712073,1712502..1712644,
FT                   1716145..1716328,1717244..1717358))
FT                   /codon_start=1
FT                   /gene="Nmnat1"
FT                   /locus_tag="mCG_17404"
FT                   /product="nicotinamide nucleotide adenylyltransferase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17404.2 transcript_id=mCT12766.2
FT                   protein_id=mCP19381.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V449"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V449"
FT                   /protein_id="EDL14864.1"
FT                   HSTL"
FT   gene            1728090..1739601
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /note="gene_id=mCG17405.2"
FT   mRNA            join(1728090..1728389,1728655..1728796,1729684..1729792,
FT                   1730988..1731123,1731562..1731660,1736123..1736218,
FT                   1736656..1736737,1739016..1739600)
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /product="leucine zipper and CTNNBIP1 domain containing,
FT                   transcript variant mCT12749"
FT                   /note="gene_id=mCG17405.2 transcript_id=mCT12749.1 created
FT                   on 14-DEC-2002"
FT   mRNA            join(1728122..1728796,1729684..1729792,1730988..1731123,
FT                   1731562..1731660,1736123..1736218,1736656..1736737,
FT                   1739016..1739601)
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /product="leucine zipper and CTNNBIP1 domain containing,
FT                   transcript variant mCT177243"
FT                   /note="gene_id=mCG17405.2 transcript_id=mCT177243.0 created
FT                   on 14-DEC-2002"
FT   CDS             join(1729692..1729792,1730988..1731123,1731562..1731660,
FT                   1736123..1736218,1736656..1736737,1739016..1739074)
FT                   /codon_start=1
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /product="leucine zipper and CTNNBIP1 domain containing,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17405.2 transcript_id=mCT177243.0
FT                   protein_id=mCP100165.0 isoform=CRA_a"
FT                   /protein_id="EDL14866.1"
FT   CDS             join(1729692..1729792,1730988..1731123,1731562..1731660,
FT                   1736123..1736218,1736656..1736737,1739016..1739074)
FT                   /codon_start=1
FT                   /gene="Lzic"
FT                   /locus_tag="mCG_17405"
FT                   /product="leucine zipper and CTNNBIP1 domain containing,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG17405.2 transcript_id=mCT12749.1
FT                   protein_id=mCP19393.1 isoform=CRA_a"
FT                   /protein_id="EDL14867.1"
FT   gene            complement(1742326..1747266)
FT                   /locus_tag="mCG_1027388"
FT                   /note="gene_id=mCG1027388.0"
FT   mRNA            complement(join(1742326..1742629,1747139..1747266))
FT                   /locus_tag="mCG_1027388"
FT                   /product="mCG1027388"
FT                   /note="gene_id=mCG1027388.0 transcript_id=mCT145092.1
FT                   created on 13-MAR-2003"
FT   CDS             complement(1742385..1742483)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027388"
FT                   /product="mCG1027388"
FT                   /note="gene_id=mCG1027388.0 transcript_id=mCT145092.1
FT                   protein_id=mCP76772.1"
FT                   /protein_id="EDL14868.1"
FT                   /translation="MQKFSPKHRGIRILKASCCEWQTFQVPERMTM"
FT   assembly_gap    1761144..1761218
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            1761302..1811000
FT                   /gene="Ctnnbip1"
FT                   /locus_tag="mCG_17406"
FT                   /note="gene_id=mCG17406.1"
FT   mRNA            join(1761302..1761357,1784365..1784449,1790251..1790371,
FT                   1790942..1791032,1808769..1811000)
FT                   /gene="Ctnnbip1"
FT                   /locus_tag="mCG_17406"
FT                   /product="catenin beta interacting protein 1"
FT                   /note="gene_id=mCG17406.1 transcript_id=mCT12728.1 created
FT                   on 26-NOV-2002"
FT   assembly_gap    1777275..1777294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1790276..1790371,1790942..1791032,1808769..1808827)
FT                   /codon_start=1
FT                   /gene="Ctnnbip1"
FT                   /locus_tag="mCG_17406"
FT                   /product="catenin beta interacting protein 1"
FT                   /note="gene_id=mCG17406.1 transcript_id=mCT12728.1
FT                   protein_id=mCP19353.1"
FT                   /protein_id="EDL14869.1"
FT   assembly_gap    1817023..1817042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1830564..1831151
FT                   /estimated_length=588
FT                   /gap_type="unknown"
FT   gene            <1831152..1894902
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /note="gene_id=mCG17403.2"
FT   mRNA            join(1831152..1831259,1860008..1860130,1872053..1872082,
FT                   1873179..1873374,1875282..1875490,1877703..1877852,
FT                   1877964..1878149,1880652..1880900,1881215..1881336,
FT                   1884238..1884400,1887646..1887703,1889184..1889341,
FT                   1889570..1889718,1889961..1890187,1890874..1891044,
FT                   1891326..1891471,1892245..1892380,1892770..1892954,
FT                   1893377..1894902)
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /product="calsyntenin 1, transcript variant mCT12748"
FT                   /note="gene_id=mCG17403.2 transcript_id=mCT12748.2 created
FT                   on 26-NOV-2002"
FT   mRNA            join(<1831152..1831259,1860008..1860130,1873179..1873374,
FT                   1875282..1875490,1877703..1877852,1877964..1878149,
FT                   1880652..1880900,1881215..1881336,1884238..1884400,
FT                   1887646..1887703,1889184..1889341,1889570..1889718,
FT                   1889961..1890187,1890874..1891044,1891326..1891471,
FT                   1892245..1892380,1892770..1892954,1893377..1894902)
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /product="calsyntenin 1, transcript variant mCT190910"
FT                   /note="gene_id=mCG17403.2 transcript_id=mCT190910.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1831154..1831259,1860008..1860130,1873179..1873374,
FT                   1875282..1875490,1877703..1877852,1877964..1878149,
FT                   1880652..1880900,1881215..1881336,1884238..1884400,
FT                   1887646..1887674)
FT                   /codon_start=1
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /product="calsyntenin 1, isoform CRA_b"
FT                   /note="gene_id=mCG17403.2 transcript_id=mCT190910.0
FT                   protein_id=mCP111866.0 isoform=CRA_b"
FT                   /protein_id="EDL14871.1"
FT   CDS             join(1831169..1831259,1860008..1860130,1872053..1872082,
FT                   1873179..1873374,1875282..1875490,1877703..1877852,
FT                   1877964..1878149,1880652..1880900,1881215..1881336,
FT                   1884238..1884400,1887646..1887674)
FT                   /codon_start=1
FT                   /gene="Clstn1"
FT                   /locus_tag="mCG_17403"
FT                   /product="calsyntenin 1, isoform CRA_a"
FT                   /note="gene_id=mCG17403.2 transcript_id=mCT12748.2
FT                   protein_id=mCP19389.2 isoform=CRA_a"
FT                   /protein_id="EDL14870.1"
FT   assembly_gap    1839206..1839225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1840801..1840820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1849883..1849902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1852093..1852112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1854257..1854276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1881837..1881856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1890784..1890827
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            complement(1895110..>1920815)
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /note="gene_id=mCG17400.2"
FT   mRNA            complement(join(1895110..1896781,1897750..1897882,
FT                   1898212..1898357,1898596..1898719,1899296..1899463,
FT                   1899792..1899870,1900008..1900120,1900210..1900388,
FT                   1900503..1900602,1900801..1900944,1901112..1901233,
FT                   1901321..1901485,1901566..1901616,1902366..1902496,
FT                   1902589..1902685,1903231..1903452,1904367..1904456,
FT                   1904697..1904846,1904956..1905135,1905646..1905875,
FT                   1905955..1906183,1909128..1909300,1920690..1920815))
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide, transcript variant mCT12519"
FT                   /note="gene_id=mCG17400.2 transcript_id=mCT12519.2 created
FT                   on 27-NOV-2002"
FT   mRNA            complement(join(1895174..1896781,1897750..1897882,
FT                   1898212..1898357,1898596..1898719,1899296..1899463,
FT                   1899792..1899870,1900008..1900123,1900210..1900388,
FT                   1900503..1900602,1900801..1900944,1901112..1901233,
FT                   1901321..1901488,1901566..1901616,1902366..1902496,
FT                   1902589..1902685,1903231..1903452,1904367..1904456,
FT                   1904697..1904846,1904956..1905135,1905646..1905875,
FT                   1905955..1906183,1909128..1909300,1920690..>1920815))
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide, transcript variant mCT190905"
FT                   /note="gene_id=mCG17400.2 transcript_id=mCT190905.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1896644..1896781,1897750..1897882,
FT                   1898212..1898357,1898596..1898719,1899296..1899463,
FT                   1899792..1899870,1900008..1900123,1900210..1900388,
FT                   1900503..1900602,1900801..1900944,1901112..1901233,
FT                   1901321..1901488,1901566..1901616,1902366..1902496,
FT                   1902589..1902685,1903231..1903452,1904367..1904456,
FT                   1904697..1904846,1904956..1905135,1905646..1905875,
FT                   1905955..1906183,1909128..>1909277))
FT                   /codon_start=1
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG17400.2 transcript_id=mCT190905.0
FT                   protein_id=mCP111826.0 isoform=CRA_b"
FT                   /protein_id="EDL14873.1"
FT                   "
FT   CDS             complement(join(1896644..1896781,1897750..1897882,
FT                   1898212..1898357,1898596..1898719,1899296..1899463,
FT                   1899792..1899870,1900008..1900120,1900210..1900388,
FT                   1900503..1900602,1900801..1900944,1901112..1901233,
FT                   1901321..1901485,1901566..1901616,1902366..1902496,
FT                   1902589..1902685,1903231..1903452,1904367..1904456,
FT                   1904697..1904846,1904956..1905135,1905646..1905875,
FT                   1905955..1906183,1909128..1909268))
FT                   /codon_start=1
FT                   /gene="Pik3cd"
FT                   /locus_tag="mCG_17400"
FT                   /product="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG17400.2 transcript_id=mCT12519.2
FT                   protein_id=mCP19384.2 isoform=CRA_a"
FT                   /db_xref="GOA:O35904"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1098211"
FT                   /db_xref="PDB:2WXF"
FT                   /db_xref="PDB:2WXG"
FT                   /db_xref="PDB:2WXH"
FT                   /db_xref="PDB:2WXI"
FT                   /db_xref="PDB:2WXJ"
FT                   /db_xref="PDB:2WXK"
FT                   /db_xref="PDB:2WXL"
FT                   /db_xref="PDB:2WXM"
FT                   /db_xref="PDB:2WXN"
FT                   /db_xref="PDB:2WXO"
FT                   /db_xref="PDB:2WXP"
FT                   /db_xref="PDB:2WXQ"
FT                   /db_xref="PDB:2WXR"
FT                   /db_xref="PDB:2X38"
FT                   /db_xref="PDB:4AJW"
FT                   /db_xref="PDB:4V0I"
FT                   /db_xref="PDB:4XE0"
FT                   /db_xref="PDB:5AE8"
FT                   /db_xref="PDB:5AE9"
FT                   /db_xref="PDB:5I4U"
FT                   /db_xref="PDB:5I6U"
FT                   /db_xref="PDB:5IS5"
FT                   /db_xref="PDB:5L72"
FT                   /db_xref="PDB:5NCY"
FT                   /db_xref="PDB:5NCZ"
FT                   /db_xref="PDB:5T27"
FT                   /db_xref="PDB:5T28"
FT                   /db_xref="PDB:5T2B"
FT                   /db_xref="PDB:5T2D"
FT                   /db_xref="PDB:5T2G"
FT                   /db_xref="PDB:5T2I"
FT                   /db_xref="PDB:5T2L"
FT                   /db_xref="PDB:5T2M"
FT                   /db_xref="PDB:5T7F"
FT                   /db_xref="PDB:5T8I"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35904"
FT                   /protein_id="EDL14872.1"
FT   assembly_gap    1906367..1906386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1908765..1908972
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    1910360..1910379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1935918..1936223
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    1937687..1937930
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    1943398..1946777
FT                   /estimated_length=3380
FT                   /gap_type="unknown"
FT   assembly_gap    1950636..1952089
FT                   /estimated_length=1454
FT                   /gap_type="unknown"
FT   assembly_gap    1955276..1955944
FT                   /estimated_length=669
FT                   /gap_type="unknown"
FT   assembly_gap    1958859..1958886
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            complement(1960949..>1968008)
FT                   /locus_tag="mCG_17402"
FT                   /note="gene_id=mCG17402.2"
FT   mRNA            complement(join(1960949..1962643,1963586..1963723,
FT                   1964217..1964510,1965078..1965149,1967776..>1968008))
FT                   /locus_tag="mCG_17402"
FT                   /product="mCG17402"
FT                   /note="gene_id=mCG17402.2 transcript_id=mCT12765.2 created
FT                   on 26-DEC-2002"
FT   CDS             complement(join(1962546..1962643,1963586..1963723,
FT                   1964217..1964510,1965078..1965149,1967776..>1968007))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17402"
FT                   /product="mCG17402"
FT                   /note="gene_id=mCG17402.2 transcript_id=mCT12765.2
FT                   protein_id=mCP19387.2"
FT                   /protein_id="EDL14874.1"
FT   gene            complement(1972688..1983626)
FT                   /locus_tag="mCG_17395"
FT                   /note="gene_id=mCG17395.2"
FT   mRNA            complement(join(1972688..1973005,1973477..1973826,
FT                   1975111..1975287,1976638..1976832,1977411..1977531,
FT                   1983416..1983626))
FT                   /locus_tag="mCG_17395"
FT                   /product="mCG17395, transcript variant mCT12520"
FT                   /note="gene_id=mCG17395.2 transcript_id=mCT12520.2 created
FT                   on 26-DEC-2002"
FT   CDS             complement(join(1972783..1973005,1973477..1973826,
FT                   1975111..1975287,1976638..1976832,1977411..1977531,
FT                   1983416..1983528))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17395"
FT                   /product="mCG17395, isoform CRA_a"
FT                   /note="gene_id=mCG17395.2 transcript_id=mCT12520.2
FT                   protein_id=mCP19367.2 isoform=CRA_a"
FT                   /protein_id="EDL14875.1"
FT   mRNA            complement(join(1974365..1975287,1976638..1976832,
FT                   1977411..1977531,1983416..>1983579))
FT                   /locus_tag="mCG_17395"
FT                   /product="mCG17395, transcript variant mCT190864"
FT                   /note="gene_id=mCG17395.2 transcript_id=mCT190864.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1974708..1975287,1976638..>1976723))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17395"
FT                   /product="mCG17395, isoform CRA_b"
FT                   /note="gene_id=mCG17395.2 transcript_id=mCT190864.0
FT                   protein_id=mCP111825.0 isoform=CRA_b"
FT                   /protein_id="EDL14876.1"
FT   assembly_gap    1988215..1988365
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   gene            complement(1989766..2021470)
FT                   /gene="5730438N18Rik"
FT                   /locus_tag="mCG_141690"
FT                   /note="gene_id=mCG141690.0"
FT   mRNA            complement(join(1989766..1989909,1989991..1990702,
FT                   1994813..1995093,1998168..1998234,1999562..1999662,
FT                   2001837..2001914,2008185..2008364,2021229..2021470))
FT                   /gene="5730438N18Rik"
FT                   /locus_tag="mCG_141690"
FT                   /product="RIKEN cDNA 5730438N18"
FT                   /note="gene_id=mCG141690.0 transcript_id=mCT176344.0
FT                   created on 27-NOV-2002"
FT   assembly_gap    1989910..1989990
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   CDS             complement(join(1990503..1990702,1994813..1995093,
FT                   1998168..1998234,1999562..1999662,2001837..2001914,
FT                   2008185..2008364,2021229..2021284))
FT                   /codon_start=1
FT                   /gene="5730438N18Rik"
FT                   /locus_tag="mCG_141690"
FT                   /product="RIKEN cDNA 5730438N18"
FT                   /note="gene_id=mCG141690.0 transcript_id=mCT176344.0
FT                   protein_id=mCP99266.0"
FT                   /protein_id="EDL14877.1"
FT   assembly_gap    2003818..2003897
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    2012793..2013608
FT                   /estimated_length=816
FT                   /gap_type="unknown"
FT   assembly_gap    2014849..2015291
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   assembly_gap    2016642..2016661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2019543..2020811
FT                   /estimated_length=1269
FT                   /gap_type="unknown"
FT   assembly_gap    2048674..2048693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2067127..2067146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2068369..2068388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2069665..2069684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2094034..2094080
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    2120247..2120266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2121806..2121943
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    2128533..2128552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2129625..2129644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2137712..2138162
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   gene            complement(2147034..2205787)
FT                   /gene="Spsb1"
FT                   /locus_tag="mCG_17401"
FT                   /note="gene_id=mCG17401.1"
FT   mRNA            complement(join(2147034..2149093,2157156..2157997,
FT                   2205603..2205787))
FT                   /gene="Spsb1"
FT                   /locus_tag="mCG_17401"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 1"
FT                   /note="gene_id=mCG17401.1 transcript_id=mCT12764.1 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(2148966..2149093,2157156..2157849))
FT                   /codon_start=1
FT                   /gene="Spsb1"
FT                   /locus_tag="mCG_17401"
FT                   /product="splA/ryanodine receptor domain and SOCS box
FT                   containing 1"
FT                   /note="gene_id=mCG17401.1 transcript_id=mCT12764.1
FT                   protein_id=mCP19380.1"
FT                   /protein_id="EDL14878.1"
FT   assembly_gap    2173679..2173728
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    2175768..2175839
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2189372..2189467
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    2192486..2192702
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    2204198..2204344
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    2211053..2211072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2213437..2213456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2214981..2215000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2216150..2216169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2229453..2230201
FT                   /estimated_length=749
FT                   /gap_type="unknown"
FT   gene            complement(2232850..2262420)
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /note="gene_id=mCG17411.2"
FT   mRNA            complement(join(2232850..2236319,2237456..2237725,
FT                   2248092..2248209,2249357..2249993,2262190..2262420))
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /product="hexose-6-phosphate dehydrogenase (glucose
FT                   1-dehydrogenase), transcript variant mCT12732"
FT                   /note="gene_id=mCG17411.2 transcript_id=mCT12732.2 created
FT                   on 26-DEC-2002"
FT   mRNA            complement(join(2234854..2236319,2237456..2237725,
FT                   2248092..2248209,2249357..2249993,2256638..2256828))
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /product="hexose-6-phosphate dehydrogenase (glucose
FT                   1-dehydrogenase), transcript variant mCT178512"
FT                   /note="gene_id=mCG17411.2 transcript_id=mCT178512.0 created
FT                   on 26-DEC-2002"
FT   CDS             complement(join(2234956..2236319,2237456..2237725,
FT                   2248092..2248209,2249357..2249993,2262190..2262194))
FT                   /codon_start=1
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /product="hexose-6-phosphate dehydrogenase (glucose
FT                   1-dehydrogenase), isoform CRA_a"
FT                   /note="gene_id=mCG17411.2 transcript_id=mCT12732.2
FT                   protein_id=mCP19372.1 isoform=CRA_a"
FT                   /protein_id="EDL14879.1"
FT   CDS             complement(join(2234956..2236319,2237456..2237725,
FT                   2248092..2248209,2249357..2249974))
FT                   /codon_start=1
FT                   /gene="H6pd"
FT                   /locus_tag="mCG_17411"
FT                   /product="hexose-6-phosphate dehydrogenase (glucose
FT                   1-dehydrogenase), isoform CRA_b"
FT                   /note="gene_id=mCG17411.2 transcript_id=mCT178512.0
FT                   protein_id=mCP101434.0 isoform=CRA_b"
FT                   /protein_id="EDL14880.1"
FT   assembly_gap    2244166..2244321
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    2260376..2260421
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    2286611..2286706
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    2313120..2313139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2314957..2314976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2334168..2334433
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   gene            2342786..2359759
FT                   /gene="Gpr157"
FT                   /locus_tag="mCG_55380"
FT                   /note="gene_id=mCG55380.2"
FT   mRNA            join(2342786..2343560,2354163..2354376,2356972..2357169,
FT                   2357604..2359759)
FT                   /gene="Gpr157"
FT                   /locus_tag="mCG_55380"
FT                   /product="G protein-coupled receptor 157"
FT                   /note="gene_id=mCG55380.2 transcript_id=mCT55563.1 created
FT                   on 11-FEB-2003"
FT   CDS             join(2343178..2343560,2354163..2354376,2356972..2357169,
FT                   2357604..2357801)
FT                   /codon_start=1
FT                   /gene="Gpr157"
FT                   /locus_tag="mCG_55380"
FT                   /product="G protein-coupled receptor 157"
FT                   /note="gene_id=mCG55380.2 transcript_id=mCT55563.1
FT                   protein_id=mCP25789.0"
FT                   /db_xref="GOA:Q148S2"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR022343"
FT                   /db_xref="MGI:MGI:2442046"
FT                   /db_xref="UniProtKB/TrEMBL:Q148S2"
FT                   /protein_id="EDL14881.1"
FT   assembly_gap    2352063..2352082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2360551..2360711
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            complement(2369256..2374249)
FT                   /locus_tag="mCG_147511"
FT                   /note="gene_id=mCG147511.0"
FT   mRNA            complement(join(2369256..2371507,2374031..2374249))
FT                   /locus_tag="mCG_147511"
FT                   /product="mCG147511"
FT                   /note="gene_id=mCG147511.0 transcript_id=mCT187774.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2370662..2370940)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147511"
FT                   /product="mCG147511"
FT                   /note="gene_id=mCG147511.0 transcript_id=mCT187774.0
FT                   protein_id=mCP109470.0"
FT                   /protein_id="EDL14882.1"
FT   assembly_gap    2371912..2372249
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   gene            2374715..2397918
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /note="gene_id=mCG130718.1"
FT   mRNA            join(2374715..2374922,2375027..2375420,2376056..2376137,
FT                   2380951..2381049,2381488..2381648,2384363..2384487,
FT                   2391276..2391428,2393584..2393709,2393794..2393981,
FT                   2394093..2394203,2394922..2395023,2396341..2396416,
FT                   2396963..2397090,2397188..2397918)
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 5, transcript variant mCT132043"
FT                   /note="gene_id=mCG130718.1 transcript_id=mCT132043.1
FT                   created on 27-NOV-2002"
FT   mRNA            join(2376079..2376137,2380951..2381049,2381488..2381648,
FT                   2384363..2384487,2391276..2391382,2394093..2394203,
FT                   2394922..2395023,2396341..2396416,2396963..2397090,
FT                   2397188..2397918)
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 5, transcript variant mCT176343"
FT                   /note="gene_id=mCG130718.1 transcript_id=mCT176343.0
FT                   created on 27-NOV-2002"
FT   CDS             join(2376108..2376137,2380951..2381049,2381488..2381648,
FT                   2384363..2384487,2391276..2391428,2393584..2393709,
FT                   2393794..2393981,2394093..2394203,2394922..2395023,
FT                   2396341..2396416,2396963..2397090,2397188..2397394)
FT                   /codon_start=1
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 5, isoform CRA_a"
FT                   /note="gene_id=mCG130718.1 transcript_id=mCT132043.1
FT                   protein_id=mCP76669.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WV38"
FT                   /db_xref="InterPro:IPR002442"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1928369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV38"
FT                   /protein_id="EDL14883.1"
FT   CDS             join(2376108..2376137,2380951..2381049,2381488..2381648,
FT                   2384363..2384487,2391276..2391382,2394093..2394203,
FT                   2394922..2395023,2396341..2396416,2396963..2397090,
FT                   2397188..2397394)
FT                   /codon_start=1
FT                   /gene="Slc2a5"
FT                   /locus_tag="mCG_130718"
FT                   /product="solute carrier family 2 (facilitated glucose
FT                   transporter), member 5, isoform CRA_b"
FT                   /note="gene_id=mCG130718.1 transcript_id=mCT176343.0
FT                   protein_id=mCP99265.0 isoform=CRA_b"
FT                   /protein_id="EDL14884.1"
FT   assembly_gap    2385592..2385662
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    2386440..2387114
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   assembly_gap    2393374..2393393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2403121..>2422733
FT                   /locus_tag="mCG_17184"
FT                   /note="gene_id=mCG17184.2"
FT   mRNA            join(<2403121..2403171,2403630..2403728,2406259..2406419,
FT                   2408802..2408926,2411652..2411804,2412296..2412421,
FT                   2412689..2412879,2414231..2414341,2417545..2417646,
FT                   2419456..2419531,2420703..2420830,2422515..>2422733)
FT                   /locus_tag="mCG_17184"
FT                   /product="mCG17184"
FT                   /note="gene_id=mCG17184.2 transcript_id=mCT16164.2 created
FT                   on 26-DEC-2002"
FT   CDS             join(2403121..2403171,2403630..2403728,2406259..2406419,
FT                   2408802..2408926,2411652..2411804,2412296..2412421,
FT                   2412689..2412879,2414231..2414341,2417545..2417646,
FT                   2419456..2419531,2420703..2420830,2422515..2422733)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17184"
FT                   /product="mCG17184"
FT                   /note="gene_id=mCG17184.2 transcript_id=mCT16164.2
FT                   protein_id=mCP2742.2"
FT                   /protein_id="EDL14885.1"
FT   assembly_gap    2405036..2405056
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    2416137..2416574
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    2421106..2421342
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    2424332..2424856
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   assembly_gap    2430748..2430770
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    2434232..2434822
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    2435422..2438722
FT                   /estimated_length=3301
FT                   /gap_type="unknown"
FT   gene            complement(2441070..2455745)
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /note="gene_id=mCG17185.2"
FT   mRNA            complement(join(2441070..2441560,2443504..2443627,
FT                   2446868..2447025,2448122..2448191,2450478..2450570,
FT                   2451740..2451888,2452521..2452703,2455471..2455745))
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /product="carbonic anhydrase 6, transcript variant
FT                   mCT16165"
FT                   /note="gene_id=mCG17185.2 transcript_id=mCT16165.2 created
FT                   on 27-NOV-2002"
FT   mRNA            complement(join(2441070..2441560,2443504..2443627,
FT                   2446868..2447025,2448122..2448191,2450478..2450570,
FT                   2451740..2451888,2452521..>2452892))
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /product="carbonic anhydrase 6, transcript variant
FT                   mCT190887"
FT                   /note="gene_id=mCG17185.2 transcript_id=mCT190887.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2441457..2441560,2443504..2443627,
FT                   2446868..2447025,2448122..2448191,2450478..2450570,
FT                   2451740..2451888,2452521..2452703,2455471..2455543))
FT                   /codon_start=1
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /product="carbonic anhydrase 6, isoform CRA_b"
FT                   /note="gene_id=mCG17185.2 transcript_id=mCT16165.2
FT                   protein_id=mCP2745.2 isoform=CRA_b"
FT                   /db_xref="GOA:P18761"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018428"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="MGI:MGI:1333786"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18761"
FT                   /protein_id="EDL14887.1"
FT   CDS             complement(join(2441457..2441560,2443504..2443627,
FT                   2446868..2447025,2448122..2448191,2450478..2450570,
FT                   2451740..2451888,2452521..>2452779))
FT                   /codon_start=1
FT                   /gene="Car6"
FT                   /locus_tag="mCG_17185"
FT                   /product="carbonic anhydrase 6, isoform CRA_a"
FT                   /note="gene_id=mCG17185.2 transcript_id=mCT190887.0
FT                   protein_id=mCP111824.0 isoform=CRA_a"
FT                   /protein_id="EDL14886.1"
FT   assembly_gap    2442943..2443289
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    2471218..2471545
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   gene            2482317..2482721
FT                   /pseudo
FT                   /locus_tag="mCG_50526"
FT                   /note="gene_id=mCG50526.2"
FT   mRNA            2482317..2482721
FT                   /pseudo
FT                   /locus_tag="mCG_50526"
FT                   /note="gene_id=mCG50526.2 transcript_id=mCT50709.1 created
FT                   on 23-DEC-2002"
FT   assembly_gap    2483429..2483488
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    2484277..2484724
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   gene            2491374..2503337
FT                   /locus_tag="mCG_17183"
FT                   /note="gene_id=mCG17183.2"
FT   mRNA            join(2491374..2491763,2493907..2494000,2495471..2495566,
FT                   2496548..2496606,2498430..2498499,2498666..2498799,
FT                   2499555..2499777,2501032..2501229,2501913..2502114,
FT                   2502293..2502401,2502523..2502581,2502948..2503337)
FT                   /locus_tag="mCG_17183"
FT                   /product="mCG17183"
FT                   /note="gene_id=mCG17183.2 transcript_id=mCT16163.1 created
FT                   on 27-NOV-2002"
FT   CDS             join(2493916..2494000,2495471..2495566,2496548..2496606,
FT                   2498430..2498499,2498666..2498799,2499555..2499777,
FT                   2501032..2501229,2501913..2502114,2502293..2502401,
FT                   2502523..2502581,2502948..2503017)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17183"
FT                   /product="mCG17183"
FT                   /note="gene_id=mCG17183.2 transcript_id=mCT16163.1
FT                   protein_id=mCP2747.1"
FT                   /db_xref="GOA:Q5FW97"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FW97"
FT                   /protein_id="EDL14888.1"
FT   assembly_gap    2500097..2500116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2524928..2525375
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    2526245..2526411
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    2529160..2530770
FT                   /estimated_length=1611
FT                   /gap_type="unknown"
FT   assembly_gap    2552920..2552948
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            complement(2569454..2569858)
FT                   /pseudo
FT                   /locus_tag="mCG_50522"
FT                   /note="gene_id=mCG50522.2"
FT   mRNA            complement(2569454..2569858)
FT                   /pseudo
FT                   /locus_tag="mCG_50522"
FT                   /note="gene_id=mCG50522.2 transcript_id=mCT50705.2 created
FT                   on 11-FEB-2003"
FT   assembly_gap    2588061..2588080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2602936..2603057
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    2611904..2611923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2622835..2622988
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    2636450..2636477
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            <2661183..2878397
FT                   /locus_tag="mCG_130721"
FT                   /note="gene_id=mCG130721.1"
FT   mRNA            join(<2661183..2661507,2686381..2686451,2694199..2694324,
FT                   2723534..2723639,2725134..2725230,2732229..2732333,
FT                   2754577..2754625,2763366..2763490,2764475..2764574,
FT                   2788418..2788516,2826666..2826746,2867285..2867447,
FT                   2868418..2868510,2868978..2869177,2870160..2870321,
FT                   2870575..2870688,2870912..2872266,2872376..2872598,
FT                   2873191..2873914,2874841..2874987,2875460..2875640,
FT                   2875891..2878397)
FT                   /locus_tag="mCG_130721"
FT                   /product="mCG130721"
FT                   /note="gene_id=mCG130721.1 transcript_id=mCT132046.2
FT                   created on 04-APR-2003"
FT   CDS             join(2661183..2661507,2686381..2686451,2694199..2694324,
FT                   2723534..2723639,2725134..2725230,2732229..2732333,
FT                   2754577..2754625,2763366..2763490,2764475..2764574,
FT                   2788418..2788516,2826666..2826746,2867285..2867447,
FT                   2868418..2868510,2868978..2869177,2870160..2870321,
FT                   2870575..2870688,2870912..2872266,2872376..2872598,
FT                   2873191..2873914,2874841..2874987,2875460..2875640,
FT                   2875891..2875924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_130721"
FT                   /product="mCG130721"
FT                   /note="gene_id=mCG130721.1 transcript_id=mCT132046.2
FT                   protein_id=mCP76686.2"
FT                   /protein_id="EDL14889.1"
FT   assembly_gap    2714629..2714764
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    2733843..2733989
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    2749229..2749825
FT                   /estimated_length=597
FT                   /gap_type="unknown"
FT   assembly_gap    2781146..2781396
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    2787277..2787586
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    2790502..2790521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2804305..2804324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2806094..2806113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2820596..2829937
FT                   /locus_tag="mCG_147508"
FT                   /note="gene_id=mCG147508.0"
FT   mRNA            join(2820596..2823496,2829813..2829937)
FT                   /locus_tag="mCG_147508"
FT                   /product="mCG147508"
FT                   /note="gene_id=mCG147508.0 transcript_id=mCT187771.0
FT                   created on 13-JAN-2004"
FT   CDS             join(2823322..2823496,2829813..2829856)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147508"
FT                   /product="mCG147508"
FT                   /note="gene_id=mCG147508.0 transcript_id=mCT187771.0
FT                   protein_id=mCP109468.0"
FT                   /protein_id="EDL14890.1"
FT   assembly_gap    2825544..2825902
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    2830528..2830872
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    2837354..2837374
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            complement(2885909..2908058)
FT                   /gene="Slc45a1"
FT                   /locus_tag="mCG_17186"
FT                   /note="gene_id=mCG17186.2"
FT   mRNA            complement(join(2885909..2886253,2887374..2887579,
FT                   2889789..2889965,2891363..2891516,2894435..2895171,
FT                   2898426..2898650,2899308..2899400,2899967..2900387,
FT                   2907952..2908058))
FT                   /gene="Slc45a1"
FT                   /locus_tag="mCG_17186"
FT                   /product="solute carrier family 45, member 1"
FT                   /note="gene_id=mCG17186.2 transcript_id=mCT16166.2 created
FT                   on 26-DEC-2002"
FT   CDS             complement(join(2885987..2886253,2887374..2887579,
FT                   2889789..2889965,2891363..2891516,2894435..2895171,
FT                   2898426..2898650,2899308..2899400,2899967..2900363))
FT                   /codon_start=1
FT                   /gene="Slc45a1"
FT                   /locus_tag="mCG_17186"
FT                   /product="solute carrier family 45, member 1"
FT                   /note="gene_id=mCG17186.2 transcript_id=mCT16166.2
FT                   protein_id=mCP2748.2"
FT                   /protein_id="EDL14891.1"
FT   assembly_gap    2895575..2896016
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    2897931..2897950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2899134..2899286
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    2909900..2910224
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    2915398..2915417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2934033..2934052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2942410..2942429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2950250..2950292
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2967102..2967129
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    2971664..2972490
FT                   /estimated_length=827
FT                   /gap_type="unknown"
FT   assembly_gap    2975820..2975839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2979040..2979080
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    2983479..2983849
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    2985902..2986964
FT                   /estimated_length=1063
FT                   /gap_type="unknown"
FT   assembly_gap    3006595..3006681
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    3010066..3010163
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    3014460..3014479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3018158..3019091
FT                   /estimated_length=934
FT                   /gap_type="unknown"
FT   assembly_gap    3031885..3031904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3035275..3035742
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    3036400..3036419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3041106..3041125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3046219..3046454
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    3047966..3048154
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    3049634..3049716
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            complement(3056681..3119426)
FT                   /locus_tag="mCG_147512"
FT                   /note="gene_id=mCG147512.0"
FT   mRNA            complement(join(3056681..3056702,3118372..3119426))
FT                   /locus_tag="mCG_147512"
FT                   /product="mCG147512"
FT                   /note="gene_id=mCG147512.0 transcript_id=mCT187775.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    3059236..3061885
FT                   /estimated_length=2650
FT                   /gap_type="unknown"
FT   assembly_gap    3078360..3078540
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   gene            <3082308..>3096348
FT                   /locus_tag="mCG_145229"
FT                   /note="gene_id=mCG145229.0"
FT   mRNA            join(<3082308..3082536,3088740..3088975,3096054..>3096348)
FT                   /locus_tag="mCG_145229"
FT                   /product="mCG145229"
FT                   /note="gene_id=mCG145229.0 transcript_id=mCT184653.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    3083265..3083500
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   gene            complement(3084991..3111556)
FT                   /locus_tag="mCG_1027359"
FT                   /note="gene_id=mCG1027359.1"
FT   mRNA            complement(join(3084991..3085249,3106453..3106575,
FT                   3111433..3111556))
FT                   /locus_tag="mCG_1027359"
FT                   /product="mCG1027359"
FT                   /note="gene_id=mCG1027359.1 transcript_id=mCT145063.1
FT                   created on 14-FEB-2003"
FT   CDS             complement(join(3085081..3085249,3106453..3106541))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027359"
FT                   /product="mCG1027359"
FT                   /note="gene_id=mCG1027359.1 transcript_id=mCT145063.1
FT                   protein_id=mCP76841.1"
FT                   /protein_id="EDL14894.1"
FT   CDS             join(<3088965..3088975,3096054..>3096348)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145229"
FT                   /product="mCG145229"
FT                   /note="gene_id=mCG145229.0 transcript_id=mCT184653.0
FT                   protein_id=mCP105931.0"
FT                   /protein_id="EDL14893.1"
FT   assembly_gap    3098719..3098738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3103755..3104231
FT                   /pseudo
FT                   /locus_tag="mCG_1027347"
FT                   /note="gene_id=mCG1027347.1"
FT   mRNA            3103755..3104231
FT                   /pseudo
FT                   /locus_tag="mCG_1027347"
FT                   /note="gene_id=mCG1027347.1 transcript_id=mCT145051.1
FT                   created on 29-JAN-2003"
FT   assembly_gap    3108754..3110627
FT                   /estimated_length=1874
FT                   /gap_type="unknown"
FT   gene            3111698..3125368
FT                   /gene="Errfi1"
FT                   /locus_tag="mCG_1312"
FT                   /note="gene_id=mCG1312.2"
FT   mRNA            join(3111698..3111878,3121557..3121751,3121846..3121922,
FT                   3122798..3125368)
FT                   /gene="Errfi1"
FT                   /locus_tag="mCG_1312"
FT                   /product="ERBB receptor feedback inhibitor 1"
FT                   /note="gene_id=mCG1312.2 transcript_id=mCT8615.2 created on
FT                   27-NOV-2002"
FT   assembly_gap    3111924..3112011
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   CDS             complement(3118868..3118984)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147512"
FT                   /product="mCG147512"
FT                   /note="gene_id=mCG147512.0 transcript_id=mCT187775.0
FT                   protein_id=mCP109471.0"
FT                   /protein_id="EDL14892.1"
FT   CDS             join(3121630..3121751,3121846..3121922,3122798..3123984)
FT                   /codon_start=1
FT                   /gene="Errfi1"
FT                   /locus_tag="mCG_1312"
FT                   /product="ERBB receptor feedback inhibitor 1"
FT                   /note="gene_id=mCG1312.2 transcript_id=mCT8615.2
FT                   protein_id=mCP21724.2"
FT                   /db_xref="GOA:Q3TK48"
FT                   /db_xref="InterPro:IPR015116"
FT                   /db_xref="InterPro:IPR021619"
FT                   /db_xref="MGI:MGI:1921405"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TK48"
FT                   /protein_id="EDL14895.1"
FT                   VSP"
FT   assembly_gap    3138687..3138706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3143330..3143595
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    3148331..3148676
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   gene            complement(3153691..3170982)
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /note="gene_id=mCG1310.2"
FT   mRNA            complement(join(3153691..3154020,3157563..3157649,
FT                   3160370..3160439,3161807..3161866,3163598..3163699,
FT                   3164882..3164987,3166347..3166414))
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7, transcript variant mCT8613"
FT                   /note="gene_id=mCG1310.2 transcript_id=mCT8613.1 created on
FT                   27-NOV-2002"
FT   mRNA            complement(join(3153784..3154020,3157563..3157649,
FT                   3160370..3160439,3161807..3161866,3163598..3163699,
FT                   3164882..3164987,3170878..3170982))
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7, transcript variant mCT176345"
FT                   /note="gene_id=mCG1310.2 transcript_id=mCT176345.0 created
FT                   on 27-NOV-2002"
FT   CDS             complement(join(3153860..3154020,3157563..3157649,
FT                   3160370..3160439,3161807..3161866,3163598..3163699,
FT                   3164882..3164971))
FT                   /codon_start=1
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7, isoform CRA_a"
FT                   /note="gene_id=mCG1310.2 transcript_id=mCT176345.0
FT                   protein_id=mCP99267.0 isoform=CRA_a"
FT                   /protein_id="EDL14896.1"
FT   CDS             complement(join(3153860..3154020,3157563..3157649,
FT                   3160370..3160439,3161807..3161866,3163598..3163699,
FT                   3164882..3164971))
FT                   /codon_start=1
FT                   /gene="Park7"
FT                   /locus_tag="mCG_1310"
FT                   /product="Parkinson disease (autosomal recessive, early
FT                   onset) 7, isoform CRA_a"
FT                   /note="gene_id=mCG1310.2 transcript_id=mCT8613.1
FT                   protein_id=mCP21736.1 isoform=CRA_a"
FT                   /protein_id="EDL14897.1"
FT   gene            3176746..3202631
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /note="gene_id=mCG1309.2"
FT   mRNA            join(3176746..3176818,3186354..3186478,3187265..3187369,
FT                   3188844..3188981,3189569..3189638,3190824..3190948,
FT                   3191959..3192093,3201310..3202631)
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, transcript variant mCT194205"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT194205.0 created
FT                   on 19-MAR-2004"
FT   mRNA            join(3181852..3181971,3186354..3186478,3187265..3187369,
FT                   3188844..3188981,3189569..3189638,3190824..3190948,
FT                   3191959..3192093,3201310..3202631)
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, transcript variant mCT8612"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT8612.2 created on
FT                   19-MAR-2004"
FT   mRNA            join(3184082..3184618,3186354..3186478,3187265..3187369,
FT                   3188844..3188981,3189569..3189638,3190824..3190948,
FT                   3191959..3192093,3201310..3202631)
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, transcript variant mCT187772"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT187772.1 created
FT                   on 19-MAR-2004"
FT   CDS             join(3186379..3186478,3187265..3187369,3188844..3188981,
FT                   3189569..3189638,3190824..3190948,3191959..3192093,
FT                   3201310..3201407)
FT                   /codon_start=1
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, isoform CRA_a"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT187772.1
FT                   protein_id=mCP109467.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U3R1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020413"
FT                   /db_xref="InterPro:IPR034020"
FT                   /db_xref="MGI:MGI:1101059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3R1"
FT                   /protein_id="EDL14898.1"
FT   CDS             join(3186379..3186478,3187265..3187369,3188844..3188981,
FT                   3189569..3189638,3190824..3190948,3191959..3192093,
FT                   3201310..3201407)
FT                   /codon_start=1
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, isoform CRA_a"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT194205.0
FT                   protein_id=mCP115234.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U3R1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020413"
FT                   /db_xref="InterPro:IPR034020"
FT                   /db_xref="MGI:MGI:1101059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3R1"
FT                   /protein_id="EDL14899.1"
FT   CDS             join(3186379..3186478,3187265..3187369,3188844..3188981,
FT                   3189569..3189638,3190824..3190948,3191959..3192093,
FT                   3201310..3201407)
FT                   /codon_start=1
FT                   /gene="Tnfrsf9"
FT                   /locus_tag="mCG_1309"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 9, isoform CRA_a"
FT                   /note="gene_id=mCG1309.2 transcript_id=mCT8612.2
FT                   protein_id=mCP21725.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U3R1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020413"
FT                   /db_xref="InterPro:IPR034020"
FT                   /db_xref="MGI:MGI:1101059"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3R1"
FT                   /protein_id="EDL14900.1"
FT   assembly_gap    3219943..3219962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3249312..3249331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3252306..3257020
FT                   /gene="Uts2"
FT                   /locus_tag="mCG_1308"
FT                   /note="gene_id=mCG1308.1"
FT   mRNA            join(3252306..3252444,3254247..3254357,3255351..3255394,
FT                   3256777..3257020)
FT                   /gene="Uts2"
FT                   /locus_tag="mCG_1308"
FT                   /product="urotensin 2"
FT                   /note="gene_id=mCG1308.1 transcript_id=mCT8611.0 created on
FT                   27-NOV-2002"
FT   CDS             join(3252342..3252444,3254247..3254357,3255351..3255394,
FT                   3256777..3256890)
FT                   /codon_start=1
FT                   /gene="Uts2"
FT                   /locus_tag="mCG_1308"
FT                   /product="urotensin 2"
FT                   /note="gene_id=mCG1308.1 transcript_id=mCT8611.0
FT                   protein_id=mCP21716.1"
FT                   /db_xref="GOA:Q541G7"
FT                   /db_xref="InterPro:IPR001483"
FT                   /db_xref="MGI:MGI:1346329"
FT                   /db_xref="UniProtKB/TrEMBL:Q541G7"
FT                   /protein_id="EDL14901.1"
FT   gene            complement(3259922..>3299749)
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /note="gene_id=mCG1307.1"
FT   mRNA            complement(join(3259922..3261169,3263438..3263588,
FT                   3264460..3264643,3265622..3265717,3267460..3268151,
FT                   3268761..3268988,3273118..3273285,3273437..3273552,
FT                   3274071..3274206,3279629..3279758,3280291..3280419,
FT                   3281332..3281437,3283969..3284125,3284356..3284462,
FT                   3287133..3287211,3289077..3289216,3293109..3293157,
FT                   3296467..3296668,3297836..3297951,3298719..3298864,
FT                   3299268..>3299749))
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /product="period homolog 3 (Drosophila), transcript variant
FT                   mCT190876"
FT                   /note="gene_id=mCG1307.1 transcript_id=mCT190876.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3259922..3261169,3263438..3263588,
FT                   3264460..3264643,3265615..3265717,3267460..3268151,
FT                   3268761..3268988,3273118..3273285,3273437..3273552,
FT                   3274071..3274206,3279629..3279758,3280291..3280419,
FT                   3281332..3281437,3283969..3284125,3284356..3284462,
FT                   3287133..3287211,3289077..3289216,3293109..3293157,
FT                   3296467..3296668,3297836..3297951,3298719..3298864,
FT                   3299268..3299749))
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /product="period homolog 3 (Drosophila), transcript variant
FT                   mCT8610"
FT                   /note="gene_id=mCG1307.1 transcript_id=mCT8610.2 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(3261086..3261169,3263438..3263588,
FT                   3264460..3264643,3265615..3265717,3267460..3268151,
FT                   3268761..3268988,3273118..3273285,3273437..3273552,
FT                   3274071..3274206,3279629..3279758,3280291..3280419,
FT                   3281332..3281437,3283969..3284125,3284356..3284462,
FT                   3287133..3287211,3289077..3289216,3293109..3293157,
FT                   3296467..3296668,3297836..3297951,3298719..3298864,
FT                   3299268..3299392))
FT                   /codon_start=1
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /product="period homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG1307.1 transcript_id=mCT8610.2
FT                   protein_id=mCP21697.2 isoform=CRA_b"
FT                   /protein_id="EDL14903.1"
FT                   QHPAEDTS"
FT   CDS             complement(join(3264509..3264643,3265622..3265717,
FT                   3267460..3268151,3268761..3268988,3273118..3273285,
FT                   3273437..3273552,3274071..3274206,3279629..3279758,
FT                   3280291..3280419,3281332..3281437,3283969..3284125,
FT                   3284356..3284462,3287133..3287211,3289077..3289216,
FT                   3293109..3293157,3296467..3296668,3297836..3297951,
FT                   3298719..3298864,3299268..>3299407))
FT                   /codon_start=1
FT                   /gene="Per3"
FT                   /locus_tag="mCG_1307"
FT                   /product="period homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG1307.1 transcript_id=mCT190876.0
FT                   protein_id=mCP111812.0 isoform=CRA_a"
FT                   /protein_id="EDL14902.1"
FT   assembly_gap    3293763..3293838
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            complement(3302992..3313158)
FT                   /gene="Vamp3"
FT                   /locus_tag="mCG_1306"
FT                   /note="gene_id=mCG1306.2"
FT   mRNA            complement(join(3302992..3304212,3305144..3305195,
FT                   3306068..3306226,3311224..3311305,3313136..3313158))
FT                   /gene="Vamp3"
FT                   /locus_tag="mCG_1306"
FT                   /product="vesicle-associated membrane protein 3"
FT                   /note="gene_id=mCG1306.2 transcript_id=mCT8609.1 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(3304196..3304212,3305144..3305195,
FT                   3306068..3306226,3311224..3311305,3313136..3313137))
FT                   /codon_start=1
FT                   /gene="Vamp3"
FT                   /locus_tag="mCG_1306"
FT                   /product="vesicle-associated membrane protein 3"
FT                   /note="gene_id=mCG1306.2 transcript_id=mCT8609.1
FT                   protein_id=mCP21692.1"
FT                   /protein_id="EDL14904.1"
FT   gene            complement(3314787..3714788)
FT                   /locus_tag="mCG_142030"
FT                   /note="gene_id=mCG142030.0"
FT   mRNA            complement(join(3314787..3318118,3331042..3331116,
FT                   3333039..3333232,3335811..3335882,3336754..3337000,
FT                   3337665..3337852,3338526..3338597,3339443..3339689,
FT                   3340349..3340536,3344339..3344862,3345225..3345540,
FT                   3346221..3346299,3346675..3346871,3349489..3349640,
FT                   3392332..3392466,3399103..3399229,3404700..3406552,
FT                   3409320..3409460,3424743..3424896,3551263..3551334,
FT                   3714625..3714788))
FT                   /locus_tag="mCG_142030"
FT                   /product="mCG142030"
FT                   /note="gene_id=mCG142030.0 transcript_id=mCT178503.0
FT                   created on 26-DEC-2002"
FT   CDS             complement(join(3318055..3318118,3331042..3331116,
FT                   3333039..3333232,3335811..3335882,3336754..3337000,
FT                   3337665..3337852,3338526..3338597,3339443..3339689,
FT                   3340349..3340536,3344339..3344862,3345225..3345540,
FT                   3346221..3346299,3346675..3346871,3349489..3349640,
FT                   3392332..3392466,3399103..3399229,3404700..3406552,
FT                   3409320..3409460,3424743..3424896,3551263..3551334,
FT                   3714625..3714744))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142030"
FT                   /product="mCG142030"
FT                   /note="gene_id=mCG142030.0 transcript_id=mCT178503.0
FT                   protein_id=mCP101425.0"
FT                   /protein_id="EDL14905.1"
FT   assembly_gap    3327422..3327441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3328629..3328648
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3329667..3330169
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    3331293..3331312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3332371..3332390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3338032..3338051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3377829..3377976
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    3401687..3401888
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    3406794..3407059
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    3413488..3413558
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    3415231..3415372
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    3441160..3441205
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3443614..3443678
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    3471542..3471576
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    3477163..3477182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3487577..3487899
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    3488862..3489208
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    3491018..3491190
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    3499771..3499790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3545635..3545765
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    3560834..3560853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3591930..3592090
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    3636761..3636780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3637663..3640746
FT                   /locus_tag="mCG_1027405"
FT                   /note="gene_id=mCG1027405.1"
FT   mRNA            join(3637663..3637724,3639751..3640746)
FT                   /locus_tag="mCG_1027405"
FT                   /product="mCG1027405"
FT                   /note="gene_id=mCG1027405.1 transcript_id=mCT145109.1
FT                   created on 16-DEC-2002"
FT   CDS             3640362..3640487
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027405"
FT                   /product="mCG1027405"
FT                   /note="gene_id=mCG1027405.1 transcript_id=mCT145109.1
FT                   protein_id=mCP76768.1"
FT                   /protein_id="EDL14906.1"
FT   assembly_gap    3682264..3682370
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    3706460..3706479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3710176..3710222
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    3725297..3725316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3726646..3726665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3727767..3727786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3729396..3729415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3747044..3747554
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    3759281..3759306
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    3775970..3775989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3782459..3782478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3786404..3786423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3802116..3802135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3807257..3807434
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    3814203..3815257
FT                   /estimated_length=1055
FT                   /gap_type="unknown"
FT   assembly_gap    3837293..3837803
FT                   /estimated_length=511
FT                   /gap_type="unknown"
FT   assembly_gap    3847424..3847580
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    3848774..3848793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3853035..3853404
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    3854844..3854863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3883777..3883842
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    3888323..3891047
FT                   /estimated_length=2725
FT                   /gap_type="unknown"
FT   assembly_gap    3892184..3892203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3894611..3894630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3906272..3906355
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    3907323..3907508
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    3915473..3915492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3945862..3947604
FT                   /estimated_length=1743
FT                   /gap_type="unknown"
FT   assembly_gap    3954889..3954908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3956562..3957739
FT                   /estimated_length=1178
FT                   /gap_type="unknown"
FT   assembly_gap    3969676..3969695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4062142..>4105909)
FT                   /locus_tag="mCG_1027353"
FT                   /note="gene_id=mCG1027353.1"
FT   mRNA            complement(join(4062142..4062297,4062348..4062431,
FT                   4100473..4100591,4105871..>4105909))
FT                   /locus_tag="mCG_1027353"
FT                   /product="mCG1027353"
FT                   /note="gene_id=mCG1027353.1 transcript_id=mCT145057.1
FT                   created on 16-DEC-2002"
FT   CDS             complement(join(4062423..4062431,4100473..4100591,
FT                   4105871..>4105907))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027353"
FT                   /product="mCG1027353"
FT                   /note="gene_id=mCG1027353.1 transcript_id=mCT145057.1
FT                   protein_id=mCP76815.1"
FT                   /protein_id="EDL14907.1"
FT                   HRWNTNERS"
FT   assembly_gap    4082030..4082138
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    4096329..4096545
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    4102288..4102716
FT                   /estimated_length=429
FT                   /gap_type="unknown"
FT   assembly_gap    4115473..4130572
FT                   /estimated_length=15100
FT                   /gap_type="unknown"
FT   assembly_gap    4155402..4156229
FT                   /estimated_length=828
FT                   /gap_type="unknown"
FT   assembly_gap    4162710..4162729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4171293..4171502
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    4192414..4192433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4198035..4198058
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            4198202..4246364
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /note="gene_id=mCG4084.2"
FT   mRNA            join(4198202..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4234254..4234376,
FT                   4235265..4235338,4237888..4238077,4238168..4238253,
FT                   4238605..4238721,4241359..4241514,4242408..4242477,
FT                   4243681..4243738,4243853..4243995,4244327..4244456,
FT                   4245112..4246364)
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   transcript variant mCT2701"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT2701.2 created on
FT                   27-DEC-2002"
FT   mRNA            join(<4198237..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4234254..4234376,
FT                   4235265..4235338,4237888..4238077,4238168..4241093)
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   transcript variant mCT190850"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT190850.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4198248..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4237888..4238077)
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   transcript variant mCT178514"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT178514.0 created
FT                   on 27-DEC-2002"
FT   CDS             join(<4198253..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4234254..4234376,
FT                   4235265..4235338,4237888..4238077,4238168..4238257)
FT                   /codon_start=1
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT190850.0
FT                   protein_id=mCP111862.0 isoform=CRA_c"
FT                   /protein_id="EDL14910.1"
FT   mRNA            join(<4198256..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4235265..4235338,
FT                   4237888..4238077,4238168..>4238204)
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   transcript variant mCT190849"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT190849.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4198256..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4235265..4235338,
FT                   4237888..4238077,4238168..>4238204)
FT                   /codon_start=1
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT190849.0
FT                   protein_id=mCP111861.0 isoform=CRA_b"
FT                   /protein_id="EDL14909.1"
FT   CDS             join(4198265..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4232903..4233031,4234254..4234376,
FT                   4235265..4235338,4237888..4238077,4238168..4238253,
FT                   4238605..4238721,4241359..4241514,4242408..4242477,
FT                   4243681..4243738,4243853..4243995,4244327..4244456,
FT                   4245112..4245137)
FT                   /codon_start=1
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT2701.2
FT                   protein_id=mCP21711.2 isoform=CRA_d"
FT                   /protein_id="EDL14911.1"
FT   CDS             join(4198265..4198336,4214784..4214913,4217232..4217305,
FT                   4221493..4221594,4237888..4238049)
FT                   /codon_start=1
FT                   /gene="Dnajc11"
FT                   /locus_tag="mCG_4084"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 11,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG4084.2 transcript_id=mCT178514.0
FT                   protein_id=mCP101436.0 isoform=CRA_a"
FT                   /protein_id="EDL14908.1"
FT                   ALGYPVSHEHQHRPGH"
FT   assembly_gap    4198395..4198777
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    4202712..4202731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4210548..4210621
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   gene            complement(4247045..4253462)
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /note="gene_id=mCG4089.2"
FT   mRNA            complement(join(4247045..4247761,4248044..4248145,
FT                   4250078..4250270,4253242..4253462))
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /product="THAP domain containing, apoptosis associated
FT                   protein 3, transcript variant mCT2682"
FT                   /note="gene_id=mCG4089.2 transcript_id=mCT2682.2 created on
FT                   20-DEC-2002"
FT   mRNA            complement(join(4247048..4247761,4250078..4250270,
FT                   4253242..>4253330))
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /product="THAP domain containing, apoptosis associated
FT                   protein 3, transcript variant mCT190861"
FT                   /note="gene_id=mCG4089.2 transcript_id=mCT190861.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(4247474..4247761,4250078..4250270,
FT                   4253242..>4253330))
FT                   /codon_start=1
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /product="THAP domain containing, apoptosis associated
FT                   protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG4089.2 transcript_id=mCT190861.0
FT                   protein_id=mCP111864.0 isoform=CRA_a"
FT                   /protein_id="EDL14912.1"
FT   CDS             complement(join(4247474..4247761,4248044..4248145,
FT                   4250078..4250270,4253242..4253315))
FT                   /codon_start=1
FT                   /gene="Thap3"
FT                   /locus_tag="mCG_4089"
FT                   /product="THAP domain containing, apoptosis associated
FT                   protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG4089.2 transcript_id=mCT2682.2
FT                   protein_id=mCP21742.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q52KE1"
FT                   /db_xref="InterPro:IPR006612"
FT                   /db_xref="InterPro:IPR026520"
FT                   /db_xref="MGI:MGI:1917126"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KE1"
FT                   /protein_id="EDL14913.1"
FT   assembly_gap    4251938..4251957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4255859..4255878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4255879..>4260595)
FT                   /gene="Phf13"
FT                   /locus_tag="mCG_4082"
FT                   /note="gene_id=mCG4082.2"
FT   mRNA            complement(join(4255879..4256188,4256479..4257001,
FT                   4258399..4258500,4260260..>4260595))
FT                   /gene="Phf13"
FT                   /locus_tag="mCG_4082"
FT                   /product="PHD finger protein 13"
FT                   /note="gene_id=mCG4082.2 transcript_id=mCT2727.2 created on
FT                   25-APR-2003"
FT   CDS             complement(join(4255962..4256188,4256479..4257001,
FT                   4258399..>4258500))
FT                   /codon_start=1
FT                   /gene="Phf13"
FT                   /locus_tag="mCG_4082"
FT                   /product="PHD finger protein 13"
FT                   /note="gene_id=mCG4082.2 transcript_id=mCT2727.2
FT                   protein_id=mCP21708.2"
FT                   /protein_id="EDL14914.1"
FT                   LD"
FT   assembly_gap    4259551..4260257
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   assembly_gap    4263548..4263699
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    4266141..4266160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4269423..4269442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4272288..4275150)
FT                   /locus_tag="mCG_147513"
FT                   /note="gene_id=mCG147513.0"
FT   mRNA            complement(4272288..4275150)
FT                   /locus_tag="mCG_147513"
FT                   /product="mCG147513"
FT                   /note="gene_id=mCG147513.0 transcript_id=mCT187776.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(4274243..4274473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147513"
FT                   /product="mCG147513"
FT                   /note="gene_id=mCG147513.0 transcript_id=mCT187776.0
FT                   protein_id=mCP109472.0"
FT                   /protein_id="EDL14915.1"
FT   gene            <4274472..4283207
FT                   /locus_tag="mCG_4080"
FT                   /note="gene_id=mCG4080.2"
FT   mRNA            join(<4274472..4275492,4277829..4278234,4279836..4279908,
FT                   4280864..4283207)
FT                   /locus_tag="mCG_4080"
FT                   /product="mCG4080"
FT                   /note="gene_id=mCG4080.2 transcript_id=mCT2732.2 created on
FT                   20-DEC-2002"
FT   CDS             join(4274472..4275492,4277829..4278234,4279836..4279908,
FT                   4280864..4281157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4080"
FT                   /product="mCG4080"
FT                   /note="gene_id=mCG4080.2 transcript_id=mCT2732.2
FT                   protein_id=mCP21765.2"
FT                   /db_xref="GOA:Q3U410"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR011705"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017096"
FT                   /db_xref="MGI:MGI:1919288"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3U410"
FT                   /protein_id="EDL14916.1"
FT   gene            complement(4285302..>4293433)
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /note="gene_id=mCG4092.3"
FT   mRNA            complement(join(4285302..4285649,4285719..4285807,
FT                   4286073..4286237,4286308..4286444,4286818..4286972,
FT                   4287071..4287157,4287556..4287648,4288225..4288336,
FT                   4291539..4291780,4292149..4292820,4293304..4293420))
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, transcript
FT                   variant mCT2665"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT2665.1 created on
FT                   02-DEC-2002"
FT   mRNA            complement(join(4285303..4285649,4285719..4285807,
FT                   4286073..4286233,4286308..4286444,4286818..4287157,
FT                   4287556..4287648,4288225..4288336,4291539..4291780,
FT                   4292149..4292820,4293304..4293422))
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, transcript
FT                   variant mCT176829"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT176829.0 created
FT                   on 02-DEC-2002"
FT   mRNA            complement(join(4285304..4285649,4285719..4285807,
FT                   4286073..4286237,4286308..4286444,4286818..4286972,
FT                   4287071..4287157,4287556..4287763,4288225..4288336,
FT                   4291539..4292820,4293304..>4293433))
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, transcript
FT                   variant mCT190889"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT190889.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(4285353..4285649,4285719..4285807,
FT                   4286073..4286237,4286308..4286444,4286818..4286972,
FT                   4287071..4287157,4287556..4287648,4288225..4288336,
FT                   4291539..4291780,4292149..4292817))
FT                   /codon_start=1
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, isoform CRA_b"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT2665.1
FT                   protein_id=mCP21755.2 isoform=CRA_b"
FT                   /protein_id="EDL14918.1"
FT   CDS             complement(join(4285353..4285649,4285719..4285807,
FT                   4286073..4286237,4286308..4286444,4286818..4286972,
FT                   4287071..4287157,4287556..4287763,4288225..>4288238))
FT                   /codon_start=1
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, isoform CRA_a"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT190889.0
FT                   protein_id=mCP111865.0 isoform=CRA_a"
FT                   /protein_id="EDL14917.1"
FT   CDS             complement(join(4286183..4286233,4286308..4286444,
FT                   4286818..4287157,4287556..4287648,4288225..4288336,
FT                   4291539..4291780,4292149..4292817))
FT                   /codon_start=1
FT                   /gene="Hkr3"
FT                   /locus_tag="mCG_4092"
FT                   /product="GLI-Kruppel family member HKR3, isoform CRA_c"
FT                   /note="gene_id=mCG4092.3 transcript_id=mCT176829.0
FT                   protein_id=mCP99751.0 isoform=CRA_c"
FT                   /protein_id="EDL14919.1"
FT   gene            complement(4293675..4304337)
FT                   /gene="Tas1r1"
FT                   /locus_tag="mCG_4091"
FT                   /note="gene_id=mCG4091.1"
FT   mRNA            complement(join(4293675..4294758,4296544..4296664,
FT                   4297081..4297293,4297673..4298434,4300370..4300676,
FT                   4303962..4304337))
FT                   /gene="Tas1r1"
FT                   /locus_tag="mCG_4091"
FT                   /product="taste receptor, type 1, member 1"
FT                   /note="gene_id=mCG4091.1 transcript_id=mCT2666.1 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(4293827..4294758,4296544..4296664,
FT                   4297081..4297293,4297673..4298434,4300370..4300676,
FT                   4303962..4304155))
FT                   /codon_start=1
FT                   /gene="Tas1r1"
FT                   /locus_tag="mCG_4091"
FT                   /product="taste receptor, type 1, member 1"
FT                   /note="gene_id=mCG4091.1 transcript_id=mCT2666.1
FT                   protein_id=mCP21752.2"
FT                   /db_xref="GOA:Q3U5H1"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1927505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U5H1"
FT                   /protein_id="EDL14920.1"
FT   assembly_gap    4295149..4295197
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    4302161..4302336
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   gene            4305089..4327198
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /note="gene_id=mCG4087.2"
FT   mRNA            join(4305089..4305577,4306817..4307036,4307287..4307414,
FT                   4311465..4311600,4311718..4311805,4312317..4312414,
FT                   4316305..4316466,4317528..4317828,4318368..4318479,
FT                   4321675..4321852,4323495..4323628,4326957..4327198)
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /product="nucleolar protein 9, transcript variant mCT2684"
FT                   /note="gene_id=mCG4087.2 transcript_id=mCT2684.2 created on
FT                   02-DEC-2002"
FT   CDS             join(4305125..4305577,4306817..4307036,4307287..4307414,
FT                   4311465..4311600,4311718..4311805,4312317..4312414,
FT                   4316305..4316466,4317528..4317828,4318368..4318479,
FT                   4321675..4321852,4323495..4323628,4326957..4326962)
FT                   /codon_start=1
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /product="nucleolar protein 9, isoform CRA_b"
FT                   /note="gene_id=mCG4087.2 transcript_id=mCT2684.2
FT                   protein_id=mCP21713.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TZX8"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="MGI:MGI:1921285"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TZX8"
FT                   /protein_id="EDL14922.1"
FT   mRNA            join(<4305133..4305577,4306817..4307036,4307287..4307414,
FT                   4311465..4311600,4312317..4312414,4316305..4316466,
FT                   4317528..4317828,4318368..4318479,4321675..4321852,
FT                   4323495..4323628,4324045..4325728)
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /product="nucleolar protein 9, transcript variant
FT                   mCT190857"
FT                   /note="gene_id=mCG4087.2 transcript_id=mCT190857.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4311557..4311600,4312317..4312414,4316305..4316466,
FT                   4317528..4317828,4318368..4318479,4321675..4321852,
FT                   4323495..4323628,4324045..4324179)
FT                   /codon_start=1
FT                   /gene="Nol9"
FT                   /locus_tag="mCG_4087"
FT                   /product="nucleolar protein 9, isoform CRA_a"
FT                   /note="gene_id=mCG4087.2 transcript_id=mCT190857.0
FT                   protein_id=mCP111863.0 isoform=CRA_a"
FT                   /protein_id="EDL14921.1"
FT   assembly_gap    4320524..4321003
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    4322947..4323055
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    4329676..4329712
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    4338734..4339144
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    4346581..4346642
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    4352456..4352863
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    4363660..4363679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4374351..4381300
FT                   /gene="Plekhg5"
FT                   /locus_tag="mCG_145231"
FT                   /note="gene_id=mCG145231.0"
FT   mRNA            join(<4374351..4374455,4374593..4374712,4378023..4378155,
FT                   4378238..4378353,4378434..4378615,4379713..4380483,
FT                   4380745..4381300)
FT                   /gene="Plekhg5"
FT                   /locus_tag="mCG_145231"
FT                   /product="pleckstrin homology domain containing, family G
FT                   (with RhoGef domain) member 5"
FT                   /note="gene_id=mCG145231.0 transcript_id=mCT184655.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4374351..4374455,4374593..4374712,4378023..4378155,
FT                   4378238..4378353,4378434..4378615,4379713..4380483,
FT                   4380745..4380754)
FT                   /codon_start=1
FT                   /gene="Plekhg5"
FT                   /locus_tag="mCG_145231"
FT                   /product="pleckstrin homology domain containing, family G
FT                   (with RhoGef domain) member 5"
FT                   /note="gene_id=mCG145231.0 transcript_id=mCT184655.0
FT                   protein_id=mCP105932.0"
FT                   /protein_id="EDL14923.1"
FT   gene            4381849..4386034
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /note="gene_id=mCG4090.2"
FT   mRNA            join(4381849..4382029,4382500..4382638,4382846..4382980,
FT                   4383293..4383457,4383555..4383609,4384162..4384217,
FT                   4384316..4384414,4384605..4384642,4385075..4385258,
FT                   4385426..4386034)
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 25, transcript variant mCT2672"
FT                   /note="gene_id=mCG4090.2 transcript_id=mCT2672.2 created on
FT                   03-DEC-2002"
FT   CDS             join(4381994..4382029,4382500..4382638,4382846..4382980,
FT                   4383293..4383457,4383555..4383609,4384162..4384217,
FT                   4384316..4384414,4384605..4384642,4385075..4385258,
FT                   4385426..4385754)
FT                   /codon_start=1
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 25, isoform CRA_b"
FT                   /note="gene_id=mCG4090.2 transcript_id=mCT2672.2
FT                   protein_id=mCP21748.1 isoform=CRA_b"
FT                   /db_xref="GOA:B1AWN9"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR022329"
FT                   /db_xref="InterPro:IPR034050"
FT                   /db_xref="MGI:MGI:1934667"
FT                   /db_xref="UniProtKB/TrEMBL:B1AWN9"
FT                   /protein_id="EDL14925.1"
FT                   AEDLRSRLQRGP"
FT   mRNA            join(4382258..4382638,4382846..4382980,4383293..4383457,
FT                   4384316..4384414,4384605..4384642,4385075..4385258,
FT                   4385426..4386019)
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 25, transcript variant mCT176828"
FT                   /note="gene_id=mCG4090.2 transcript_id=mCT176828.0 created
FT                   on 03-DEC-2002"
FT   CDS             join(4382425..4382638,4382846..4382980,4383293..4383457,
FT                   4384316..4384414,4384605..4384642,4385075..4385258,
FT                   4385426..4385754)
FT                   /codon_start=1
FT                   /gene="Tnfrsf25"
FT                   /locus_tag="mCG_4090"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 25, isoform CRA_a"
FT                   /note="gene_id=mCG4090.2 transcript_id=mCT176828.0
FT                   protein_id=mCP99750.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VD70"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR022329"
FT                   /db_xref="InterPro:IPR034050"
FT                   /db_xref="MGI:MGI:1934667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VD70"
FT                   /protein_id="EDL14924.1"
FT   gene            complement(<4387036..4401633)
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /note="gene_id=mCG4085.2"
FT   mRNA            complement(join(<4387036..4387180,4389532..4389543,
FT                   4389629..4389708,4393982..4394245,4394321..4394466,
FT                   4396686..4396878,4396969..4397211,4400078..4400391,
FT                   4401432..4401633))
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /product="espin, transcript variant mCT176827"
FT                   /note="gene_id=mCG4085.2 transcript_id=mCT176827.0 created
FT                   on 05-DEC-2002"
FT   CDS             complement(join(4387036..4387180,4389532..4389543,
FT                   4389629..4389708,4393982..4394245,4394321..4394466,
FT                   4396686..4396878,4396969..4397211,4400078..4400391,
FT                   4401432..4401597))
FT                   /codon_start=1
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /product="espin, isoform CRA_a"
FT                   /note="gene_id=mCG4085.2 transcript_id=mCT176827.0
FT                   protein_id=mCP99749.0 isoform=CRA_a"
FT                   /protein_id="EDL14926.1"
FT                   IPK"
FT   mRNA            complement(join(<4387036..4387180,4389532..4389543,
FT                   4389629..4389708,4393982..4394466,4394683..>4394722))
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /product="espin, transcript variant mCT2704"
FT                   /note="gene_id=mCG4085.2 transcript_id=mCT2704.2 created on
FT                   05-DEC-2002"
FT   CDS             complement(join(4387036..4387180,4389532..4389543,
FT                   4389629..4389708,4393982..4394466,4394683..4394722))
FT                   /codon_start=1
FT                   /gene="Espn"
FT                   /locus_tag="mCG_4085"
FT                   /product="espin, isoform CRA_b"
FT                   /note="gene_id=mCG4085.2 transcript_id=mCT2704.2
FT                   protein_id=mCP21710.2 isoform=CRA_b"
FT                   /protein_id="EDL14927.1"
FT   assembly_gap    4407488..4408831
FT                   /estimated_length=1344
FT                   /gap_type="unknown"
FT   assembly_gap    4409338..4410273
FT                   /estimated_length=936
FT                   /gap_type="unknown"
FT   gene            4421740..4423252
FT                   /pseudo
FT                   /locus_tag="mCG_131423"
FT                   /note="gene_id=mCG131423.0"
FT   mRNA            join(4421740..4421814,4422049..4422403,4422610..4423252)
FT                   /pseudo
FT                   /locus_tag="mCG_131423"
FT                   /note="gene_id=mCG131423.0 transcript_id=mCT132758.0
FT                   created on 27-DEC-2002"
FT   gene            4424559..>4426239
FT                   /gene="Hes2"
FT                   /locus_tag="mCG_4081"
FT                   /note="gene_id=mCG4081.2"
FT   mRNA            join(4424559..4424680,4425356..4425403,4425495..4425590,
FT                   4425819..4425918,4426007..>4426239)
FT                   /gene="Hes2"
FT                   /locus_tag="mCG_4081"
FT                   /product="hairy and enhancer of split 2 (Drosophila)"
FT                   /note="gene_id=mCG4081.2 transcript_id=mCT2726.1 created on
FT                   06-DEC-2002"
FT   CDS             join(4425359..4425403,4425495..4425590,4425819..4425918,
FT                   4426007..4426239)
FT                   /codon_start=1
FT                   /gene="Hes2"
FT                   /locus_tag="mCG_4081"
FT                   /product="hairy and enhancer of split 2 (Drosophila)"
FT                   /note="gene_id=mCG4081.2 transcript_id=mCT2726.1
FT                   protein_id=mCP21701.0"
FT                   /db_xref="GOA:O54792"
FT                   /db_xref="InterPro:IPR003650"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:1098624"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54792"
FT                   /protein_id="EDL14928.1"
FT   gene            4443824..4538100
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /note="gene_id=mCG12307.2"
FT   mRNA            join(4443824..4444030,4472195..4472312,4483959..4484115,
FT                   4489294..4489385,4495990..4496104,4503937..4504023,
FT                   4519393..4519509,4527091..4527275,4537721..4538100)
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /product="acyl-CoA thioesterase 7, transcript variant
FT                   mCT15578"
FT                   /note="gene_id=mCG12307.2 transcript_id=mCT15578.2 created
FT                   on 06-DEC-2002"
FT   CDS             join(4443861..4444030,4472195..4472312,4483959..4484115,
FT                   4489294..4489385,4495990..4496104,4503937..4504023,
FT                   4519393..4519509,4527091..4527275,4537721..4537819)
FT                   /codon_start=1
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /product="acyl-CoA thioesterase 7, isoform CRA_a"
FT                   /note="gene_id=mCG12307.2 transcript_id=mCT15578.2
FT                   protein_id=mCP21695.2 isoform=CRA_a"
FT                   /protein_id="EDL14929.1"
FT   mRNA            join(<4451896..4452075,4472195..4472312,4483959..4484115,
FT                   4489294..4489385,4495990..4496104,4503937..4504023,
FT                   4519393..4519509,4527091..4527275,4537721..4538094)
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /product="acyl-CoA thioesterase 7, transcript variant
FT                   mCT190855"
FT                   /note="gene_id=mCG12307.2 transcript_id=mCT190855.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4451897..4452075,4472195..4472312,4483959..4484115,
FT                   4489294..4489385,4495990..4496104,4503937..4504023,
FT                   4519393..4519509,4527091..4527275,4537721..4537819)
FT                   /codon_start=1
FT                   /gene="Acot7"
FT                   /locus_tag="mCG_12307"
FT                   /product="acyl-CoA thioesterase 7, isoform CRA_b"
FT                   /note="gene_id=mCG12307.2 transcript_id=mCT190855.0
FT                   protein_id=mCP111809.0 isoform=CRA_b"
FT                   /protein_id="EDL14930.1"
FT   assembly_gap    4455039..4455154
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    4463129..4463685
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    4468683..4468702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4478894..4478913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4498458..4498477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4518887..4518906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4540324..4540667
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   gene            4545279..4551605
FT                   /gene="Gpr153"
FT                   /locus_tag="mCG_12300"
FT                   /note="gene_id=mCG12300.2"
FT   mRNA            join(4545279..4545747,4546112..4546541,4548032..4548224,
FT                   4548637..4548821,4549124..4551605)
FT                   /gene="Gpr153"
FT                   /locus_tag="mCG_12300"
FT                   /product="G protein-coupled receptor 153"
FT                   /note="gene_id=mCG12300.2 transcript_id=mCT15571.2 created
FT                   on 18-DEC-2002"
FT   CDS             join(4545392..4545747,4546112..4546541,4548032..4548224,
FT                   4548637..4548821,4549124..4549855)
FT                   /codon_start=1
FT                   /gene="Gpr153"
FT                   /locus_tag="mCG_12300"
FT                   /product="G protein-coupled receptor 153"
FT                   /note="gene_id=mCG12300.2 transcript_id=mCT15571.2
FT                   protein_id=mCP21665.2"
FT                   /protein_id="EDL14931.1"
FT   gene            complement(<4553154..>4554326)
FT                   /gene="Hes3"
FT                   /locus_tag="mCG_12306"
FT                   /note="gene_id=mCG12306.1"
FT   mRNA            complement(join(<4553154..4553518,4553889..4553970,
FT                   4554051..4554146,4554267..>4554326))
FT                   /gene="Hes3"
FT                   /locus_tag="mCG_12306"
FT                   /product="hairy and enhancer of split 3 (Drosophila)"
FT                   /note="gene_id=mCG12306.1 transcript_id=mCT15577.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(4553154..4553518,4553889..4553970,
FT                   4554051..4554146,4554267..4554326))
FT                   /codon_start=1
FT                   /gene="Hes3"
FT                   /locus_tag="mCG_12306"
FT                   /product="hairy and enhancer of split 3 (Drosophila)"
FT                   /note="gene_id=mCG12306.1 transcript_id=mCT15577.1
FT                   protein_id=mCP21679.1"
FT                   /db_xref="GOA:A0A1W2P7Y8"
FT                   /db_xref="InterPro:IPR003650"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:104877"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1W2P7Y8"
FT                   /protein_id="EDL14932.1"
FT   gene            <4564021..4574367
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /note="gene_id=mCG12314.2"
FT   mRNA            join(<4564021..4564285,4565402..4565490,4565854..4565962,
FT                   4566388..4566557,4567254..4567471,4569739..4573836)
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /product="isoprenylcysteine carboxyl methyltransferase,
FT                   transcript variant mCT190888"
FT                   /note="gene_id=mCG12314.2 transcript_id=mCT190888.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4564028..4564285,4565402..4565490,4566388..4566557,
FT                   4567254..4567471,4569739..4574367)
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /product="isoprenylcysteine carboxyl methyltransferase,
FT                   transcript variant mCT15584"
FT                   /note="gene_id=mCG12314.2 transcript_id=mCT15584.1 created
FT                   on 18-DEC-2002"
FT   CDS             join(4564091..4564285,4565402..4565490,4566388..4566557,
FT                   4567254..4567471,4569739..4569921)
FT                   /codon_start=1
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /product="isoprenylcysteine carboxyl methyltransferase,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12314.2 transcript_id=mCT15584.1
FT                   protein_id=mCP21689.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U4N2"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="InterPro:IPR025770"
FT                   /db_xref="MGI:MGI:1888594"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4N2"
FT                   /protein_id="EDL14933.1"
FT                   VEL"
FT   CDS             <4572698..4573351
FT                   /codon_start=1
FT                   /gene="Icmt"
FT                   /locus_tag="mCG_12314"
FT                   /product="isoprenylcysteine carboxyl methyltransferase,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12314.2 transcript_id=mCT190888.0
FT                   protein_id=mCP111811.0 isoform=CRA_b"
FT                   /protein_id="EDL14934.1"
FT   gene            complement(4573951..4585636)
FT                   /locus_tag="mCG_12305"
FT                   /note="gene_id=mCG12305.2"
FT   mRNA            complement(join(4573951..4574333,4575555..4575620,
FT                   4578115..4578232,4578503..4578554,4578802..4578987,
FT                   4579121..4579307,4579918..4580015,4580095..4580163,
FT                   4580610..4580678,4580768..4580840,4581774..4581820,
FT                   4582124..4582249,4582335..4582410,4582483..4582564,
FT                   4582651..4582802,4584401..4584525,4585000..4585636))
FT                   /locus_tag="mCG_12305"
FT                   /product="mCG12305"
FT                   /note="gene_id=mCG12305.2 transcript_id=mCT15576.2 created
FT                   on 27-DEC-2002"
FT   CDS             complement(join(4574144..4574333,4575555..4575620,
FT                   4578115..4578232,4578503..4578554,4578802..4578987,
FT                   4579121..4579307,4579918..4580015,4580095..4580163,
FT                   4580610..4580678,4580768..4580840,4581774..4581820,
FT                   4582124..4582249,4582335..4582410,4582483..4582564,
FT                   4582651..4582714))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12305"
FT                   /product="mCG12305"
FT                   /note="gene_id=mCG12305.2 transcript_id=mCT15576.2
FT                   protein_id=mCP21685.2"
FT                   /protein_id="EDL14935.1"
FT   gene            4592572..4600781
FT                   /locus_tag="mCG_12304"
FT                   /note="gene_id=mCG12304.1"
FT   mRNA            join(4592572..4592606,4594192..4594296,4596715..4596839,
FT                   4598991..4600781)
FT                   /locus_tag="mCG_12304"
FT                   /product="mCG12304"
FT                   /note="gene_id=mCG12304.1 transcript_id=mCT15575.1 created
FT                   on 30-NOV-2004"
FT   CDS             join(4592595..4592606,4594192..4594296,4596715..4596839,
FT                   4598991..4599135)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12304"
FT                   /product="mCG12304"
FT                   /note="gene_id=mCG12304.1 transcript_id=mCT15575.1
FT                   protein_id=mCP21677.2"
FT                   /db_xref="GOA:Q4VAG4"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="MGI:MGI:99262"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAG4"
FT                   /protein_id="EDL14936.1"
FT   assembly_gap    4604838..4605879
FT                   /estimated_length=1042
FT                   /gap_type="unknown"
FT   gene            4608188..4654126
FT                   /locus_tag="mCG_131426"
FT                   /note="gene_id=mCG131426.1"
FT   mRNA            join(4608188..4608264,4614541..4614668,4620146..4620334,
FT                   4622686..4622804,4623225..4623463,4625103..4625224,
FT                   4626331..4626487,4627207..4627373,4627464..4627685,
FT                   4629528..4629734,4629918..4630129,4632770..4632901,
FT                   4633004..4633112,4633925..4634116,4634472..4634672,
FT                   4637054..4637191,4637277..4637398,4638127..4638300,
FT                   4638633..4638774,4639995..4640126,4640881..4640998,
FT                   4641626..4641750,4642685..4642916,4643129..4643239,
FT                   4643518..4643690,4644165..4644339,4644727..4644819,
FT                   4645007..4645095,4645279..4645412,4645914..4646058,
FT                   4646369..4646528,4646997..4647076,4647696..4647828,
FT                   4648884..4648961,4649441..4649578,4649819..4649927,
FT                   4650673..4650805,4651034..4651229,4651982..4652145,
FT                   4652498..4652551,4653464..4654126)
FT                   /locus_tag="mCG_131426"
FT                   /product="mCG131426"
FT                   /note="gene_id=mCG131426.1 transcript_id=mCT132761.1
FT                   created on 16-DEC-2002"
FT   CDS             join(4608192..4608264,4614541..4614668,4620146..4620334,
FT                   4622686..4622804,4623225..4623463,4625103..4625224,
FT                   4626331..4626487,4627207..4627373,4627464..4627685,
FT                   4629528..4629734,4629918..4630129,4632770..4632901,
FT                   4633004..4633112,4633925..4634116,4634472..4634672,
FT                   4637054..4637191,4637277..4637398,4638127..4638300,
FT                   4638633..4638774,4639995..4640126,4640881..4640998,
FT                   4641626..4641750,4642685..4642916,4643129..4643239,
FT                   4643518..4643690,4644165..4644339,4644727..4644819,
FT                   4645007..4645095,4645279..4645412,4645914..4646058,
FT                   4646369..4646528,4646997..4647076,4647696..4647828,
FT                   4648884..4648961,4649441..4649578,4649819..4649927,
FT                   4650673..4650805,4651034..4651229,4651982..4652145,
FT                   4652498..4652551,4653464..4653514)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131426"
FT                   /product="mCG131426"
FT                   /note="gene_id=mCG131426.1 transcript_id=mCT132761.1
FT                   protein_id=mCP76889.1"
FT                   /protein_id="EDL14937.1"
FT   assembly_gap    4625473..4625518
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    4636134..4636153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<4659586..4742997)
FT                   /gene="Kcnab2"
FT                   /locus_tag="mCG_12303"
FT                   /note="gene_id=mCG12303.2"
FT   mRNA            complement(join(<4659586..4659675,4660293..4660381,
FT                   4660841..4660961,4661480..4661574,4661676..4661796,
FT                   4663307..4663392,4667498..4667584,4668475..4668518,
FT                   4669586..4669630,4671151..4671195,4673703..4673782,
FT                   4678561..4678598,4679393..4679436,4701378..4701419,
FT                   4702401..4702533,4742925..4742997))
FT                   /gene="Kcnab2"
FT                   /locus_tag="mCG_12303"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 2"
FT                   /note="gene_id=mCG12303.2 transcript_id=mCT15574.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(4659586..4659675,4660293..4660381,
FT                   4660841..4660961,4661480..4661574,4661676..4661796,
FT                   4663307..4663392,4667498..4667584,4668475..4668518,
FT                   4669586..4669630,4671151..4671195,4673703..4673782,
FT                   4678561..4678598,4679393..4679436,4701378..4701419,
FT                   4702401..4702477))
FT                   /codon_start=1
FT                   /gene="Kcnab2"
FT                   /locus_tag="mCG_12303"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 2"
FT                   /note="gene_id=mCG12303.2 transcript_id=mCT15574.1
FT                   protein_id=mCP21667.0"
FT                   /protein_id="EDL14938.1"
FT   assembly_gap    4701299..4701318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4740393..4740550
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            4742228..4828716
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /note="gene_id=mCG12308.2"
FT   mRNA            join(4742228..4742281,4749941..4750121,4754424..4754576,
FT                   4762349..4762521,4763849..4763913,4764604..4764759,
FT                   4768546..4768676,4772033..4772214,4773027..4773153,
FT                   4783750..4783932,4789901..4790027,4801550..4801611,
FT                   4802823..4802939,4803415..4803563,4803660..4803851,
FT                   4804463..4804650,4809939..4810099,4812586..4812766,
FT                   4817442..4817567,4820160..4820365,4821111..4821337,
FT                   4821853..4822039,4822626..4822709,4824862..4825018,
FT                   4825212..4825297,4825798..4825883,4826712..4826883,
FT                   4827108..4827287,4827540..4827683,4828172..4828716)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT185776"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT185776.0 created
FT                   on 17-JUN-2003"
FT   mRNA            join(4743666..4743963,4749941..4750121,4754424..4754576,
FT                   4762349..4762521,4763849..4763913,4764604..4764759,
FT                   4768546..4768676,4772033..4772214,4773027..4773153,
FT                   4783750..4783932,4789901..4790027,4801550..4801611,
FT                   4802823..4802939,4803415..4803563,4803660..4803851,
FT                   4804463..4804650,4809939..4810099,4812586..4812766,
FT                   4817442..4817567,4820160..4820365,4821111..4821337,
FT                   4821853..4822039,4822626..4822709,4824862..4825018,
FT                   4825212..4825297,4825798..4825883,4826712..4826883,
FT                   4827108..4827287,4827540..4827683,4828172..4828716)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT177663"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT177663.1 created
FT                   on 17-JUN-2003"
FT   mRNA            join(4743666..4743963,4749986..4750121,4754424..4754576,
FT                   4762349..4762521,4763849..4763913,4764604..4764759,
FT                   4768546..4768649,4772033..4772224,4773040..4773153,
FT                   4783750..4783932,4789901..4790027,4803416..4803563,
FT                   4803660..4803851,4804463..4804650,4809939..4810099,
FT                   4812586..4812766,4817442..4817567,4820160..4820365,
FT                   4821111..4821337,4821853..4822039,4822626..4822709,
FT                   4824862..4825018,4825212..4825297,4825798..4825883,
FT                   4826712..4826883,4827108..4827287,4827540..4827683,
FT                   4828172..4828716)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT15579"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT15579.3 created
FT                   on 17-JUN-2003"
FT   mRNA            join(<4743666..4743963,4749986..4750121,4754424..4754576,
FT                   4762349..4762521,4763849..4763913,4764604..4764759,
FT                   4768546..4768649,4772033..4772224,4773040..4773153,
FT                   4783750..4783932,4789901..4790027,4803415..4803563,
FT                   4803660..4803851,4804463..4804650,4809939..4810099,
FT                   4812586..4812766,4817442..4817567,4820160..4820365,
FT                   4821111..4821337,4821853..4822039,4822626..4822709,
FT                   4824862..4825018,4825212..4825297,4825798..4825883,
FT                   4826712..4826883,4827108..4827287,4827540..4827683,
FT                   4828172..4828668)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT190856"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT190856.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(4743666..4743963,4749941..4750121,4754424..4754576,
FT                   4754765..4754896,4755144..4755375,4755815..4756127)
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   transcript variant mCT177662"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT177662.1 created
FT                   on 17-JUN-2003"
FT   assembly_gap    4747004..4747057
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   CDS             join(4749987..4750121,4754424..4754576,4762349..4762521,
FT                   4763849..4763913,4764604..4764759,4768546..4768676,
FT                   4772033..4772214,4773027..4773153,4783750..4783932,
FT                   4789901..4790027,4801550..4801611,4802823..4802939,
FT                   4803415..4803563,4803660..4803851,4804463..4804650,
FT                   4809939..4810099,4812586..4812766,4817442..4817567,
FT                   4820160..4820365,4821111..4821337,4821853..4822039,
FT                   4822626..4822709,4824862..4825018,4825212..4825297,
FT                   4825798..4825883,4826712..4826883,4827108..4827287,
FT                   4827540..4827683,4828172..4828312)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT177663.1
FT                   protein_id=mCP100584.1 isoform=CRA_a"
FT                   /db_xref="GOA:P59240"
FT                   /db_xref="InterPro:IPR029775"
FT                   /db_xref="MGI:MGI:2384210"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59240"
FT                   /protein_id="EDL14939.1"
FT   CDS             join(4749987..4750121,4754424..4754576,4762349..4762521,
FT                   4763849..4763913,4764604..4764759,4768546..4768676,
FT                   4772033..4772214,4773027..4773153,4783750..4783932,
FT                   4789901..4790027,4801550..4801611,4802823..4802939,
FT                   4803415..4803563,4803660..4803851,4804463..4804650,
FT                   4809939..4810099,4812586..4812766,4817442..4817567,
FT                   4820160..4820365,4821111..4821337,4821853..4822039,
FT                   4822626..4822709,4824862..4825018,4825212..4825297,
FT                   4825798..4825883,4826712..4826883,4827108..4827287,
FT                   4827540..4827683,4828172..4828312)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT185776.0
FT                   protein_id=mCP107034.0 isoform=CRA_a"
FT                   /db_xref="GOA:P59240"
FT                   /db_xref="InterPro:IPR029775"
FT                   /db_xref="MGI:MGI:2384210"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59240"
FT                   /protein_id="EDL14940.1"
FT   CDS             join(4749987..4750121,4754424..4754576,4762349..4762521,
FT                   4763849..4763913,4764604..4764759,4768546..4768649,
FT                   4772033..4772224,4773040..4773153,4783750..4783932,
FT                   4789901..4790027,4803416..4803563,4803660..4803851,
FT                   4804463..4804650,4809939..4810099,4812586..4812766,
FT                   4817442..4817567,4820160..4820365,4821111..4821337,
FT                   4821853..4822039,4822626..4822709,4824862..4825018,
FT                   4825212..4825297,4825798..4825883,4826712..4826883,
FT                   4827108..4827287,4827540..4827683,4828172..4828312)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT15579.3
FT                   protein_id=mCP21703.3 isoform=CRA_c"
FT                   /protein_id="EDL14942.1"
FT                   NEETFCVKVLYQ"
FT   CDS             join(4749987..4750121,4754424..4754576,4754765..4754779)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT177662.1
FT                   protein_id=mCP100585.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9D4S3"
FT                   /db_xref="InterPro:IPR029775"
FT                   /db_xref="MGI:MGI:2384210"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4S3"
FT                   /protein_id="EDL14943.1"
FT   assembly_gap    4752218..4752341
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    4756964..4756983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4774234..4774319
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   CDS             join(<4789947..4790027,4803415..4803563,4803660..4803851,
FT                   4804463..4804650,4809939..4810099,4812586..4812766,
FT                   4817442..4817567,4820160..4820365,4821111..4821337,
FT                   4821853..4822039,4822626..4822709,4824862..4825018,
FT                   4825212..4825297,4825798..4825883,4826712..4826883,
FT                   4827108..4827287,4827540..4827683,4828172..4828312)
FT                   /codon_start=1
FT                   /gene="Nphp4"
FT                   /locus_tag="mCG_12308"
FT                   /product="nephronophthisis 4 (juvenile) homolog (human),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12308.2 transcript_id=mCT190856.0
FT                   protein_id=mCP111810.0 isoform=CRA_b"
FT                   /protein_id="EDL14941.1"
FT   assembly_gap    4794125..4794177
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    4831832..4832106
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    4835839..4836339
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    4844496..4844515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4850509..4850528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4851845..4851864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4855337..4855356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4856514..4860324
FT                   /estimated_length=3811
FT                   /gap_type="unknown"
FT   assembly_gap    4867818..4868805
FT                   /estimated_length=988
FT                   /gap_type="unknown"
FT   gene            <4888595..4892820
FT                   /locus_tag="mCG_145230"
FT                   /note="gene_id=mCG145230.1"
FT   mRNA            join(<4888595..4890976,4891522..4892820)
FT                   /locus_tag="mCG_145230"
FT                   /product="mCG145230"
FT                   /note="gene_id=mCG145230.1 transcript_id=mCT184654.1
FT                   created on 15-JUL-2003"
FT   CDS             <4889540..4889875
FT                   /codon_start=1
FT                   /locus_tag="mCG_145230"
FT                   /product="mCG145230"
FT                   /note="gene_id=mCG145230.1 transcript_id=mCT184654.1
FT                   protein_id=mCP105934.0"
FT                   /protein_id="EDL14944.1"
FT                   ALSLFHP"
FT   assembly_gap    4890977..4891521
FT                   /estimated_length=545
FT                   /gap_type="unknown"
FT   assembly_gap    4896338..4896357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4909010..4910195
FT                   /estimated_length=1186
FT                   /gap_type="unknown"
FT   assembly_gap    4916141..4917039
FT                   /estimated_length=899
FT                   /gap_type="unknown"
FT   assembly_gap    4917963..4918207
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   gene            complement(4941066..4941406)
FT                   /pseudo
FT                   /locus_tag="mCG_1027364"
FT                   /note="gene_id=mCG1027364.1"
FT   mRNA            complement(4941066..4941406)
FT                   /pseudo
FT                   /locus_tag="mCG_1027364"
FT                   /note="gene_id=mCG1027364.1 transcript_id=mCT145068.1
FT                   created on 13-FEB-2003"
FT   assembly_gap    4945661..4945680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4954846..4954865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4957482..4957501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4961159..4963975
FT                   /locus_tag="mCG_1027416"
FT                   /note="gene_id=mCG1027416.1"
FT   mRNA            join(4961159..4961461,4962554..4962743,4963744..4963975)
FT                   /locus_tag="mCG_1027416"
FT                   /product="mCG1027416"
FT                   /note="gene_id=mCG1027416.1 transcript_id=mCT145120.1
FT                   created on 13-MAR-2003"
FT   CDS             join(4961285..4961461,4962554..4962724)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027416"
FT                   /product="mCG1027416"
FT                   /note="gene_id=mCG1027416.1 transcript_id=mCT145120.1
FT                   protein_id=mCP76924.1"
FT                   /db_xref="MGI:MGI:2685679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V423"
FT                   /protein_id="EDL14945.1"
FT                   EVSLSPSLSPS"
FT   assembly_gap    4966311..4966737
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    4972383..4972402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4981035..4981054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4995325..4995425
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    4996383..4996774
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    5011469..5011488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5027953..5028486
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   assembly_gap    5031848..5031970
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    5041692..5041921
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    5046421..5046440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5082810..5083309
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    5084782..5084810
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    5089414..5089953
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    5116875..5116894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5120303..5120377
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    5137705..5138355
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    5146166..5146186
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    5157570..5157807
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    5158732..5159313
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    5163003..5163048
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    5171485..5171504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5177440..5177459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5178940..5179892
FT                   /estimated_length=953
FT                   /gap_type="unknown"
FT   assembly_gap    5181244..5182472
FT                   /estimated_length=1229
FT                   /gap_type="unknown"
FT   assembly_gap    5196181..5196386
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    5197375..5197789
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    5222360..5222381
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    5225588..5226019
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    5228064..5228083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5246789..5246808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5280633..5280652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5337299..5337318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5349140..5349159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5352436..5352455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5363860..5363898
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    5372525..5372626
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    5388761..5419467
FT                   /estimated_length=30707
FT                   /gap_type="unknown"
FT   assembly_gap    5427350..5427369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5431312..5431331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5443799..5443858
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    5452260..5452279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5462155..5462278
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    5464703..5464893
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    5468446..5469034
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    5475944..5475963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5477559..5477873
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    5479200..5479219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5480714..5480733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5484057..5484146
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    5485311..5485372
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    5493543..5493562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5502537..5502720
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    5526358..5526377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5531315..5531334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5541722..5541741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5575252..5575345
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    5600366..5600662
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    5602143..5602162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5607160..5607179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5612432..5612557
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    5613333..5613352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5624745..5624764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5639877..>5749616)
FT                   /locus_tag="mCG_17925"
FT                   /note="gene_id=mCG17925.1"
FT   mRNA            complement(join(5639877..5640968,5648849..5648979,
FT                   5651448..5651690,5653068..5653155,5699341..5700146,
FT                   5749356..>5749616))
FT                   /locus_tag="mCG_17925"
FT                   /product="mCG17925"
FT                   /note="gene_id=mCG17925.1 transcript_id=mCT17679.2 created
FT                   on 27-DEC-2002"
FT   CDS             complement(join(5648907..5648979,5651448..5651690,
FT                   5653068..5653155,5699341..>5700145))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17925"
FT                   /product="mCG17925"
FT                   /note="gene_id=mCG17925.1 transcript_id=mCT17679.2
FT                   protein_id=mCP21770.2"
FT                   /protein_id="EDL14946.1"
FT                   ISC"
FT   assembly_gap    5657017..5657304
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    5659651..5659670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5670799..5671477
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   assembly_gap    5685552..5685664
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    5709675..5709826
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    5711524..5711543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5714886..5714993
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    5721551..5721681
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    5746374..5746500
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    5748793..5749164
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    5749743..5749762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5753234..5753253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5760900..5760919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5765769..5765889
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    5772575..5772594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5777068..5778174
FT                   /estimated_length=1107
FT                   /gap_type="unknown"
FT   assembly_gap    5794137..5794156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5818934..5819121
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    5821805..5821839
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    5822914..5822933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5827937..5828218
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    5865036..5865055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5876372..5876391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5896532..5896551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5902800..5902889
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    5941318..5941337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5951292..5951311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5952471..5952490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5954571..5954879
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    5971576..5971666
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    5976117..5976297
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    5985300..5985366
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    5999411..5999612
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    6013292..6014645
FT                   /estimated_length=1354
FT                   /gap_type="unknown"
FT   assembly_gap    6018699..6018837
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    6024299..6024318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6029395..6029611
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    6037331..6037446
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    6051322..6051341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6058463..6058555
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    6068563..6068582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6069900..6070222
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   gene            complement(<6073450..>6073836)
FT                   /locus_tag="mCG_1027432"
FT                   /note="gene_id=mCG1027432.0"
FT   mRNA            complement(join(<6073450..6073684,6073706..>6073836))
FT                   /locus_tag="mCG_1027432"
FT                   /product="mCG1027432"
FT                   /note="gene_id=mCG1027432.0 transcript_id=mCT145136.0
FT                   created on 13-MAR-2003"
FT   CDS             complement(join(6073450..6073684,6073706..6073836))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027432"
FT                   /product="mCG1027432"
FT                   /note="gene_id=mCG1027432.0 transcript_id=mCT145136.0
FT                   protein_id=mCP76788.0"
FT                   /protein_id="EDL14947.1"
FT                   ATGWVGALLSAAGSLGL"
FT   assembly_gap    6116932..6117345
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    6122550..6122655
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    6129653..6129672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6131366..6131620
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    6141519..6141869
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    6158341..6158640
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    6160500..6160846
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    6164480..6164499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6168381..6168400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6187293..6188597
FT                   /estimated_length=1305
FT                   /gap_type="unknown"
FT   assembly_gap    6194591..6194665
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    6213692..6213711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<6215196..6218066)
FT                   /locus_tag="mCG_147514"
FT                   /note="gene_id=mCG147514.0"
FT   mRNA            complement(join(<6215196..6216400,6217656..6217749,
FT                   6217995..6218066))
FT                   /locus_tag="mCG_147514"
FT                   /product="mCG147514"
FT                   /note="gene_id=mCG147514.0 transcript_id=mCT187777.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<6215196..6215496)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147514"
FT                   /product="mCG147514"
FT                   /note="gene_id=mCG147514.0 transcript_id=mCT187777.0
FT                   protein_id=mCP109473.0"
FT                   /protein_id="EDL14948.1"
FT   assembly_gap    6223968..6223987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6224801..6229464
FT                   /locus_tag="mCG_17927"
FT                   /note="gene_id=mCG17927.1"
FT   mRNA            join(6224801..6224863,6227290..6227403,6228072..6228533,
FT                   6229031..6229464)
FT                   /locus_tag="mCG_17927"
FT                   /product="mCG17927"
FT                   /note="gene_id=mCG17927.1 transcript_id=mCT17681.1 created
FT                   on 27-DEC-2002"
FT   CDS             join(6224849..6224863,6227290..6227403,6228072..6228533,
FT                   6229031..6229132)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17927"
FT                   /product="mCG17927"
FT                   /note="gene_id=mCG17927.1 transcript_id=mCT17681.1
FT                   protein_id=mCP21771.2"
FT                   /protein_id="EDL14949.1"
FT                   DDEDDAEG"
FT   gene            complement(6232906..6242594)
FT                   /gene="Dffb"
FT                   /locus_tag="mCG_17930"
FT                   /note="gene_id=mCG17930.1"
FT   mRNA            complement(join(6232906..6233152,6236632..6236732,
FT                   6237480..6237650,6239120..6239199,6240318..6240506,
FT                   6242134..6242260,6242432..6242594))
FT                   /gene="Dffb"
FT                   /locus_tag="mCG_17930"
FT                   /product="DNA fragmentation factor, beta subunit"
FT                   /note="gene_id=mCG17930.1 transcript_id=mCT17684.1 created
FT                   on 25-NOV-2002"
FT   CDS             complement(join(6232909..6233152,6236632..6236732,
FT                   6237480..6237650,6239120..6239199,6240318..6240506,
FT                   6242134..6242260,6242432..6242554))
FT                   /codon_start=1
FT                   /gene="Dffb"
FT                   /locus_tag="mCG_17930"
FT                   /product="DNA fragmentation factor, beta subunit"
FT                   /note="gene_id=mCG17930.1 transcript_id=mCT17684.1
FT                   protein_id=mCP21698.0"
FT                   /protein_id="EDL14950.1"
FT                   ARKR"
FT   gene            6242808..6274040
FT                   /gene="BC046331"
FT                   /locus_tag="mCG_17924"
FT                   /note="gene_id=mCG17924.2"
FT   mRNA            join(6242808..6243162,6246509..6246660,6248732..6248905,
FT                   6249195..6249333,6250540..6250602,6251065..6251150,
FT                   6252375..6252543,6252791..6252949,6254235..6254450,
FT                   6255882..6256076,6256601..6256768,6257252..6257425,
FT                   6260295..6260471,6260947..6261159,6262857..6262893,
FT                   6263694..6263760,6264283..6264391,6269085..6269223,
FT                   6269348..6269415,6272981..6273071,6273505..6274040)
FT                   /gene="BC046331"
FT                   /locus_tag="mCG_17924"
FT                   /product="cDNA sequence BC046331"
FT                   /note="gene_id=mCG17924.2 transcript_id=mCT17630.2 created
FT                   on 27-DEC-2002"
FT   CDS             join(6246548..6246660,6248732..6248905,6249195..6249333,
FT                   6250540..6250602,6251065..6251150,6252375..6252543,
FT                   6252791..6252949,6254235..6254450,6255882..6256076,
FT                   6256601..6256768,6257252..6257425,6260295..6260471,
FT                   6260947..6261159,6262857..6262893,6263694..6263760,
FT                   6264283..6264391,6269085..6269223,6269348..6269415,
FT                   6272981..6273071,6273505..6273620)
FT                   /codon_start=1
FT                   /gene="BC046331"
FT                   /locus_tag="mCG_17924"
FT                   /product="cDNA sequence BC046331"
FT                   /note="gene_id=mCG17924.2 transcript_id=mCT17630.2
FT                   protein_id=mCP21749.2"
FT                   /protein_id="EDL14951.1"
FT   assembly_gap    6261342..6261383
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   gene            <6278630..6288366
FT                   /gene="Lrrc47"
FT                   /locus_tag="mCG_17923"
FT                   /note="gene_id=mCG17923.1"
FT   mRNA            join(<6278630..6278912,6278976..6279247,6282471..6282923,
FT                   6284233..6284349,6285225..6285340,6285785..6285887,
FT                   6286249..6286338,6286486..6288366)
FT                   /gene="Lrrc47"
FT                   /locus_tag="mCG_17923"
FT                   /product="leucine rich repeat containing 47"
FT                   /note="gene_id=mCG17923.1 transcript_id=mCT17629.2 created
FT                   on 18-DEC-2002"
FT   assembly_gap    6278913..6278975
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   CDS             join(<6278978..6279247,6282471..6282923,6284233..6284349,
FT                   6285225..6285340,6285785..6285887,6286249..6286338,
FT                   6286486..6286731)
FT                   /codon_start=1
FT                   /gene="Lrrc47"
FT                   /locus_tag="mCG_17923"
FT                   /product="leucine rich repeat containing 47"
FT                   /note="gene_id=mCG17923.1 transcript_id=mCT17629.2
FT                   protein_id=mCP21739.2"
FT                   /protein_id="EDL14952.1"
FT                   HVTVVR"
FT   assembly_gap    6284468..6284700
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            complement(6289943..6293007)
FT                   /locus_tag="mCG_17922"
FT                   /note="gene_id=mCG17922.2"
FT   mRNA            complement(join(6289943..6290308,6290543..6290672,
FT                   6292359..6292476,6292764..6293007))
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, transcript variant mCT17628"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT17628.2 created
FT                   on 18-DEC-2002"
FT   mRNA            complement(join(6290023..6290308,6290543..6290746,
FT                   6290922..6291048,6292359..6292476,6292764..6293007))
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, transcript variant mCT177671"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT177671.0 created
FT                   on 18-DEC-2002"
FT   mRNA            complement(join(6290166..6290308,6290543..6290746,
FT                   6292359..6292476,6292764..6293007))
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, transcript variant mCT177672"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT177672.0 created
FT                   on 18-DEC-2002"
FT   CDS             complement(join(6292408..6292476,6292764..6292994))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, isoform CRA_a"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT17628.2
FT                   protein_id=mCP21718.2 isoform=CRA_a"
FT                   /protein_id="EDL14953.1"
FT   CDS             complement(join(6292408..6292476,6292764..6292994))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, isoform CRA_a"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT177671.0
FT                   protein_id=mCP100594.0 isoform=CRA_a"
FT                   /protein_id="EDL14954.1"
FT   CDS             complement(join(6292408..6292476,6292764..6292994))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17922"
FT                   /product="mCG17922, isoform CRA_a"
FT                   /note="gene_id=mCG17922.2 transcript_id=mCT177672.0
FT                   protein_id=mCP100593.0 isoform=CRA_a"
FT                   /protein_id="EDL14955.1"
FT   gene            complement(6293221..6294983)
FT                   /pseudo
FT                   /locus_tag="mCG_67211"
FT                   /note="gene_id=mCG67211.1"
FT   mRNA            complement(join(6293221..6293711,6294875..6294983))
FT                   /pseudo
FT                   /locus_tag="mCG_67211"
FT                   /note="gene_id=mCG67211.1 transcript_id=mCT67394.1 created
FT                   on 27-DEC-2002"
FT   assembly_gap    6298593..6312883
FT                   /estimated_length=14291
FT                   /gap_type="unknown"
FT   gene            complement(6318337..6380194)
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /note="gene_id=mCG17921.2"
FT   mRNA            complement(join(6318337..6321415,6322677..6322770,
FT                   6323482..6323620,6324073..6324221,6324632..6324759,
FT                   6326005..6326093,6326433..6326575,6326758..6326867,
FT                   6329911..6330026,6330478..6330664,6345843..6346085,
FT                   6367885..6367990,6368384..6368461,6380073..6380194))
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /product="transformation related protein 73, transcript
FT                   variant mCT17627"
FT                   /note="gene_id=mCG17921.2 transcript_id=mCT17627.2 created
FT                   on 18-DEC-2002"
FT   mRNA            complement(join(6320933..6321415,6322677..6322770,
FT                   6323482..6323620,6324073..6324221,6324632..6324759,
FT                   6326005..6326093,6326433..6326575,6326758..6326867,
FT                   6329911..6330026,6330478..6330664,6345843..6346085,
FT                   6360461..6360734))
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /product="transformation related protein 73, transcript
FT                   variant mCT177670"
FT                   /note="gene_id=mCG17921.2 transcript_id=mCT177670.0 created
FT                   on 18-DEC-2002"
FT   CDS             complement(join(6321080..6321415,6322677..6322770,
FT                   6323482..6323620,6324073..6324221,6324632..6324759,
FT                   6326005..6326093,6326433..6326575,6326758..6326867,
FT                   6329911..6330026,6330478..6330664,6345843..6346085,
FT                   6367885..6367990,6368384..6368461,6380073..6380191))
FT                   /codon_start=1
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /product="transformation related protein 73, isoform CRA_a"
FT                   /note="gene_id=mCG17921.2 transcript_id=mCT17627.2
FT                   protein_id=mCP21707.2 isoform=CRA_a"
FT                   /protein_id="EDL14956.1"
FT   CDS             complement(join(6321080..6321415,6322677..6322770,
FT                   6323482..6323620,6324073..6324221,6324632..6324759,
FT                   6326005..6326093,6326433..6326575,6326758..6326867,
FT                   6329911..6330026,6330478..6330664,6345843..6346085,
FT                   6360461..6360499))
FT                   /codon_start=1
FT                   /gene="Trp73"
FT                   /locus_tag="mCG_17921"
FT                   /product="transformation related protein 73, isoform CRA_b"
FT                   /note="gene_id=mCG17921.2 transcript_id=mCT177670.0
FT                   protein_id=mCP100592.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9JJP2"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002117"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR010991"
FT                   /db_xref="InterPro:IPR011615"
FT                   /db_xref="InterPro:IPR012346"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR032646"
FT                   /db_xref="MGI:MGI:1336991"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJP2"
FT                   /protein_id="EDL14957.1"
FT                   KQPIKEEFTETESH"
FT   assembly_gap    6328483..6328502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6334734..6334871
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    6338062..6338459
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    6346359..6346449
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    6357289..6358351
FT                   /estimated_length=1063
FT                   /gap_type="unknown"
FT   assembly_gap    6388263..6388404
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    6391524..6391543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6393044..6393210
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    6403349..6403396
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            6405970..6431574
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /note="gene_id=mCG17929.2"
FT   mRNA            join(6405970..6406091,6408829..6408981,6410077..6410193,
FT                   6412296..6412368,6415015..6415118,6415725..6415811,
FT                   6415948..6416082,6416180..6416257,6417840..6417945,
FT                   6418546..6418671,6419405..6419596,6430425..6431574)
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /product="WD repeat domain 8, transcript variant mCT176361"
FT                   /note="gene_id=mCG17929.2 transcript_id=mCT176361.0 created
FT                   on 25-NOV-2002"
FT   mRNA            join(6405970..6406091,6408829..6408981,6410077..6410193,
FT                   6412296..6412368,6415015..6415118,6415725..6415811,
FT                   6415948..6416082,6416180..6416257,6417840..6417945,
FT                   6418546..6418671,6419405..6419596,6419836..6420119)
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /product="WD repeat domain 8, transcript variant mCT17683"
FT                   /note="gene_id=mCG17929.2 transcript_id=mCT17683.0 created
FT                   on 25-NOV-2002"
FT   CDS             join(6406023..6406091,6408829..6408981,6410077..6410193,
FT                   6412296..6412368,6415015..6415118,6415725..6415811,
FT                   6415948..6416082,6416180..6416257,6417840..6417945,
FT                   6418546..6418671,6419405..6419596,6430425..6430456)
FT                   /codon_start=1
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /product="WD repeat domain 8, isoform CRA_b"
FT                   /note="gene_id=mCG17929.2 transcript_id=mCT176361.0
FT                   protein_id=mCP99283.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1891749"
FT                   /db_xref="UniProtKB/TrEMBL:Q3T993"
FT                   /protein_id="EDL14959.1"
FT   CDS             join(6406023..6406091,6408829..6408981,6410077..6410193,
FT                   6412296..6412368,6415015..6415118,6415725..6415811,
FT                   6415948..6416082,6416180..6416257,6417840..6417945,
FT                   6418546..6418671,6419405..6419596,6419836..6419984)
FT                   /codon_start=1
FT                   /gene="Wdr8"
FT                   /locus_tag="mCG_17929"
FT                   /product="WD repeat domain 8, isoform CRA_a"
FT                   /note="gene_id=mCG17929.2 transcript_id=mCT17683.0
FT                   protein_id=mCP21751.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JM98"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="MGI:MGI:1891749"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JM98"
FT                   /protein_id="EDL14958.1"
FT                   MPRT"
FT   gene            complement(6420784..6423996)
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /note="gene_id=mCG17928.1"
FT   mRNA            complement(join(6420784..6421869,6422573..6422726,
FT                   6423389..6423565,6423659..6423996))
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /product="RIKEN cDNA 1200015A19, transcript variant
FT                   mCT17682"
FT                   /note="gene_id=mCG17928.1 transcript_id=mCT17682.1 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(6420785..6421869,6423389..6423565,
FT                   6423659..6423952))
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /product="RIKEN cDNA 1200015A19, transcript variant
FT                   mCT176819"
FT                   /note="gene_id=mCG17928.1 transcript_id=mCT176819.0 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(6421675..6421869,6422573..6422726,
FT                   6423389..6423565,6423659..6423933))
FT                   /codon_start=1
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /product="RIKEN cDNA 1200015A19, isoform CRA_b"
FT                   /note="gene_id=mCG17928.1 transcript_id=mCT17682.1
FT                   protein_id=mCP21717.2 isoform=CRA_b"
FT                   /protein_id="EDL14961.1"
FT   CDS             complement(join(6421845..6421869,6423389..6423565,
FT                   6423659..6423933))
FT                   /codon_start=1
FT                   /gene="1200015A19Rik"
FT                   /locus_tag="mCG_17928"
FT                   /product="RIKEN cDNA 1200015A19, isoform CRA_a"
FT                   /note="gene_id=mCG17928.1 transcript_id=mCT176819.0
FT                   protein_id=mCP99741.0 isoform=CRA_a"
FT                   /protein_id="EDL14960.1"
FT   assembly_gap    6431696..6431718
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            6434088..6542421
FT                   /locus_tag="mCG_130928"
FT                   /note="gene_id=mCG130928.0"
FT   mRNA            join(6434088..6434488,6440379..6440513,6446577..6446686,
FT                   6490684..6490806,6508997..6509119,6516090..6516215,
FT                   6517490..6517612,6518793..6518915,6519088..6519225,
FT                   6519689..6519808,6520378..6520500,6520932..6521102,
FT                   6521365..6521496,6522751..6522879,6524845..6524973,
FT                   6525604..6525738,6525825..6525959,6529246..6529371,
FT                   6529902..6530033,6530125..6530253,6530378..6530509,
FT                   6531784..6531912,6532001..6532129,6532374..6532502,
FT                   6532848..6532976,6533165..6533293,6533904..6534032,
FT                   6534147..6534275,6534370..6534501,6534648..6534776,
FT                   6535290..6535418,6536361..6536489,6536607..6536735,
FT                   6537116..6537244,6537337..6537465,6538319..6538447,
FT                   6540516..6542421)
FT                   /locus_tag="mCG_130928"
FT                   /product="mCG130928"
FT                   /note="gene_id=mCG130928.0 transcript_id=mCT132256.1
FT                   created on 16-DEC-2002"
FT   CDS             join(6434370..6434488,6440379..6440513,6446577..6446686,
FT                   6490684..6490806,6508997..6509119,6516090..6516215,
FT                   6517490..6517612,6518793..6518915,6519088..6519225,
FT                   6519689..6519808,6520378..6520500,6520932..6521102,
FT                   6521365..6521496,6522751..6522879,6524845..6524973,
FT                   6525604..6525738,6525825..6525959,6529246..6529371,
FT                   6529902..6530033,6530125..6530253,6530378..6530509,
FT                   6531784..6531912,6532001..6532129,6532374..6532502,
FT                   6532848..6532976,6533165..6533293,6533904..6534032,
FT                   6534147..6534275,6534370..6534501,6534648..6534776,
FT                   6535290..6535418,6536361..6536489,6536607..6536735,
FT                   6537116..6537244,6537337..6537465,6538319..6538447,
FT                   6540516..6540583)
FT                   /codon_start=1
FT                   /locus_tag="mCG_130928"
FT                   /product="mCG130928"
FT                   /note="gene_id=mCG130928.0 transcript_id=mCT132256.1
FT                   protein_id=mCP76723.1"
FT                   /protein_id="EDL14962.1"
FT   gene            complement(6444946..6445477)
FT                   /pseudo
FT                   /locus_tag="mCG_17926"
FT                   /note="gene_id=mCG17926.1"
FT   mRNA            complement(6444946..6445477)
FT                   /pseudo
FT                   /locus_tag="mCG_17926"
FT                   /note="gene_id=mCG17926.1 transcript_id=mCT17680.1 created
FT                   on 27-DEC-2002"
FT   assembly_gap    6454906..6457100
FT                   /estimated_length=2195
FT                   /gap_type="unknown"
FT   assembly_gap    6458430..6458449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6476029..6478040
FT                   /estimated_length=2012
FT                   /gap_type="unknown"
FT   assembly_gap    6497382..6497552
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    6504548..6504567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6513627..6513646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6515908..6515927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6520669..6520846
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            complement(6545177..6554700)
FT                   /locus_tag="mCG_3923"
FT                   /note="gene_id=mCG3923.2"
FT   mRNA            complement(join(6545177..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6549345,6549445..6549597,
FT                   6551670..6551830,6552299..6552355,6553604..6554700))
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, transcript variant mCT185170"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT185170.0 created
FT                   on 27-MAY-2003"
FT   mRNA            complement(join(6545178..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6548780,6549216..6549345,
FT                   6549445..6549597,6551670..6551868,6552299..6552355,
FT                   6553561..6553773,6554653..>6554699))
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, transcript variant mCT2923"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT2923.2 created on
FT                   27-MAY-2003"
FT   mRNA            complement(join(6545233..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6548780,6549216..6549345,
FT                   6549445..6549597,6551670..6551830,6552299..6552355,
FT                   6553604..>6553669))
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, transcript variant mCT190897"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT190897.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6545656..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6548780,6549216..6549345,
FT                   6549445..6549597,6551670..6551868,6552299..6552355,
FT                   6553561..6553773,6554653..>6554698))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, isoform CRA_c"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT2923.2
FT                   protein_id=mCP21691.2 isoform=CRA_c"
FT                   /protein_id="EDL14965.1"
FT   CDS             complement(join(6545656..6545795,6546398..6546499,
FT                   6546936..6547009,6547531..6547719,6548018..6548169,
FT                   6548524..6548616,6548706..6548780,6549216..6549345,
FT                   6549445..6549597,6551670..6551830,6552299..6552355,
FT                   6553604..>6553669))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, isoform CRA_b"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT190897.0
FT                   protein_id=mCP111855.0 isoform=CRA_b"
FT                   /protein_id="EDL14964.1"
FT                   VETDV"
FT   CDS             complement(join(6549120..6549345,6549445..6549597,
FT                   6551670..6551830,6552299..6552355,6553604..6553858))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3923"
FT                   /product="mCG3923, isoform CRA_a"
FT                   /note="gene_id=mCG3923.2 transcript_id=mCT185170.0
FT                   protein_id=mCP106428.0 isoform=CRA_a"
FT                   /protein_id="EDL14963.1"
FT                   DL"
FT   assembly_gap    6549396..6549415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6555403..6564071
FT                   /estimated_length=8669
FT                   /gap_type="unknown"
FT   assembly_gap    6569283..6569392
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    6575707..6575921
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   gene            complement(6581825..>6786826)
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /note="gene_id=mCG3922.2"
FT   mRNA            complement(join(6581825..6582457,6583806..6583980,
FT                   6584782..6584901,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599131,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628690,
FT                   6732422..6732469,6786477..6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT2924"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT2924.2 created on
FT                   16-DEC-2002"
FT   mRNA            complement(join(6581826..6582457,6583806..6583980,
FT                   6584782..6585015,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599128,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628693,
FT                   6732422..6732469,6786477..>6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT190892"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190892.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6581827..6582457,6583806..6583980,
FT                   6584782..6585015,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599128,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628690,
FT                   6732422..6732469,6786477..>6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT190895"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190895.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6581833..6582457,6584782..6585015,
FT                   6589666..6589840,6590083..6590252,6595794..6595871,
FT                   6596494..6596663,6599044..6599128,6602122..6603538,
FT                   6606723..6606876,6607396..6607543,6609325..6609535,
FT                   6616668..6616770,6628556..6628693,6732422..6732472,
FT                   6786477..>6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT190894"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190894.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(6581833..6582457,6584782..6585015,
FT                   6589666..6589840,6590083..6590252,6595794..6595871,
FT                   6596494..6596663,6599044..6599131,6602122..6603538,
FT                   6606723..6606876,6607396..6607543,6609325..6609535,
FT                   6616668..6616770,6628556..6628693,6732422..6732472,
FT                   6786477..>6786826))
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, transcript variant
FT                   mCT190893"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190893.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6582323..6582457,6583806..6583980,
FT                   6584782..6585015,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599128,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628690,
FT                   6732422..6732469,6786477..>6786824))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_d"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190895.0
FT                   protein_id=mCP111854.0 isoform=CRA_d"
FT                   /protein_id="EDL14969.1"
FT   CDS             complement(join(6582323..6582457,6583806..6583980,
FT                   6584782..6585015,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599128,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628693,
FT                   6732422..6732469,6786477..>6786824))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_a"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190892.0
FT                   protein_id=mCP111851.0 isoform=CRA_a"
FT                   /protein_id="EDL14966.1"
FT   CDS             complement(join(6582323..6582457,6583806..6583980,
FT                   6584782..6584901,6589666..6589840,6590083..6590252,
FT                   6595794..6595871,6596494..6596663,6599044..6599131,
FT                   6602122..6603538,6606723..6606876,6607396..6607543,
FT                   6609325..6609535,6616668..6616770,6628556..6628690,
FT                   6732422..6732469,6786477..6786803))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_e"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT2924.2
FT                   protein_id=mCP21775.2 isoform=CRA_e"
FT                   /protein_id="EDL14970.1"
FT   CDS             complement(join(6582445..6582457,6584782..6585015,
FT                   6589666..6589840,6590083..6590252,6595794..6595871,
FT                   6596494..6596663,6599044..6599128,6602122..6603538,
FT                   6606723..6606876,6607396..6607543,6609325..6609535,
FT                   6616668..6616770,6628556..6628693,6732422..6732472,
FT                   6786477..>6786824))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_c"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190894.0
FT                   protein_id=mCP111853.0 isoform=CRA_c"
FT                   /protein_id="EDL14968.1"
FT   CDS             complement(join(6582445..6582457,6584782..6585015,
FT                   6589666..6589840,6590083..6590252,6595794..6595871,
FT                   6596494..6596663,6599044..6599131,6602122..6603538,
FT                   6606723..6606876,6607396..6607543,6609325..6609535,
FT                   6616668..6616770,6628556..6628693,6732422..6732472,
FT                   6786477..>6786824))
FT                   /codon_start=1
FT                   /gene="Prdm16"
FT                   /locus_tag="mCG_3922"
FT                   /product="PR domain containing 16, isoform CRA_b"
FT                   /note="gene_id=mCG3922.2 transcript_id=mCT190893.0
FT                   protein_id=mCP111852.0 isoform=CRA_b"
FT                   /protein_id="EDL14967.1"
FT   assembly_gap    6585589..6585631
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    6618216..6618235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6630571..6630707
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    6653854..6653873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6678204..6691050
FT                   /estimated_length=12847
FT                   /gap_type="unknown"
FT   assembly_gap    6719634..6719726
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    6732625..6732658
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    6741334..6742475
FT                   /estimated_length=1142
FT                   /gap_type="unknown"
FT   assembly_gap    6764839..6764858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6774381..6774400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6784622..6784727
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    6788695..6788809
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    6795805..6796089
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    6817439..6817458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6825632..6826472
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   gene            6859418..6862424
FT                   /locus_tag="mCG_1027442"
FT                   /note="gene_id=mCG1027442.1"
FT   mRNA            join(6859418..6859629,6862249..6862424)
FT                   /locus_tag="mCG_1027442"
FT                   /product="mCG1027442, transcript variant mCT145146"
FT                   /note="gene_id=mCG1027442.1 transcript_id=mCT145146.1
FT                   created on 13-MAR-2003"
FT   mRNA            join(6859435..6859629,6860282..6860926)
FT                   /locus_tag="mCG_1027442"
FT                   /product="mCG1027442, transcript variant mCT181158"
FT                   /note="gene_id=mCG1027442.1 transcript_id=mCT181158.0
FT                   created on 13-MAR-2003"
FT   CDS             join(6859472..6859629,6862249..6862378)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027442"
FT                   /product="mCG1027442, isoform CRA_a"
FT                   /note="gene_id=mCG1027442.1 transcript_id=mCT145146.1
FT                   protein_id=mCP76827.1 isoform=CRA_a"
FT                   /protein_id="EDL14971.1"
FT   CDS             join(6859472..6859629,6860282..6860306)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027442"
FT                   /product="mCG1027442, isoform CRA_b"
FT                   /note="gene_id=mCG1027442.1 transcript_id=mCT181158.0
FT                   protein_id=mCP104080.0 isoform=CRA_b"
FT                   /protein_id="EDL14972.1"
FT                   PGREQRGRLPRAVFL"
FT   assembly_gap    6894601..6895700
FT                   /estimated_length=1100
FT                   /gap_type="unknown"
FT   gene            6895701..6902763
FT                   /locus_tag="mCG_147515"
FT                   /note="gene_id=mCG147515.0"
FT   mRNA            join(6895701..6895844,6899455..6902763)
FT                   /locus_tag="mCG_147515"
FT                   /product="mCG147515"
FT                   /note="gene_id=mCG147515.0 transcript_id=mCT187778.0
FT                   created on 13-JAN-2004"
FT   CDS             6901544..6901804
FT                   /codon_start=1
FT                   /locus_tag="mCG_147515"
FT                   /product="mCG147515"
FT                   /note="gene_id=mCG147515.0 transcript_id=mCT187778.0
FT                   protein_id=mCP109475.0"
FT                   /protein_id="EDL14973.1"
FT   assembly_gap    6903516..6903535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6903541..6904159
FT                   /locus_tag="mCG_1027444"
FT                   /note="gene_id=mCG1027444.1"
FT   mRNA            join(<6903541..6903917,6904043..6904159)
FT                   /locus_tag="mCG_1027444"
FT                   /product="mCG1027444"
FT                   /note="gene_id=mCG1027444.1 transcript_id=mCT145148.1
FT                   created on 13-MAR-2003"
FT   CDS             <6903541..6903750
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027444"
FT                   /product="mCG1027444"
FT                   /note="gene_id=mCG1027444.1 transcript_id=mCT145148.1
FT                   protein_id=mCP76675.1"
FT                   /protein_id="EDL14974.1"
FT   gene            complement(6904212..6913783)
FT                   /locus_tag="mCG_147517"
FT                   /note="gene_id=mCG147517.0"
FT   mRNA            complement(join(6904212..6907094,6913253..6913783))
FT                   /locus_tag="mCG_147517"
FT                   /product="mCG147517"
FT                   /note="gene_id=mCG147517.0 transcript_id=mCT187780.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6906428..6906787)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147517"
FT                   /product="mCG147517"
FT                   /note="gene_id=mCG147517.0 transcript_id=mCT187780.0
FT                   protein_id=mCP109476.0"
FT                   /protein_id="EDL14975.1"
FT                   REQEKNCPGLEDRAP"
FT   assembly_gap    6923172..6923191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6924904..6926181)
FT                   /gene="Actrt2"
FT                   /locus_tag="mCG_3936"
FT                   /note="gene_id=mCG3936.0"
FT   mRNA            complement(6924904..6926181)
FT                   /gene="Actrt2"
FT                   /locus_tag="mCG_3936"
FT                   /product="actin-related protein T2"
FT                   /note="gene_id=mCG3936.0 transcript_id=mCT2913.1 created on
FT                   06-DEC-2002"
FT   CDS             complement(6925013..6926146)
FT                   /codon_start=1
FT                   /gene="Actrt2"
FT                   /locus_tag="mCG_3936"
FT                   /product="actin-related protein T2"
FT                   /note="gene_id=mCG3936.0 transcript_id=mCT2913.1
FT                   protein_id=mCP21761.2"
FT                   /protein_id="EDL14976.1"
FT   assembly_gap    6928525..6928544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6932320..6932477
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    6945639..6945981
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    6950276..6950443
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    6951909..6952343
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    6979704..6979723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6983793..6983812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6986019..6986038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6993199..6994057
FT                   /estimated_length=859
FT                   /gap_type="unknown"
FT   assembly_gap    6997201..6997220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7015311..7015330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7028099..7028179
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    7030206..7030288
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    7057388..7057483
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   gene            7102406..7118930
FT                   /gene="B230396O12Rik"
FT                   /locus_tag="mCG_147516"
FT                   /note="gene_id=mCG147516.0"
FT   mRNA            join(7102406..7102623,7104128..7104353,7105604..7105808,
FT                   7106857..7107023,7107463..7107733,7108385..7108599,
FT                   7116716..7117261,7117606..7118930)
FT                   /gene="B230396O12Rik"
FT                   /locus_tag="mCG_147516"
FT                   /product="RIKEN cDNA B230396O12"
FT                   /note="gene_id=mCG147516.0 transcript_id=mCT187779.0
FT                   created on 13-JAN-2004"
FT   CDS             join(7102571..7102623,7104128..7104353,7105604..7105808,
FT                   7106857..7107023,7107463..7107733,7108385..7108599,
FT                   7116716..7117243)
FT                   /codon_start=1
FT                   /gene="B230396O12Rik"
FT                   /locus_tag="mCG_147516"
FT                   /product="RIKEN cDNA B230396O12"
FT                   /note="gene_id=mCG147516.0 transcript_id=mCT187779.0
FT                   protein_id=mCP109474.0"
FT                   /protein_id="EDL14977.1"
FT   gene            complement(7111166..7121286)
FT                   /locus_tag="mCG_147506"
FT                   /note="gene_id=mCG147506.0"
FT   mRNA            complement(join(7111166..7111477,7116692..7116719,
FT                   7116818..7116919,7119724..7119880,7120312..7120445,
FT                   7121207..7121286))
FT                   /locus_tag="mCG_147506"
FT                   /product="mCG147506"
FT                   /note="gene_id=mCG147506.0 transcript_id=mCT187769.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(7111347..7111477,7116692..7116719,
FT                   7116818..7116919,7119724..7119747))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147506"
FT                   /product="mCG147506"
FT                   /note="gene_id=mCG147506.0 transcript_id=mCT187769.0
FT                   protein_id=mCP109465.0"
FT                   /protein_id="EDL14978.1"
FT   assembly_gap    7111656..7116464
FT                   /estimated_length=4809
FT                   /gap_type="unknown"
FT   assembly_gap    7121287..7121934
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   gene            7123181..7146421
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /note="gene_id=mCG3934.1"
FT   mRNA            join(7123181..7123497,7132338..7132406,7132961..7133020,
FT                   7134057..7134218,7134508..7134588,7135830..7135925,
FT                   7136388..7136506,7137035..7137100,7138510..7138644,
FT                   7138720..7138809,7140398..7140534,7140819..7140912,
FT                   7141730..7141858,7142372..7142470,7142835..7142918,
FT                   7143307..7143410,7143715..7143773,7144123..7144242,
FT                   7144722..7144855,7144966..7145031,7145488..7145583,
FT                   7145852..7145928,7146017..7146421)
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, transcript
FT                   variant mCT2911"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT2911.2 created on
FT                   06-DEC-2002"
FT   mRNA            join(7123181..7123497,7132961..7133020,7134057..7134218,
FT                   7134508..7134588,7135830..7135925,7136388..7136506,
FT                   7137035..7137100,7138510..7138644,7138720..7138809,
FT                   7140398..7140534,7140819..7140912,7141730..7141858,
FT                   7142372..7142470,7142835..7142918,7143307..7143410,
FT                   7143715..7143773,7144123..7144242,7144722..7144855,
FT                   7144966..7145031,7145488..7145583,7145852..7145928,
FT                   7146017..7146421)
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, transcript
FT                   variant mCT176826"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT176826.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(7123181..7123497,7132961..7133020,7134057..7134218,
FT                   7134508..7134588,7135830..7135925,7136388..7136506,
FT                   7137035..7137100,7138510..7138644,7138720..7138809,
FT                   7140087..7140196,7140398..7140534,7140819..7140912,
FT                   7141730..7141858,7142372..7142470,7142835..7142918,
FT                   7143307..7143410,7143715..7143773,7144123..7144242,
FT                   7144722..7144855,7144966..7145031,7145488..7145583,
FT                   7145852..7145928,7146017..7146412)
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, transcript
FT                   variant mCT176825"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT176825.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(7123377..7123497,7132338..7132406,7132961..7133020,
FT                   7134057..7134218,7134508..7134588,7135830..7135925,
FT                   7136388..7136506,7137035..7137100,7138510..7138644,
FT                   7138720..7138809,7140398..7140534,7140819..7140912,
FT                   7141730..7141858,7142372..7142470,7142835..7142918,
FT                   7143307..7143410,7143715..7143773,7144123..7144242,
FT                   7144722..7144855,7144966..7145031,7145488..7145583,
FT                   7145852..7145928,7146017..7146116)
FT                   /codon_start=1
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT2911.2
FT                   protein_id=mCP21746.1 isoform=CRA_c"
FT                   /protein_id="EDL14981.1"
FT                   SPMHPMKRCRIW"
FT   CDS             join(7123377..7123497,7132961..7133020,7134057..7134218,
FT                   7134508..7134588,7135830..7135925,7136388..7136506,
FT                   7137035..7137100,7138510..7138644,7138720..7138809,
FT                   7140398..7140534,7140819..7140912,7141730..7141858,
FT                   7142372..7142470,7142835..7142918,7143307..7143410,
FT                   7143715..7143773,7144123..7144242,7144722..7144855,
FT                   7144966..7145031,7145488..7145583,7145852..7145928,
FT                   7146017..7146116)
FT                   /codon_start=1
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT176826.0
FT                   protein_id=mCP99747.0 isoform=CRA_b"
FT                   /db_xref="GOA:B2RPX5"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029735"
FT                   /db_xref="MGI:MGI:1351603"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPX5"
FT                   /protein_id="EDL14980.1"
FT   CDS             join(7123377..7123497,7132961..7133020,7134057..7134218,
FT                   7134508..7134588,7135830..7135925,7136388..7136506,
FT                   7137035..7137100,7138510..7138644,7138720..7138809,
FT                   7140087..7140134)
FT                   /codon_start=1
FT                   /gene="Mmel1"
FT                   /locus_tag="mCG_3934"
FT                   /product="membrane metallo-endopeptidase-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3934.1 transcript_id=mCT176825.0
FT                   protein_id=mCP99748.0 isoform=CRA_a"
FT                   /protein_id="EDL14979.1"
FT   assembly_gap    7123580..7124389
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   assembly_gap    7129201..7129220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7147296..7149953)
FT                   /gene="2810405K02Rik"
FT                   /locus_tag="mCG_3932"
FT                   /note="gene_id=mCG3932.1"
FT   mRNA            complement(join(7147296..7147488,7147931..7148049,
FT                   7148240..7148315,7148397..7148460,7149019..7149070,
FT                   7149367..7149571,7149834..7149953))
FT                   /gene="2810405K02Rik"
FT                   /locus_tag="mCG_3932"
FT                   /product="RIKEN cDNA 2810405K02"
FT                   /note="gene_id=mCG3932.1 transcript_id=mCT2921.1 created on
FT                   06-DEC-2002"
FT   CDS             complement(join(7147462..7147488,7147931..7148049,
FT                   7148240..7148315,7148397..7148460,7149019..7149070,
FT                   7149367..7149571,7149834..7149896))
FT                   /codon_start=1
FT                   /gene="2810405K02Rik"
FT                   /locus_tag="mCG_3932"
FT                   /product="RIKEN cDNA 2810405K02"
FT                   /note="gene_id=mCG3932.1 transcript_id=mCT2921.1
FT                   protein_id=mCP21738.1"
FT                   /protein_id="EDL14982.1"
FT   assembly_gap    7158133..7158263
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   gene            complement(7173020..7179520)
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /note="gene_id=mCG3935.2"
FT   mRNA            complement(join(7173020..7173283,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7177552..7177677,7178092..7178200,7178931..7179068,
FT                   7179467..7179520))
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), transcript variant
FT                   mCT2912"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT2912.2 created on
FT                   27-DEC-2002"
FT   mRNA            complement(join(<7173200..7173280,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7177552..7177677,7178092..7178200,7178931..>7178999))
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), transcript variant
FT                   mCT190874"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT190874.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7173200..7173280,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7177552..7177677,7178092..7178200,7178931..7178999))
FT                   /codon_start=1
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), isoform CRA_b"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT190874.0
FT                   protein_id=mCP111859.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3SXX1"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR022332"
FT                   /db_xref="InterPro:IPR034031"
FT                   /db_xref="MGI:MGI:2675303"
FT                   /db_xref="UniProtKB/TrEMBL:Q3SXX1"
FT                   /protein_id="EDL14984.1"
FT   CDS             complement(join(7173200..7173283,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7177552..7177677,7178092..7178200,7178931..7178999))
FT                   /codon_start=1
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), isoform CRA_c"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT2912.2
FT                   protein_id=mCP21680.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q71F55"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR022332"
FT                   /db_xref="InterPro:IPR034031"
FT                   /db_xref="MGI:MGI:2675303"
FT                   /db_xref="UniProtKB/TrEMBL:Q71F55"
FT                   /protein_id="EDL14985.1"
FT   mRNA            complement(join(<7173217..7173280,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7178931..7179068,7179467..>7179506))
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), transcript variant
FT                   mCT190873"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT190873.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<7173217..7173280,7173436..7173467,
FT                   7174154..7174317,7175367..7175457,7176216..7176371,
FT                   7178931..>7179060))
FT                   /codon_start=1
FT                   /gene="Tnfrsf14"
FT                   /locus_tag="mCG_3935"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 14 (herpesvirus entry mediator), isoform CRA_a"
FT                   /note="gene_id=mCG3935.2 transcript_id=mCT190873.0
FT                   protein_id=mCP111858.0 isoform=CRA_a"
FT                   /protein_id="EDL14983.1"
FT   assembly_gap    7193203..7193222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7198201..7198220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7206760..7206917
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    7209952..7209971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7211894..7212039
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            <7212426..>7213105
FT                   /gene="Hes5"
FT                   /locus_tag="mCG_3930"
FT                   /note="gene_id=mCG3930.0"
FT   mRNA            join(<7212426..7212479,7212566..7212731,7212822..>7213105)
FT                   /gene="Hes5"
FT                   /locus_tag="mCG_3930"
FT                   /product="hairy and enhancer of split 5 (Drosophila)"
FT                   /note="gene_id=mCG3930.0 transcript_id=mCT2919.0 created on
FT                   06-DEC-2002"
FT   CDS             join(7212426..7212479,7212566..7212731,7212822..7213105)
FT                   /codon_start=1
FT                   /gene="Hes5"
FT                   /locus_tag="mCG_3930"
FT                   /product="hairy and enhancer of split 5 (Drosophila)"
FT                   /note="gene_id=mCG3930.0 transcript_id=mCT2919.0
FT                   protein_id=mCP21737.0"
FT                   /db_xref="GOA:Q499J8"
FT                   /db_xref="InterPro:IPR003650"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:104876"
FT                   /db_xref="UniProtKB/TrEMBL:Q499J8"
FT                   /protein_id="EDL14986.1"
FT                   WRPW"
FT   gene            <7215563..7232400
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /note="gene_id=mCG3933.2"
FT   mRNA            join(<7215563..7215699,7220540..7220622,7220983..7221197,
FT                   7221404..7221587,7221857..7221949,7222337..7222490,
FT                   7222836..7223017,7223612..7223693,7223932..7224032,
FT                   7226093..7226248,7227725..7227837,7228046..7228133,
FT                   7228666..7228817,7229614..7229669,7229856..7229905,
FT                   7230384..7230488,7230955..7231055,7231189..7231257,
FT                   7231554..7231694,7231958..7232400)
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /product="pantothenate kinase 4, transcript variant
FT                   mCT190870"
FT                   /note="gene_id=mCG3933.2 transcript_id=mCT190870.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7215564..7215699,7220540..7220622,7220983..7221197,
FT                   7221404..7221587,7221857..7221949,7222337..7222490,
FT                   7222836..7223017,7223612..7223693,7223932..7224032,
FT                   7226093..7226248,7227725..7227837,7228046..7228133,
FT                   7228666..7228817,7229614..7229669,7229856..7229905,
FT                   7230384..7230488,7230955..7231055,7231189..7231257,
FT                   7231554..7231694,7231958..7232171)
FT                   /codon_start=1
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /product="pantothenate kinase 4, isoform CRA_a"
FT                   /note="gene_id=mCG3933.2 transcript_id=mCT190870.0
FT                   protein_id=mCP111857.0 isoform=CRA_a"
FT                   /protein_id="EDL14987.1"
FT                   FSVIFKYEVPTK"
FT   mRNA            join(<7215576..7215699,7220540..7220622,7220983..7221197,
FT                   7221404..7221587,7221857..7221949,7222337..7222490,
FT                   7222836..7223017,7223612..7223693,7223932..7224032,
FT                   7226093..7226248,7227725..7227837,7228046..7228133,
FT                   7228666..7228817,7229614..7229669,7229856..7229905,
FT                   7230384..7230488,7230955..7231055,7231189..7231257,
FT                   7231958..7232400)
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /product="pantothenate kinase 4, transcript variant
FT                   mCT2914"
FT                   /note="gene_id=mCG3933.2 transcript_id=mCT2914.2 created on
FT                   27-DEC-2002"
FT   CDS             join(7215576..7215699,7220540..7220622,7220983..7221197,
FT                   7221404..7221587,7221857..7221949,7222337..7222490,
FT                   7222836..7223017,7223612..7223693,7223932..7224032,
FT                   7226093..7226248,7227725..7227837,7228046..7228133,
FT                   7228666..7228817,7229614..7229669,7229856..7229905,
FT                   7230384..7230488,7230955..7231055,7231189..7231257,
FT                   7231958..7232171)
FT                   /codon_start=1
FT                   /gene="Pank4"
FT                   /locus_tag="mCG_3933"
FT                   /product="pantothenate kinase 4, isoform CRA_b"
FT                   /note="gene_id=mCG3933.2 transcript_id=mCT2914.2
FT                   protein_id=mCP21774.2 isoform=CRA_b"
FT                   /protein_id="EDL14988.1"
FT   assembly_gap    7222192..7222330
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   gene            complement(7234590..7260619)
FT                   /gene="Plcl4"
FT                   /locus_tag="mCG_3920"
FT                   /note="gene_id=mCG3920.2"
FT   mRNA            complement(join(7234590..7236440,7237691..7238492,
FT                   7240611..7240690,7240913..7241059,7241232..7241316,
FT                   7241396..7241520,7242189..7242296,7242515..7242697,
FT                   7242785..7242882,7244035..7244117,7244427..7244525,
FT                   7247637..7247795,7249954..7250061,7250352..7250523,
FT                   7251571..7251691,7251954..7252157,7252310..7252403,
FT                   7254261..7254431,7258084..7258212,7258400..7258643,
FT                   7260473..7260619))
FT                   /gene="Plcl4"
FT                   /locus_tag="mCG_3920"
FT                   /product="phospholipase C-like 4"
FT                   /note="gene_id=mCG3920.2 transcript_id=mCT2928.2 created on
FT                   30-DEC-2002"
FT   CDS             complement(join(7235137..7236440,7237691..7238492,
FT                   7240611..7240690,7240913..7241059,7241232..7241316,
FT                   7241396..7241520,7242189..7242296,7242515..7242697,
FT                   7242785..7242882,7244035..7244117,7244427..7244525,
FT                   7247637..7247795,7249954..7250061,7250352..7250523,
FT                   7251571..7251691,7251954..7252157,7252310..7252403,
FT                   7254261..7254431,7258084..7258092))
FT                   /codon_start=1
FT                   /gene="Plcl4"
FT                   /locus_tag="mCG_3920"
FT                   /product="phospholipase C-like 4"
FT                   /note="gene_id=mCG3920.2 transcript_id=mCT2928.2
FT                   protein_id=mCP21687.2"
FT                   /protein_id="EDL14989.1"
FT   assembly_gap    7283614..7283672
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    7293758..7294250
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   gene            7318719..7324172
FT                   /locus_tag="mCG_3937"
FT                   /note="gene_id=mCG3937.1"
FT   mRNA            join(7318719..7318911,7319560..7319640,7320400..7320806,
FT                   7322124..7322299,7322378..7322513,7323442..7324172)
FT                   /locus_tag="mCG_3937"
FT                   /product="mCG3937, transcript variant mCT2910"
FT                   /note="gene_id=mCG3937.1 transcript_id=mCT2910.1 created on
FT                   27-DEC-2002"
FT   mRNA            join(<7318793..7318911,7319560..7319640,7320400..7322513,
FT                   7323442..7323918)
FT                   /locus_tag="mCG_3937"
FT                   /product="mCG3937, transcript variant mCT190877"
FT                   /note="gene_id=mCG3937.1 transcript_id=mCT190877.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7318794..7318911,7319560..7319640,7320400..7320854)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3937"
FT                   /product="mCG3937, isoform CRA_a"
FT                   /note="gene_id=mCG3937.1 transcript_id=mCT190877.0
FT                   protein_id=mCP111860.0 isoform=CRA_a"
FT                   /protein_id="EDL14990.1"
FT   CDS             join(7318806..7318911,7319560..7319640,7320400..7320806,
FT                   7322124..7322299,7322378..7322513,7323442..7323510)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3937"
FT                   /product="mCG3937, isoform CRA_b"
FT                   /note="gene_id=mCG3937.1 transcript_id=mCT2910.1
FT                   protein_id=mCP21681.2 isoform=CRA_b"
FT                   /db_xref="GOA:B1AUE5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR025654"
FT                   /db_xref="MGI:MGI:2684988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1AUE5"
FT                   /protein_id="EDL14991.1"
FT   assembly_gap    7324188..7324532
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   gene            complement(7325939..7338118)
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /note="gene_id=mCG3927.1"
FT   mRNA            complement(join(7325939..7326855,7327416..7327551,
FT                   7328539..7328617,7330379..7330478,7332684..7332788,
FT                   7334552..7334639,7338026..7338118))
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /product="RER1 retention in endoplasmic reticulum 1 homolog
FT                   (S. cerevisiae), transcript variant mCT2916"
FT                   /note="gene_id=mCG3927.1 transcript_id=mCT2916.1 created on
FT                   06-DEC-2002"
FT   CDS             complement(join(7326766..7326855,7327416..7327551,
FT                   7328539..7328617,7330379..7330478,7332684..7332788,
FT                   7334552..7334632))
FT                   /codon_start=1
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /product="RER1 retention in endoplasmic reticulum 1 homolog
FT                   (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG3927.1 transcript_id=mCT2916.1
FT                   protein_id=mCP21727.2 isoform=CRA_b"
FT                   /protein_id="EDL14993.1"
FT   mRNA            complement(join(<7327484..7327551,7328539..7328617,
FT                   7330379..7330478,7332684..7332788,7334552..7334639,
FT                   7334994..7335202,7338026..>7338099))
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /product="RER1 retention in endoplasmic reticulum 1 homolog
FT                   (S. cerevisiae), transcript variant mCT190898"
FT                   /note="gene_id=mCG3927.1 transcript_id=mCT190898.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<7327484..7327551,7328539..7328617,
FT                   7330379..7330478,7332684..7332788,7334552..7334639,
FT                   7334994..>7335001))
FT                   /codon_start=1
FT                   /gene="Rer1"
FT                   /locus_tag="mCG_3927"
FT                   /product="RER1 retention in endoplasmic reticulum 1 homolog
FT                   (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG3927.1 transcript_id=mCT190898.0
FT                   protein_id=mCP111856.0 isoform=CRA_a"
FT                   /protein_id="EDL14992.1"
FT   assembly_gap    7329311..7329340
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7337924..7337943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7338421..7398496
FT                   /locus_tag="mCG_3921"
FT                   /note="gene_id=mCG3921.1"
FT   mRNA            join(7338421..7338502,7339242..7339313,7341306..7341404,
FT                   7342703..7342813,7344089..7344179,7344882..7344969,
FT                   7353065..7353161,7353889..7353999,7362887..7363010,
FT                   7363376..7363548,7380954..7381075,7381158..7381240,
FT                   7395391..7395434,7398157..7398496)
FT                   /locus_tag="mCG_3921"
FT                   /product="mCG3921, transcript variant mCT2929"
FT                   /note="gene_id=mCG3921.1 transcript_id=mCT2929.1 created on
FT                   20-DEC-2002"
FT   mRNA            join(7338422..7338502,7339242..7339313,7341306..7341404,
FT                   7342703..7342813,7344089..7344179,7344882..7344969,
FT                   7353065..7353161,7353889..7353999,7362887..7363010,
FT                   7363376..7363548,7380954..7381075,7381158..7381240,
FT                   7398157..7398400)
FT                   /locus_tag="mCG_3921"
FT                   /product="mCG3921, transcript variant mCT177682"
FT                   /note="gene_id=mCG3921.1 transcript_id=mCT177682.0 created
FT                   on 20-DEC-2002"
FT   CDS             join(7338427..7338502,7339242..7339313,7341306..7341404,
FT                   7342703..7342813,7344089..7344179,7344882..7344969,
FT                   7353065..7353161,7353889..7353999,7362887..7363010,
FT                   7363376..7363548,7380954..7381075,7381158..7381240,
FT                   7395391..7395434,7398157..7398299)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3921"
FT                   /product="mCG3921, isoform CRA_b"
FT                   /note="gene_id=mCG3921.1 transcript_id=mCT2929.1
FT                   protein_id=mCP21766.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2RTS7"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="MGI:MGI:1924116"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTS7"
FT                   /protein_id="EDL14995.1"
FT   CDS             join(7338427..7338502,7339242..7339313,7341306..7341404,
FT                   7342703..7342813,7344089..7344179,7344882..7344969,
FT                   7353065..7353161,7353889..7353999,7362887..7363010,
FT                   7363376..7363548,7380954..7381075,7381158..7381240,
FT                   7398157..7398181)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3921"
FT                   /product="mCG3921, isoform CRA_a"
FT                   /note="gene_id=mCG3921.1 transcript_id=mCT177682.0
FT                   protein_id=mCP100604.0 isoform=CRA_a"
FT                   /protein_id="EDL14994.1"
FT   assembly_gap    7352561..7352580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7358742..7359562
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    7361018..7361047
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7365333..7365766
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    7388954..7389607
FT                   /estimated_length=654
FT                   /gap_type="unknown"
FT   assembly_gap    7399019..7399081
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   gene            <7403947..>7404405
FT                   /locus_tag="mCG_1027449"
FT                   /note="gene_id=mCG1027449.1"
FT   mRNA            join(<7403947..7404082,7404295..>7404405)
FT                   /locus_tag="mCG_1027449"
FT                   /product="mCG1027449"
FT                   /note="gene_id=mCG1027449.1 transcript_id=mCT145153.1
FT                   created on 13-MAR-2003"
FT   CDS             join(<7403947..7404082,7404295..>7404405)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027449"
FT                   /product="mCG1027449"
FT                   /note="gene_id=mCG1027449.1 transcript_id=mCT145153.1
FT                   protein_id=mCP76688.1"
FT                   /protein_id="EDL14996.1"
FT   assembly_gap    7404086..7404275
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   gene            complement(7407291..>7475712)
FT                   /gene="Ski"
FT                   /locus_tag="mCG_3931"
FT                   /note="gene_id=mCG3931.1"
FT   mRNA            complement(join(7407291..7410720,7411137..7411367,
FT                   7412479..7412771,7412887..7413149,7413771..7413886,
FT                   7414025..7414147,7474744..>7475712))
FT                   /gene="Ski"
FT                   /locus_tag="mCG_3931"
FT                   /product="Sloan-Kettering viral oncogene homolog"
FT                   /note="gene_id=mCG3931.1 transcript_id=mCT2920.1 created on
FT                   06-DEC-2002"
FT   CDS             complement(join(7410532..7410720,7411137..7411367,
FT                   7412479..7412771,7412887..7413149,7413771..7413886,
FT                   7414025..7414147,7474744..7475712))
FT                   /codon_start=1
FT                   /gene="Ski"
FT                   /locus_tag="mCG_3931"
FT                   /product="Sloan-Kettering viral oncogene homolog"
FT                   /note="gene_id=mCG3931.1 transcript_id=mCT2920.1
FT                   protein_id=mCP21768.0"
FT                   /db_xref="GOA:B1AUF1"
FT                   /db_xref="InterPro:IPR003380"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010919"
FT                   /db_xref="InterPro:IPR014890"
FT                   /db_xref="InterPro:IPR023216"
FT                   /db_xref="InterPro:IPR028760"
FT                   /db_xref="MGI:MGI:98310"
FT                   /db_xref="UniProtKB/TrEMBL:B1AUF1"
FT                   /protein_id="EDL14997.1"
FT   assembly_gap    7427640..7427659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7459927..7460058
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    7475777..7476531
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    7486001..7486186
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    7489179..7489198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7503206..7510085
FT                   /locus_tag="mCG_23126"
FT                   /note="gene_id=mCG23126.1"
FT   mRNA            join(7503206..7503466,7503898..7504042,7504148..7504428,
FT                   7509530..7510085)
FT                   /locus_tag="mCG_23126"
FT                   /product="mCG23126, transcript variant mCT23149"
FT                   /note="gene_id=mCG23126.1 transcript_id=mCT23149.2 created
FT                   on 20-DEC-2002"
FT   CDS             join(7503405..7503466,7503898..7504042,7504148..7504428,
FT                   7509530..7509602)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23126"
FT                   /product="mCG23126, isoform CRA_b"
FT                   /note="gene_id=mCG23126.1 transcript_id=mCT23149.2
FT                   protein_id=mCP21674.2 isoform=CRA_b"
FT                   /protein_id="EDL14999.1"
FT   mRNA            join(<7503471..7504042,7504148..7504428,7509530..7510078)
FT                   /locus_tag="mCG_23126"
FT                   /product="mCG23126, transcript variant mCT190865"
FT                   /note="gene_id=mCG23126.1 transcript_id=mCT190865.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7503836..7504042,7504148..7504428,7509530..7509602)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23126"
FT                   /product="mCG23126, isoform CRA_a"
FT                   /note="gene_id=mCG23126.1 transcript_id=mCT190865.0
FT                   protein_id=mCP111835.0 isoform=CRA_a"
FT                   /protein_id="EDL14998.1"
FT   assembly_gap    7510121..7510140
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7515468..7614665)
FT                   /gene="Prkcz"
FT                   /locus_tag="mCG_23123"
FT                   /note="gene_id=mCG23123.1"
FT   mRNA            complement(join(7515468..7515922,7516093..7516208,
FT                   7521086..7521175,7521575..7521654,7522430..7522549,
FT                   7524596..7524683,7524866..7525001,7526338..7526424,
FT                   7540208..7540305,7543059..7543247,7543931..7543983,
FT                   7546586..7546667,7547695..7547826,7554358..7554443,
FT                   7608074..7608124,7609847..7609936,7610901..7611022,
FT                   7614571..7614665))
FT                   /gene="Prkcz"
FT                   /locus_tag="mCG_23123"
FT                   /product="protein kinase C, zeta"
FT                   /note="gene_id=mCG23123.1 transcript_id=mCT23147.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(7515835..7515922,7516093..7516208,
FT                   7521086..7521175,7521575..7521654,7522430..7522549,
FT                   7524596..7524683,7524866..7525001,7526338..7526424,
FT                   7540208..7540305,7543059..7543247,7543931..7543983,
FT                   7546586..7546667,7547695..7547826,7554358..7554443,
FT                   7608074..7608124,7609847..7609936,7610901..7611022,
FT                   7614571..7614641))
FT                   /codon_start=1
FT                   /gene="Prkcz"
FT                   /locus_tag="mCG_23123"
FT                   /product="protein kinase C, zeta"
FT                   /note="gene_id=mCG23123.1 transcript_id=mCT23147.1
FT                   protein_id=mCP21683.2"
FT                   /db_xref="GOA:Q02956"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012233"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR020454"
FT                   /db_xref="InterPro:IPR034877"
FT                   /db_xref="MGI:MGI:97602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02956"
FT                   /protein_id="EDL15000.1"
FT                   GFEYINPLLLSAEESV"
FT   assembly_gap    7532303..7532322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7536635..7536654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7624090..7624159
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    7626577..7626596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7638310..7651419)
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /note="gene_id=mCG23125.2"
FT   mRNA            complement(join(7638310..7639022,7639266..7639477,
FT                   7639734..7639889,7640485..7640622,7641189..7641271,
FT                   7641586..7641806,7641897..7641964,7642265..7642377,
FT                   7651233..7651419))
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit delta, transcript variant mCT23148"
FT                   /note="gene_id=mCG23125.2 transcript_id=mCT23148.2 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(7638311..7639022,7639266..7640622,
FT                   7641189..7641271,7641586..7641806,7641897..7641964,
FT                   7642265..7642377,7651233..>7651386))
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit delta, transcript variant mCT190863"
FT                   /note="gene_id=mCG23125.2 transcript_id=mCT190863.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7638732..7639022,7639266..7639477,
FT                   7639734..7639889,7640485..7640622,7641189..7641271,
FT                   7641586..7641806,7641897..7641964,7642265..7642377,
FT                   7651233..7651300))
FT                   /codon_start=1
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit delta, isoform CRA_b"
FT                   /note="gene_id=mCG23125.2 transcript_id=mCT23148.2
FT                   protein_id=mCP21670.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q14AH9"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008098"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95622"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AH9"
FT                   /protein_id="EDL15002.1"
FT   CDS             complement(join(7640435..7640622,7641189..7641271,
FT                   7641586..7641806,7641897..7641964,7642265..7642377,
FT                   7651233..>7651384))
FT                   /codon_start=1
FT                   /gene="Gabrd"
FT                   /locus_tag="mCG_23125"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor,
FT                   subunit delta, isoform CRA_a"
FT                   /note="gene_id=mCG23125.2 transcript_id=mCT190863.0
FT                   protein_id=mCP111834.0 isoform=CRA_a"
FT                   /protein_id="EDL15001.1"
FT   assembly_gap    7656108..7659218
FT                   /estimated_length=3111
FT                   /gap_type="unknown"
FT   gene            complement(7661954..>7668615)
FT                   /locus_tag="mCG_146182"
FT                   /note="gene_id=mCG146182.0"
FT   mRNA            complement(join(7661954..7663344,7664481..7665456,
FT                   7667549..7667717,7668545..>7668615))
FT                   /locus_tag="mCG_146182"
FT                   /product="mCG146182"
FT                   /note="gene_id=mCG146182.0 transcript_id=mCT186285.0
FT                   created on 14-JUL-2003"
FT   gene            7662832..>7674221
FT                   /locus_tag="mCG_1027453"
FT                   /note="gene_id=mCG1027453.1"
FT   mRNA            join(7662832..7663214,7669504..7669589,7672496..7672571,
FT                   7672723..7672866,7674121..>7674221)
FT                   /locus_tag="mCG_1027453"
FT                   /product="mCG1027453"
FT                   /note="gene_id=mCG1027453.1 transcript_id=mCT145157.1
FT                   created on 16-DEC-2002"
FT   CDS             complement(7664710..>7665237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146182"
FT                   /product="mCG146182"
FT                   /note="gene_id=mCG146182.0 transcript_id=mCT186285.0
FT                   protein_id=mCP107635.0"
FT                   /protein_id="EDL15003.1"
FT                   ALRSTPQIHSSF"
FT   assembly_gap    7666754..7667040
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   CDS             join(7669523..7669589,7672496..7672571,7672723..7672866,
FT                   7674121..>7674221)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027453"
FT                   /product="mCG1027453"
FT                   /note="gene_id=mCG1027453.1 transcript_id=mCT145157.1
FT                   protein_id=mCP76697.1"
FT                   /db_xref="MGI:MGI:1917130"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWF6"
FT                   /protein_id="EDL15004.1"
FT   assembly_gap    7670247..7670384
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   gene            7675779..7702185
FT                   /locus_tag="mCG_132275"
FT                   /note="gene_id=mCG132275.1"
FT   mRNA            join(7675779..7676178,7676449..7676622,7677133..7677243,
FT                   7677784..7677886,7678547..7678704,7679871..7680066,
FT                   7681144..7681302,7682999..7683172,7683749..7683867,
FT                   7688027..7688093,7688327..7688416,7690749..7690913,
FT                   7692200..7692335,7695642..7695721,7696420..7696542,
FT                   7700879..7701000,7701724..7702185)
FT                   /locus_tag="mCG_132275"
FT                   /product="mCG132275"
FT                   /note="gene_id=mCG132275.1 transcript_id=mCT133626.1
FT                   created on 27-DEC-2002"
FT   CDS             join(7676162..7676178,7676449..7676622,7677133..7677243,
FT                   7677784..7677886,7678547..7678704,7679871..7680066,
FT                   7681144..7681302,7682999..7683172,7683749..7683867,
FT                   7688027..7688093,7688327..7688416,7690749..7690913,
FT                   7692200..7692335,7695642..7695721,7696420..7696542,
FT                   7700879..7701000,7701724..7701811)
FT                   /codon_start=1
FT                   /locus_tag="mCG_132275"
FT                   /product="mCG132275"
FT                   /note="gene_id=mCG132275.1 transcript_id=mCT133626.1
FT                   protein_id=mCP76801.1"
FT                   /protein_id="EDL15005.1"
FT   assembly_gap    7686829..7687104
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    7693429..7693448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7716024..>7720486
FT                   /locus_tag="mCG_1027348"
FT                   /note="gene_id=mCG1027348.1"
FT   mRNA            join(7716024..7717418,7717535..7718086,7718669..7718798,
FT                   7718997..7719151,7719380..7719512,7719798..7719928,
FT                   7720149..7720287,7720395..>7720486)
FT                   /locus_tag="mCG_1027348"
FT                   /product="mCG1027348"
FT                   /note="gene_id=mCG1027348.1 transcript_id=mCT145052.1
FT                   created on 29-JAN-2003"
FT   CDS             join(7717991..7718086,7718669..7718798,7718997..7719151,
FT                   7719380..7719512,7719798..7719928,7720149..7720287,
FT                   7720395..>7720486)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027348"
FT                   /product="mCG1027348"
FT                   /note="gene_id=mCG1027348.1 transcript_id=mCT145052.1
FT                   protein_id=mCP76713.1"
FT                   /protein_id="EDL15006.1"
FT                   KVTFVAHVVTG"
FT   gene            7723198..7724942
FT                   /locus_tag="mCG_23365"
FT                   /note="gene_id=mCG23365.0"
FT   mRNA            join(7723198..7723295,7723388..7723431,7723547..7723588,
FT                   7724074..7724252,7724356..7724942)
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, transcript variant mCT23142"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT23142.2 created
FT                   on 20-DEC-2002"
FT   mRNA            join(7723199..7723295,7723388..7723431,7723529..7723588,
FT                   7724074..7724252,7724356..7724916)
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, transcript variant mCT177681"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT177681.0 created
FT                   on 20-DEC-2002"
FT   mRNA            join(7723199..7723295,7723388..7723588,7724074..7724252,
FT                   7724356..7724842)
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, transcript variant mCT177680"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT177680.0 created
FT                   on 20-DEC-2002"
FT   CDS             join(7723230..7723295,7723388..7723431,7723529..7723588,
FT                   7724074..7724252,7724356..7724615)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, isoform CRA_a"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT177681.0
FT                   protein_id=mCP100603.0 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZN39"
FT                   /db_xref="MGI:MGI:1916921"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN39"
FT                   /protein_id="EDL15007.1"
FT   CDS             join(7723230..7723295,7723388..7723431,7723547..7723588,
FT                   7724074..7724252,7724356..7724615)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, isoform CRA_b"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT23142.2
FT                   protein_id=mCP21754.1 isoform=CRA_b"
FT                   /protein_id="EDL15008.1"
FT   CDS             join(7724099..7724252,7724356..7724615)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23365"
FT                   /product="mCG23365, isoform CRA_c"
FT                   /note="gene_id=mCG23365.0 transcript_id=mCT177680.0
FT                   protein_id=mCP100602.0 isoform=CRA_c"
FT                   /protein_id="EDL15009.1"
FT   assembly_gap    7742462..7742481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7745354..7745373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7745476..7812349
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /note="gene_id=mCG23363.2"
FT   mRNA            join(7745476..7745708,7781685..7781781,7787968..7788006,
FT                   7789631..7789737,7794865..7794928,7797306..7797468,
FT                   7805937..7806003,7807600..7807801,7809297..7809513,
FT                   7811453..7811568,7811753..7812094)
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   transcript variant mCT23141"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT23141.1 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<7745498..7745708,7769797..7769845,7781685..7781781,
FT                   7787968..7788006,7789631..7789737,7794865..7794928,
FT                   7797306..7797468,7805937..7806003,7807600..7807801,
FT                   7809297..7809513,7811453..7811568,7811753..7812098)
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   transcript variant mCT190880"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT190880.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(7745654..7745708,7769797..7769845,7781685..7781781,
FT                   7787968..7788006,7789631..7789737,7794865..7794928,
FT                   7797306..7797468,7805937..7806003,7807600..7807801,
FT                   7809297..7809513,7811453..7811568,7811750..7812349)
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   transcript variant mCT176824"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT176824.0 created
FT                   on 06-DEC-2002"
FT   assembly_gap    7745932..7746057
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    7754292..7754381
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   gene            complement(7756476..7756881)
FT                   /pseudo
FT                   /locus_tag="mCG_23366"
FT                   /note="gene_id=mCG23366.2"
FT   mRNA            complement(7756476..7756881)
FT                   /pseudo
FT                   /locus_tag="mCG_23366"
FT                   /note="gene_id=mCG23366.2 transcript_id=mCT23144.2 created
FT                   on 27-DEC-2002"
FT   CDS             join(<7781716..7781781,7787968..7788006,7789631..7789737,
FT                   7794865..7794928,7797306..7797468,7805937..7806003,
FT                   7807600..7807801,7809297..7809513,7811453..7811559)
FT                   /codon_start=1
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT190880.0
FT                   protein_id=mCP111850.0 isoform=CRA_a"
FT                   /protein_id="EDL15010.1"
FT                   IWN"
FT   CDS             join(7781725..7781781,7787968..7788006,7789631..7789737,
FT                   7794865..7794928,7797306..7797468,7805937..7806003,
FT                   7807600..7807801,7809297..7809513,7811453..7811559)
FT                   /codon_start=1
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT176824.0
FT                   protein_id=mCP99746.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TQ70"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:95781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQ70"
FT                   /protein_id="EDL15011.1"
FT                   "
FT   CDS             join(7781725..7781781,7787968..7788006,7789631..7789737,
FT                   7794865..7794928,7797306..7797468,7805937..7806003,
FT                   7807600..7807801,7809297..7809513,7811453..7811559)
FT                   /codon_start=1
FT                   /gene="Gnb1"
FT                   /locus_tag="mCG_23363"
FT                   /product="guanine nucleotide binding protein, beta 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG23363.2 transcript_id=mCT23141.1
FT                   protein_id=mCP21732.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TQ70"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:95781"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQ70"
FT                   /protein_id="EDL15012.1"
FT                   "
FT   assembly_gap    7817683..7817775
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            7817948..7845269
FT                   /gene="Nadk"
FT                   /locus_tag="mCG_23367"
FT                   /note="gene_id=mCG23367.2"
FT   mRNA            join(7817948..7818228,7831005..7831474,7833588..7833671,
FT                   7838417..7838546,7839432..7839540,7839644..7839729,
FT                   7841009..7841111,7841637..7841776,7841965..7842064,
FT                   7842141..7842298,7842890..7842972,7843608..7845269)
FT                   /gene="Nadk"
FT                   /locus_tag="mCG_23367"
FT                   /product="NAD kinase"
FT                   /note="gene_id=mCG23367.2 transcript_id=mCT23145.2 created
FT                   on 06-DEC-2002"
FT   assembly_gap    7827247..7827538
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   CDS             join(7831296..7831474,7833588..7833671,7838417..7838546,
FT                   7839432..7839540,7839644..7839729,7841009..7841111,
FT                   7841637..7841776,7841965..7842064,7842141..7842298,
FT                   7842890..7842972,7843608..7843755)
FT                   /codon_start=1
FT                   /gene="Nadk"
FT                   /locus_tag="mCG_23367"
FT                   /product="NAD kinase"
FT                   /note="gene_id=mCG23367.2 transcript_id=mCT23145.2
FT                   protein_id=mCP21762.2"
FT                   /db_xref="GOA:P58058"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="MGI:MGI:2183149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58058"
FT                   /protein_id="EDL15013.1"
FT   assembly_gap    7848968..7850044
FT                   /estimated_length=1077
FT                   /gap_type="unknown"
FT   gene            7855723..7873351
FT                   /gene="A530082C11Rik"
FT                   /locus_tag="mCG_132283"
FT                   /note="gene_id=mCG132283.0"
FT   mRNA            join(7855723..7856461,7864150..7864630,7864812..7864947,
FT                   7865926..7866053,7866927..7867047,7869894..7869947,
FT                   7870508..7870580,7871965..7872110,7872861..7873351)
FT                   /gene="A530082C11Rik"
FT                   /locus_tag="mCG_132283"
FT                   /product="RIKEN cDNA A530082C11"
FT                   /note="gene_id=mCG132283.0 transcript_id=mCT133634.1
FT                   created on 27-DEC-2002"
FT   CDS             join(7864309..7864630,7864812..7864947,7865926..7866053,
FT                   7866927..7867047,7869894..7869947,7870508..7870580,
FT                   7871965..7872110,7872861..7873098)
FT                   /codon_start=1
FT                   /gene="A530082C11Rik"
FT                   /locus_tag="mCG_132283"
FT                   /product="RIKEN cDNA A530082C11"
FT                   /note="gene_id=mCG132283.0 transcript_id=mCT133634.1
FT                   protein_id=mCP76709.1"
FT                   /protein_id="EDL15014.1"
FT                   DSRQHH"
FT   assembly_gap    7871122..7871141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7873544..>7874576
FT                   /locus_tag="mCG_132285"
FT                   /note="gene_id=mCG132285.1"
FT   mRNA            7873544..>7874576
FT                   /locus_tag="mCG_132285"
FT                   /product="mCG132285"
FT                   /note="gene_id=mCG132285.1 transcript_id=mCT133636.1
FT                   created on 27-DEC-2002"
FT   CDS             7874444..>7874576
FT                   /codon_start=1
FT                   /locus_tag="mCG_132285"
FT                   /product="mCG132285"
FT                   /note="gene_id=mCG132285.1 transcript_id=mCT133636.1
FT                   protein_id=mCP76846.1"
FT                   /protein_id="EDL15015.1"
FT   assembly_gap    7875601..7875620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7877133..7878292)
FT                   /locus_tag="mCG_1027454"
FT                   /note="gene_id=mCG1027454.1"
FT   mRNA            complement(join(7877133..7877314,7877458..7878292))
FT                   /locus_tag="mCG_1027454"
FT                   /product="mCG1027454"
FT                   /note="gene_id=mCG1027454.1 transcript_id=mCT145158.1
FT                   created on 13-MAR-2003"
FT   CDS             complement(7877879..7878064)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027454"
FT                   /product="mCG1027454"
FT                   /note="gene_id=mCG1027454.1 transcript_id=mCT145158.1
FT                   protein_id=mCP76703.1"
FT                   /protein_id="EDL15016.1"
FT                   GGSHLRSYHFVDRGTV"
FT   gene            <7879263..7904191
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /note="gene_id=mCG132264.2"
FT   mRNA            join(<7879263..7879336,7879926..7880049,7881169..7881284,
FT                   7883090..7883217,7884434..7884572,7888331..7888467,
FT                   7892762..7892884,7893836..7893931,7894019..7894183,
FT                   7894989..7895054,7895757..7895932,7896727..7896817,
FT                   7901741..7901862,7902120..7902225,7902541..7902662,
FT                   7902744..7902851,7902975..7903091,7903270..7903418,
FT                   7903680..7903869,7903950..7904190)
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, transcript variant
FT                   mCT190878"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT190878.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<7879263..7879336,7879926..7880049,7881169..7881284,
FT                   7883090..7883217,7884434..7884572,7888331..7888467,
FT                   7892762..7892884,7893836..7893931,7894019..7894183,
FT                   7894989..7895054,7895757..7895932,7896727..7896817,
FT                   7901741..7901862,7902120..7902225,7902541..7902662,
FT                   7902744..7902851,7902975..7903091,7903270..7903418,
FT                   7903680..7903869,7903950..7904042)
FT                   /codon_start=1
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT190878.0
FT                   protein_id=mCP111813.0 isoform=CRA_b"
FT                   /protein_id="EDL15018.1"
FT                   F"
FT   mRNA            join(7879275..7879336,7879580..7879734,7879926..7880049,
FT                   7881169..7881284,7883090..7883217,7884434..7884572,
FT                   7888331..7888467,7892762..7892884,7893836..7893931,
FT                   7894019..7894183,7894989..7895054,7895757..7895932,
FT                   7896727..7896817,7901741..7901862,7902120..7902225,
FT                   7902541..7902662,7902744..7902851,7902975..7903091,
FT                   7903270..7903418,7903680..7903869,7903950..7904191)
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, transcript variant
FT                   mCT133622"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT133622.1
FT                   created on 06-DEC-2002"
FT   mRNA            join(7879278..7880049,7881169..7881284,7883090..7883217,
FT                   7884434..7884572,7888331..7888467,7892762..7892884,
FT                   7893836..7893931,7894022..7894183,7894989..7895054,
FT                   7895757..7895932,7896727..7896817,7901741..7901862,
FT                   7902120..7902225,7902541..7902662,7902744..7902851,
FT                   7902975..7903091,7903270..7903418,7903680..7903869,
FT                   7903950..7904190)
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, transcript variant
FT                   mCT133618"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT133618.0
FT                   created on 06-DEC-2002"
FT   mRNA            join(<7879305..7879336,7879926..7880168,7881169..7881284,
FT                   7883090..7883217,7884434..7884572,7888331..7888467,
FT                   7892762..7892884,7893836..7893931,7894019..7894183,
FT                   7894989..7895054,7895757..7895932,7896727..7896817,
FT                   7901741..7901862,7902120..7902225,7902541..7902662,
FT                   7902744..7902851,7902975..7903091,7903270..7903418,
FT                   7903680..7903869,7903950..7904190)
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, transcript variant
FT                   mCT190879"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT190879.0
FT                   created on 08-MAR-2004"
FT   CDS             join(7879939..7880049,7881169..7881284,7883090..7883217,
FT                   7884434..7884572,7888331..7888467,7892762..7892884,
FT                   7893836..7893931,7894019..7894183,7894989..7895054,
FT                   7895757..7895932,7896727..7896817,7901741..7901862,
FT                   7902120..7902225,7902541..7902662,7902744..7902851,
FT                   7902975..7903091,7903270..7903418,7903680..7903869,
FT                   7903950..7904042)
FT                   /codon_start=1
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, isoform CRA_d"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT133622.1
FT                   protein_id=mCP76783.1 isoform=CRA_d"
FT                   /protein_id="EDL15020.1"
FT   CDS             join(7879939..7880049,7881169..7881284,7883090..7883217,
FT                   7884434..7884572,7888331..7888467,7892762..7892884,
FT                   7893836..7893931,7894022..7894183,7894989..7895054,
FT                   7895757..7895932,7896727..7896817,7901741..7901862,
FT                   7902120..7902225,7902541..7902662,7902744..7902851,
FT                   7902975..7903091,7903270..7903418,7903680..7903869,
FT                   7903950..7904042)
FT                   /codon_start=1
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT133618.0
FT                   protein_id=mCP76667.1 isoform=CRA_a"
FT                   /protein_id="EDL15017.1"
FT   CDS             join(<7880085..7880168,7881169..7881284,7883090..7883217,
FT                   7884434..7884572,7888331..7888467,7892762..7892884,
FT                   7893836..7893931,7894019..7894183,7894989..7895054,
FT                   7895757..7895932,7896727..7896817,7901741..7901862,
FT                   7902120..7902225,7902541..7902662,7902744..7902851,
FT                   7902975..7903091,7903270..7903418,7903680..7903869,
FT                   7903950..7904042)
FT                   /codon_start=1
FT                   /gene="Cdc2l1"
FT                   /locus_tag="mCG_132264"
FT                   /product="cell division cycle 2-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG132264.2 transcript_id=mCT190879.0
FT                   protein_id=mCP111814.0 isoform=CRA_c"
FT                   /protein_id="EDL15019.1"
FT   assembly_gap    7899784..7899803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7904913..7907642)
FT                   /gene="Mmp23"
FT                   /locus_tag="mCG_23354"
FT                   /note="gene_id=mCG23354.0"
FT   mRNA            complement(join(7904913..7905141,7905265..7905391,
FT                   7905497..7905607,7905689..7905853,7906243..7906410,
FT                   7906480..7906619,7906707..7906843,7907286..7907642))
FT                   /gene="Mmp23"
FT                   /locus_tag="mCG_23354"
FT                   /product="matrix metallopeptidase 23"
FT                   /note="gene_id=mCG23354.0 transcript_id=mCT23189.0 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(7904967..7905141,7905265..7905391,
FT                   7905497..7905607,7905689..7905853,7906243..7906410,
FT                   7906480..7906619,7906707..7906843,7907286..7907438))
FT                   /codon_start=1
FT                   /gene="Mmp23"
FT                   /locus_tag="mCG_23354"
FT                   /product="matrix metallopeptidase 23"
FT                   /note="gene_id=mCG23354.0 transcript_id=mCT23189.0
FT                   protein_id=mCP21682.1"
FT                   /protein_id="EDL15021.1"
FT   gene            complement(7908736..7923062)
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /note="gene_id=mCG23356.2"
FT   mRNA            complement(join(7908736..7909255,7909367..7909432,
FT                   7909514..7909701,7909784..7909962,7910334..7910567,
FT                   7910656..7910782,7910908..7911068,7911175..7911331,
FT                   7911428..7911576,7911651..7911784,7911860..7912022,
FT                   7912117..7912221,7913385..7913527,7913650..7913844,
FT                   7913940..7914046,7915112..7915283,7915368..7915636,
FT                   7921260..7921415,7922822..7923062))
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /product="mindbomb homolog 2 (Drosophila), transcript
FT                   variant mCT23191"
FT                   /note="gene_id=mCG23356.2 transcript_id=mCT23191.2 created
FT                   on 06-DEC-2002"
FT   mRNA            complement(join(7908945..7909255,7909367..7909432,
FT                   7909514..7909701,7909784..7909962,7910334..7910567,
FT                   7910656..7910782,7910908..7911068,7911175..7911576,
FT                   7911651..7911784,7911860..7912022,7912117..7912221,
FT                   7913156..7913527,7913650..7913844,7913940..7914046,
FT                   7915112..7915283,7915368..7915636,7921260..>7921355))
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /product="mindbomb homolog 2 (Drosophila), transcript
FT                   variant mCT190909"
FT                   /note="gene_id=mCG23356.2 transcript_id=mCT190909.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7909017..7909255,7909367..7909432,
FT                   7909514..7909701,7909784..7909962,7910334..7910567,
FT                   7910656..7910782,7910908..7911068,7911175..7911331,
FT                   7911428..7911576,7911651..7911784,7911860..7912022,
FT                   7912117..7912221,7913385..7913527,7913650..7913844,
FT                   7913940..7914046,7915112..7915283,7915368..7915614))
FT                   /codon_start=1
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /product="mindbomb homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG23356.2 transcript_id=mCT23191.2
FT                   protein_id=mCP21694.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8R516"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR010606"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2679684"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R516"
FT                   /protein_id="EDL15023.1"
FT   CDS             complement(join(7909017..7909255,7909367..7909432,
FT                   7909514..7909701,7909784..7909962,7910334..7910567,
FT                   7910656..7910782,7910908..7911068,7911175..>7911381))
FT                   /codon_start=1
FT                   /gene="Mib2"
FT                   /locus_tag="mCG_23356"
FT                   /product="mindbomb homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG23356.2 transcript_id=mCT190909.0
FT                   protein_id=mCP111868.0 isoform=CRA_a"
FT                   /protein_id="EDL15022.1"
FT                   RDRIQIFV"
FT   assembly_gap    7926708..7933786
FT                   /estimated_length=7079
FT                   /gap_type="unknown"
FT   assembly_gap    7945902..7945962
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            <7945963..7947740
FT                   /locus_tag="mCG_1027372"
FT                   /note="gene_id=mCG1027372.1"
FT   mRNA            join(<7945963..7947268,7947719..7947740)
FT                   /locus_tag="mCG_1027372"
FT                   /product="mCG1027372"
FT                   /note="gene_id=mCG1027372.1 transcript_id=mCT145076.1
FT                   created on 29-JAN-2003"
FT   CDS             <7945965..7946588
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027372"
FT                   /product="mCG1027372"
FT                   /note="gene_id=mCG1027372.1 transcript_id=mCT145076.1
FT                   protein_id=mCP76891.1"
FT                   /protein_id="EDL15024.1"
FT   gene            7956483..7984871
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /note="gene_id=mCG23351.2"
FT   mRNA            join(7956483..7956821,7966795..7966938,7982417..7982556,
FT                   7983019..7983137,7984559..7984871)
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /product="Ssu72 RNA polymerase II CTD phosphatase homolog
FT                   (yeast), transcript variant mCT23185"
FT                   /note="gene_id=mCG23351.2 transcript_id=mCT23185.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<7956495..7956821,7966795..7966938,7982417..7982556,
FT                   7983019..7983276)
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /product="Ssu72 RNA polymerase II CTD phosphatase homolog
FT                   (yeast), transcript variant mCT190899"
FT                   /note="gene_id=mCG23351.2 transcript_id=mCT190899.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7956496..7956821,7966795..7966938,7982417..7982556,
FT                   7983019..7983203)
FT                   /codon_start=1
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /product="Ssu72 RNA polymerase II CTD phosphatase homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG23351.2 transcript_id=mCT190899.0
FT                   protein_id=mCP111846.0 isoform=CRA_a"
FT                   /protein_id="EDL15025.1"
FT   CDS             join(7956742..7956821,7966795..7966938,7982417..7982556,
FT                   7983019..7983137,7984559..7984660)
FT                   /codon_start=1
FT                   /gene="Ssu72"
FT                   /locus_tag="mCG_23351"
FT                   /product="Ssu72 RNA polymerase II CTD phosphatase homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG23351.2 transcript_id=mCT23185.2
FT                   protein_id=mCP21700.2 isoform=CRA_b"
FT                   /protein_id="EDL15026.1"
FT   assembly_gap    7959304..7959999
FT                   /estimated_length=696
FT                   /gap_type="unknown"
FT   assembly_gap    7964249..7964886
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    7985909..7986199
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   gene            7986213..>7991145
FT                   /locus_tag="mCG_23350"
FT                   /note="gene_id=mCG23350.2"
FT   mRNA            join(7986213..7986270,7986546..7986652,7990715..7990923,
FT                   7990997..>7991145)
FT                   /locus_tag="mCG_23350"
FT                   /product="mCG23350"
FT                   /note="gene_id=mCG23350.2 transcript_id=mCT23184.1 created
FT                   on 27-DEC-2002"
FT   CDS             join(7986214..7986270,7986546..7986652,7990715..7990923,
FT                   7990997..7991145)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23350"
FT                   /product="mCG23350"
FT                   /note="gene_id=mCG23350.2 transcript_id=mCT23184.1
FT                   protein_id=mCP21699.1"
FT                   /db_xref="GOA:B2RWJ3"
FT                   /db_xref="InterPro:IPR027947"
FT                   /db_xref="MGI:MGI:3648074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RWJ3"
FT                   /protein_id="EDL15027.1"
FT                   HNGHPSPRHL"
FT   gene            complement(7991792..8012251)
FT                   /locus_tag="mCG_142032"
FT                   /note="gene_id=mCG142032.0"
FT   mRNA            complement(join(7991792..7992503,7997186..7997294,
FT                   7998470..7998637,7999829..7999899,8000315..8000366,
FT                   8001290..8001414,8001631..8001756,8002026..8002082,
FT                   8002595..8002750,8004731..8004800,8005046..8005211,
FT                   8005921..8005990,8006852..8006911,8007234..8007335,
FT                   8008249..8008325,8011959..8012251))
FT                   /locus_tag="mCG_142032"
FT                   /product="mCG142032"
FT                   /note="gene_id=mCG142032.0 transcript_id=mCT178506.0
FT                   created on 27-DEC-2002"
FT   CDS             complement(join(7992339..7992503,7997186..7997294,
FT                   7998470..7998637,7999829..7999899,8000315..8000366,
FT                   8001290..8001414,8001631..8001756,8002026..8002082,
FT                   8002595..8002750,8004731..8004800,8005046..8005211,
FT                   8005921..8005990,8006852..8006911,8007234..8007335,
FT                   8008249..8008325,8011959..8012160))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142032"
FT                   /product="mCG142032"
FT                   /note="gene_id=mCG142032.0 transcript_id=mCT178506.0
FT                   protein_id=mCP101428.0"
FT                   /db_xref="GOA:Q925I1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR021911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1919214"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q925I1"
FT                   /protein_id="EDL15028.1"
FT                   DSQTNKPPHPSLLSC"
FT   gene            8012367..8014726
FT                   /gene="2610204G22Rik"
FT                   /locus_tag="mCG_1027455"
FT                   /note="gene_id=mCG1027455.0"
FT   mRNA            join(8012367..8012443,8012551..8012943,8014536..8014726)
FT                   /gene="2610204G22Rik"
FT                   /locus_tag="mCG_1027455"
FT                   /product="RIKEN cDNA 2610204G22"
FT                   /note="gene_id=mCG1027455.0 transcript_id=mCT145159.0
FT                   created on 16-DEC-2002"
FT   CDS             join(8012861..8012943,8014536..8014644)
FT                   /codon_start=1
FT                   /gene="2610204G22Rik"
FT                   /locus_tag="mCG_1027455"
FT                   /product="RIKEN cDNA 2610204G22"
FT                   /note="gene_id=mCG1027455.0 transcript_id=mCT145159.0
FT                   protein_id=mCP76705.1"
FT                   /protein_id="EDL15029.1"
FT                   RGLEVYFQQQHQASPCCL"
FT   gene            complement(8020455..8025741)
FT                   /gene="Vwa1"
FT                   /locus_tag="mCG_23349"
FT                   /note="gene_id=mCG23349.1"
FT   mRNA            complement(join(8020455..8021831,8021911..8022189,
FT                   8023890..8024447,8025635..8025741))
FT                   /gene="Vwa1"
FT                   /locus_tag="mCG_23349"
FT                   /product="von Willebrand factor A domain containing 1"
FT                   /note="gene_id=mCG23349.1 transcript_id=mCT23183.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(8021494..8021831,8021911..8022189,
FT                   8023890..8024447,8025635..8025707))
FT                   /codon_start=1
FT                   /gene="Vwa1"
FT                   /locus_tag="mCG_23349"
FT                   /product="von Willebrand factor A domain containing 1"
FT                   /note="gene_id=mCG23349.1 transcript_id=mCT23183.1
FT                   protein_id=mCP21747.2"
FT                   /protein_id="EDL15030.1"
FT                   TRAPQSMRPEAGPREP"
FT   assembly_gap    8025394..8025413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8030570..8030787
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   gene            complement(8034313..8037075)
FT                   /locus_tag="mCG_1027456"
FT                   /note="gene_id=mCG1027456.1"
FT   mRNA            complement(join(8034313..8035764,8036540..8037075))
FT                   /locus_tag="mCG_1027456"
FT                   /product="mCG1027456"
FT                   /note="gene_id=mCG1027456.1 transcript_id=mCT145160.1
FT                   created on 13-MAR-2003"
FT   CDS             complement(join(8035507..8035764,8036540..8036803))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027456"
FT                   /product="mCG1027456"
FT                   /note="gene_id=mCG1027456.1 transcript_id=mCT145160.1
FT                   protein_id=mCP76711.1"
FT                   /db_xref="GOA:Q3TYP4"
FT                   /db_xref="InterPro:IPR033355"
FT                   /db_xref="MGI:MGI:2444329"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TYP4"
FT                   /protein_id="EDL15031.1"
FT                   DEDKQLCAWV"
FT   assembly_gap    8036271..8036290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8042004..>8044013
FT                   /locus_tag="mCG_23358"
FT                   /note="gene_id=mCG23358.1"
FT   mRNA            join(8042004..8042340,8042430..8042964,8043639..>8044013)
FT                   /locus_tag="mCG_23358"
FT                   /product="mCG23358"
FT                   /note="gene_id=mCG23358.1 transcript_id=mCT23192.1 created
FT                   on 27-DEC-2002"
FT   CDS             join(8042156..8042340,8042430..8042964,8043639..8044013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23358"
FT                   /product="mCG23358"
FT                   /note="gene_id=mCG23358.1 transcript_id=mCT23192.1
FT                   protein_id=mCP21728.1"
FT                   /protein_id="EDL15032.1"
FT   gene            8053986..8060663
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /note="gene_id=mCG23357.2"
FT   mRNA            join(8053986..8054195,8054286..8054396,8057296..8057373,
FT                   8057685..8057846)
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, transcript
FT                   variant mCT176823"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT176823.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(8054068..8054195,8054286..8054396,8057296..8057373,
FT                   8059167..8059396,8060366..8060663)
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, transcript
FT                   variant mCT23187"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT23187.1 created
FT                   on 06-DEC-2002"
FT   mRNA            join(8054069..8054195,8054286..8054396,8057296..8057373,
FT                   8059167..8059517)
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, transcript
FT                   variant mCT176822"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT176822.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(8054109..8054195,8054286..8054396,8057296..8057373,
FT                   8059167..8059340)
FT                   /codon_start=1
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT23187.1
FT                   protein_id=mCP21709.2 isoform=CRA_b"
FT                   /protein_id="EDL15034.1"
FT   CDS             join(8054109..8054195,8054286..8054396,8057296..8057373,
FT                   8059167..8059340)
FT                   /codon_start=1
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT176822.0
FT                   protein_id=mCP99745.0 isoform=CRA_b"
FT                   /protein_id="EDL15035.1"
FT   CDS             join(8054109..8054195,8054286..8054396,8057296..8057373,
FT                   8057685..8057816)
FT                   /codon_start=1
FT                   /gene="Mrpl20"
FT                   /locus_tag="mCG_23357"
FT                   /product="mitochondrial ribosomal protein L20, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23357.2 transcript_id=mCT176823.0
FT                   protein_id=mCP99744.0 isoform=CRA_a"
FT                   /protein_id="EDL15033.1"
FT   gene            complement(<8062756..8063556)
FT                   /locus_tag="mCG_147505"
FT                   /note="gene_id=mCG147505.0"
FT   mRNA            complement(<8062756..8063556)
FT                   /locus_tag="mCG_147505"
FT                   /product="mCG147505"
FT                   /note="gene_id=mCG147505.0 transcript_id=mCT187768.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<8062756..8063132)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147505"
FT                   /product="mCG147505"
FT                   /note="gene_id=mCG147505.0 transcript_id=mCT187768.0
FT                   protein_id=mCP109464.0"
FT                   /protein_id="EDL15036.1"
FT   gene            <8063161..8075181
FT                   /locus_tag="mCG_23353"
FT                   /note="gene_id=mCG23353.3"
FT   mRNA            join(<8063161..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068582,8069134..8071023,
FT                   8071376..8071480,8071565..8071706,8072400..8072508,
FT                   8072593..8072685,8073982..8075181)
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, transcript variant mCT190903"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190903.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(8063174..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068582,8070924..8071023,
FT                   8071376..8071480,8071565..8071706,8072400..8072508,
FT                   8072593..8072685,8073982..8074939)
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, transcript variant mCT23188"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT23188.1 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8063180..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068582,8069134..8071023,
FT                   8071376..8071480,8071565..8071706,8072397..8072508,
FT                   8072593..8072685,8073982..8074993)
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, transcript variant mCT190902"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190902.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(8063190..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068582,8070924..8071023,
FT                   8071376..8071480,8071565..8071706,8072400..8072508,
FT                   8072593..8072685,8073982..8074336)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, isoform CRA_d"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT23188.1
FT                   protein_id=mCP21676.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q9JJA7"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="MGI:MGI:1927119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJA7"
FT                   /protein_id="EDL15040.1"
FT                   R"
FT   mRNA            join(<8063362..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068554,8074199..8074977)
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, transcript variant mCT190904"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190904.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8063364..8063471,8063819..8063893,8064109..8064218,
FT                   8065892..8066012,8068518..8068554,8074199..8074245)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, isoform CRA_c"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190904.0
FT                   protein_id=mCP111849.0 isoform=CRA_c"
FT                   /protein_id="EDL15039.1"
FT                   LL"
FT   CDS             join(<8070847..8071023,8071376..8071480,8071565..8071706,
FT                   8072397..8072508,8072593..8072685,8073982..8074336)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, isoform CRA_a"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190902.0
FT                   protein_id=mCP111847.0 isoform=CRA_a"
FT                   /protein_id="EDL15037.1"
FT   CDS             join(<8070847..8071023,8071376..8071480,8071565..8071706,
FT                   8072400..8072508,8072593..8072685,8073982..8074336)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23353"
FT                   /product="mCG23353, isoform CRA_b"
FT                   /note="gene_id=mCG23353.3 transcript_id=mCT190903.0
FT                   protein_id=mCP111848.0 isoform=CRA_b"
FT                   /protein_id="EDL15038.1"
FT   assembly_gap    8077379..8077398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8081866..8083280
FT                   /gene="Aurkaip1"
FT                   /locus_tag="mCG_23352"
FT                   /note="gene_id=mCG23352.0"
FT   mRNA            join(8081866..8081956,8082203..8082290,8082572..8083017,
FT                   8083111..8083280)
FT                   /gene="Aurkaip1"
FT                   /locus_tag="mCG_23352"
FT                   /product="aurora kinase A interacting protein 1"
FT                   /note="gene_id=mCG23352.0 transcript_id=mCT23186.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(8082236..8082290,8082572..8083017,8083111..8083212)
FT                   /codon_start=1
FT                   /gene="Aurkaip1"
FT                   /locus_tag="mCG_23352"
FT                   /product="aurora kinase A interacting protein 1"
FT                   /note="gene_id=mCG23352.0 transcript_id=mCT23186.0
FT                   protein_id=mCP21675.1"
FT                   /db_xref="GOA:Q3TZ21"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="MGI:MGI:1913327"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TZ21"
FT                   /protein_id="EDL15041.1"
FT   assembly_gap    8087071..8087173
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   gene            8090384..8094642
FT                   /gene="Mxra8"
FT                   /locus_tag="mCG_132165"
FT                   /note="gene_id=mCG132165.0"
FT   mRNA            join(8090384..8090477,8091363..8091383,8091491..8091793,
FT                   8092029..8092130,8092246..8092716,8093085..8093243,
FT                   8093321..8093360,8093433..8093509,8093586..8093666,
FT                   8093832..8094642)
FT                   /gene="Mxra8"
FT                   /locus_tag="mCG_132165"
FT                   /product="matrix-remodelling associated 8"
FT                   /note="gene_id=mCG132165.0 transcript_id=mCT133512.0
FT                   created on 06-DEC-2002"
FT   CDS             join(8090429..8090477,8091363..8091383,8091491..8091793,
FT                   8092029..8092130,8092246..8092716,8093085..8093243,
FT                   8093321..8093360,8093433..8093509,8093586..8093666,
FT                   8093832..8093857)
FT                   /codon_start=1
FT                   /gene="Mxra8"
FT                   /locus_tag="mCG_132165"
FT                   /product="matrix-remodelling associated 8"
FT                   /note="gene_id=mCG132165.0 transcript_id=mCT133512.0
FT                   protein_id=mCP76754.1"
FT                   /protein_id="EDL15042.1"
FT   gene            8097797..8109639
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /note="gene_id=mCG23342.2"
FT   mRNA            join(8097797..8098229,8103757..8103826,8103976..8104097,
FT                   8104322..8104425,8104668..8104806,8104904..8104997,
FT                   8105069..8105138,8105224..8105363,8105442..8105518,
FT                   8105610..8105677,8105805..8105957,8106469..8106600,
FT                   8106699..8106866,8106951..8107157,8108330..8109639)
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila),
FT                   transcript variant mCT23176"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT23176.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8097996..8098229,8103757..8103826,8103976..8104097,
FT                   8104322..8104425,8104668..8104806,8104904..8105363,
FT                   8105442..8105518,8105610..8105677,8105805..8105957,
FT                   8106469..8106600,8106699..8106866,8106951..8107157,
FT                   8107833..8107871,8108330..8109638)
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila),
FT                   transcript variant mCT190872"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT190872.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8098060..8098229,8103757..8103826,8103976..8104102,
FT                   8104337..8104425,8104668..8104806,8104904..8104997,
FT                   8105069..8105138,8105224..8105363,8105442..8105518,
FT                   8105610..8105677,8105805..8105957,8106469..8106600,
FT                   8106699..8106866,8106951..8107157,8108330..>8108703)
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila),
FT                   transcript variant mCT190871"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT190871.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(8098060..8098229,8103757..8103826,8103976..8104097,
FT                   8104322..8104425,8104668..8104806,8104904..8104997,
FT                   8105069..8105138,8105224..8105363,8105442..8105518,
FT                   8105610..8105677,8105805..8105957,8106469..8106600,
FT                   8106699..8106866,8106951..8107157,8108330..8108703)
FT                   /codon_start=1
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT23176.2
FT                   protein_id=mCP21759.2 isoform=CRA_c"
FT                   /db_xref="GOA:P51141"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001158"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR003351"
FT                   /db_xref="InterPro:IPR008339"
FT                   /db_xref="InterPro:IPR008340"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015506"
FT                   /db_xref="InterPro:IPR024580"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:94941"
FT                   /db_xref="PDB:1FSH"
FT                   /db_xref="PDB:1MC7"
FT                   /db_xref="PDB:2KAW"
FT                   /db_xref="PDB:2MX6"
FT                   /db_xref="PDB:3PZ8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51141"
FT                   /protein_id="EDL15045.1"
FT                   M"
FT   CDS             join(<8104056..8104102,8104337..8104425,8104668..8104806,
FT                   8104904..8104997,8105069..8105138,8105224..8105363,
FT                   8105442..8105518,8105610..8105677,8105805..8105957,
FT                   8106469..8106600,8106699..8106866,8106951..8107157,
FT                   8108330..8108703)
FT                   /codon_start=1
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT190871.0
FT                   protein_id=mCP111841.0 isoform=CRA_a"
FT                   /protein_id="EDL15043.1"
FT                   PCEFFVDIM"
FT   CDS             join(<8105112..8105363,8105442..8105518,8105610..8105677,
FT                   8105805..8105957,8106469..8106600,8106699..8106866,
FT                   8106951..8107157,8107833..8107843)
FT                   /codon_start=1
FT                   /gene="Dvl1"
FT                   /locus_tag="mCG_23342"
FT                   /product="dishevelled, dsh homolog 1 (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG23342.2 transcript_id=mCT190872.0
FT                   protein_id=mCP111842.0 isoform=CRA_b"
FT                   /protein_id="EDL15044.1"
FT                   CGSGSAGSQQSEALD"
FT   gene            complement(8109615..8113676)
FT                   /gene="Tas1r3"
FT                   /locus_tag="mCG_56364"
FT                   /note="gene_id=mCG56364.1"
FT   mRNA            complement(join(8109615..8111469,8111645..8111765,
FT                   8111864..8112061,8112173..8112976,8113057..8113357,
FT                   8113467..8113676))
FT                   /gene="Tas1r3"
FT                   /locus_tag="mCG_56364"
FT                   /product="taste receptor, type 1, member 3"
FT                   /note="gene_id=mCG56364.1 transcript_id=mCT56547.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(8110508..8111469,8111645..8111765,
FT                   8111864..8112061,8112173..8112976,8113057..8113357,
FT                   8113467..8113657))
FT                   /codon_start=1
FT                   /gene="Tas1r3"
FT                   /locus_tag="mCG_56364"
FT                   /product="taste receptor, type 1, member 3"
FT                   /note="gene_id=mCG56364.1 transcript_id=mCT56547.1
FT                   protein_id=mCP41699.2"
FT                   /protein_id="EDL15046.1"
FT   gene            complement(8115592..8119747)
FT                   /gene="BC002216"
FT                   /locus_tag="mCG_23341"
FT                   /note="gene_id=mCG23341.1"
FT   mRNA            complement(join(8115592..8117191,8117419..8117643,
FT                   8119475..8119747))
FT                   /gene="BC002216"
FT                   /locus_tag="mCG_23341"
FT                   /product="cDNA sequence BC002216"
FT                   /note="gene_id=mCG23341.1 transcript_id=mCT23175.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(8116663..8117191,8117419..8117540))
FT                   /codon_start=1
FT                   /gene="BC002216"
FT                   /locus_tag="mCG_23341"
FT                   /product="cDNA sequence BC002216"
FT                   /note="gene_id=mCG23341.1 transcript_id=mCT23175.1
FT                   protein_id=mCP21758.1"
FT                   /protein_id="EDL15047.1"
FT   gene            8119881..8139576
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /note="gene_id=mCG23348.1"
FT   mRNA            join(8119881..8120028,8122435..8122532,8123166..8123239,
FT                   8125726..8125954,8135450..8135548,8135639..8135673,
FT                   8135917..8136055,8136446..8136510,8137152..8137341,
FT                   8137470..8137553,8137786..8137875,8137959..8138121,
FT                   8138209..8138316,8138402..8138463,8138538..8138680,
FT                   8138750..8138879,8138974..8139576)
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /product="cleavage and polyadenylation specific factor
FT                   3-like, transcript variant mCT23181"
FT                   /note="gene_id=mCG23348.1 transcript_id=mCT23181.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8119950..8120028,8122435..8122532,8123166..8123239,
FT                   8125817..8125954,8135450..8135548,8135639..8135673,
FT                   8135917..8136055,8136446..8136510,8137152..>8137273)
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /product="cleavage and polyadenylation specific factor
FT                   3-like, transcript variant mCT190883"
FT                   /note="gene_id=mCG23348.1 transcript_id=mCT190883.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(8120001..8120028,8122435..8122532,8123166..8123239,
FT                   8125726..8125954,8135450..8135548,8135639..8135673,
FT                   8135917..8136055,8136446..8136510,8137152..8137341,
FT                   8137470..8137553,8137786..8137875,8137959..8138121,
FT                   8138209..8138316,8138402..8138463,8138538..8138680,
FT                   8138750..8138879,8138974..8139039)
FT                   /codon_start=1
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /product="cleavage and polyadenylation specific factor
FT                   3-like, isoform CRA_b"
FT                   /note="gene_id=mCG23348.1 transcript_id=mCT23181.2
FT                   protein_id=mCP21764.2 isoform=CRA_b"
FT                   /protein_id="EDL15049.1"
FT   CDS             join(<8123216..8123239,8125817..8125954,8135450..8135548,
FT                   8135639..8135673,8135917..8136055,8136446..8136510,
FT                   8137152..>8137273)
FT                   /codon_start=1
FT                   /gene="Cpsf3l"
FT                   /locus_tag="mCG_23348"
FT                   /product="cleavage and polyadenylation specific factor
FT                   3-like, isoform CRA_a"
FT                   /note="gene_id=mCG23348.1 transcript_id=mCT190883.0
FT                   protein_id=mCP111845.0 isoform=CRA_a"
FT                   /protein_id="EDL15048.1"
FT   gene            complement(8138233..8142080)
FT                   /locus_tag="mCG_23338"
FT                   /note="gene_id=mCG23338.2"
FT   mRNA            complement(join(8138233..8138621,8138877..8139121,
FT                   8139788..8139950,8140023..8140077,8140850..8141020,
FT                   8141104..8141253,8141400..8141763,8141920..8142080))
FT                   /locus_tag="mCG_23338"
FT                   /product="mCG23338, transcript variant mCT23173"
FT                   /note="gene_id=mCG23338.2 transcript_id=mCT23173.2 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(8139024..8139121,8139788..8139950,
FT                   8140023..8140077,8140850..8141020,8141104..8141253,
FT                   8141400..8141617))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23338"
FT                   /product="mCG23338, isoform CRA_b"
FT                   /note="gene_id=mCG23338.2 transcript_id=mCT23173.2
FT                   protein_id=mCP21763.2 isoform=CRA_b"
FT                   /protein_id="EDL15051.1"
FT                   LGA"
FT   mRNA            complement(join(8139270..8139522,8139788..8139950,
FT                   8140023..8140077,8140850..8141020,8141104..8141253,
FT                   8141400..8141587,8141706..8142059))
FT                   /locus_tag="mCG_23338"
FT                   /product="mCG23338, transcript variant mCT177836"
FT                   /note="gene_id=mCG23338.2 transcript_id=mCT177836.0 created
FT                   on 30-DEC-2002"
FT   CDS             complement(join(8139509..8139522,8139788..8139950,
FT                   8140023..8140077,8140850..8141010))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23338"
FT                   /product="mCG23338, isoform CRA_a"
FT                   /note="gene_id=mCG23338.2 transcript_id=mCT177836.0
FT                   protein_id=mCP100758.0 isoform=CRA_a"
FT                   /protein_id="EDL15050.1"
FT   gene            8142250..8157130
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /note="gene_id=mCG23347.2"
FT   mRNA            join(8142250..8142789,8145834..8145918,8146452..8146509,
FT                   8146908..8147027,8147225..8147278,8148672..8148730,
FT                   8149227..8149410,8149769..8149813,8149899..8149994,
FT                   8150097..8150171,8151468..8151595,8151684..8151735,
FT                   8151940..8152040,8152113..8152224,8152466..8152674,
FT                   8152768..8152837,8152947..8153041,8153119..8153321,
FT                   8153558..8153665,8154688..8154786,8154873..8155108,
FT                   8155285..8155394,8155483..8155593,8155688..8157130)
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, transcript variant mCT23182"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT23182.2 created
FT                   on 30-DEC-2002"
FT   mRNA            join(8142250..8142789,8146452..8146509,8146908..8147027,
FT                   8147225..8147278,8148672..8148730,8149227..8149410,
FT                   8149769..8149813,8149899..8149994,8150097..8150171,
FT                   8151483..8151595,8151684..8151735,8151940..8152040,
FT                   8152113..8152224,8152466..8152674,8152768..8152837,
FT                   8152947..8153041,8153119..8153218,8154983..8155108,
FT                   8155285..8155394,8155483..8155593,8155688..8156218)
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, transcript variant mCT177837"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT177837.0 created
FT                   on 30-DEC-2002"
FT   mRNA            join(<8142656..8142789,8146452..8146509,8146908..8147027,
FT                   8147225..8147278,8148672..8148730,8149227..8149410,
FT                   8149769..8149813,8149899..8149994,8150097..8150171,
FT                   8151468..8151595,8151684..8151735,8151940..8152040,
FT                   8152113..8152224,8152466..8152674,8152768..8152837,
FT                   8152947..8153041,8153119..8153665,8154688..8154786,
FT                   8154873..8155108,8155285..8155394,8155483..8155593,
FT                   8155688..8157130)
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, transcript variant mCT190882"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT190882.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8142725..8142789,8146452..8146509,8146908..8147027,
FT                   8147225..8147278,8148672..8148730,8149227..8149410,
FT                   8149769..8149813,8149899..8149994,8150097..8150171,
FT                   8151468..8151595,8151684..8151735,8151940..8152040,
FT                   8152113..8152224,8152466..8152674,8152768..8152837,
FT                   8152947..8153041,8153119..8153350)
FT                   /codon_start=1
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, isoform CRA_b"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT190882.0
FT                   protein_id=mCP111844.0 isoform=CRA_b"
FT                   /protein_id="EDL15053.1"
FT                   GRAARSCT"
FT   CDS             join(8142743..8142789,8146452..8146509,8146908..8147027,
FT                   8147225..8147278,8148672..8148730,8149227..8149410,
FT                   8149769..8149813,8149899..8149994,8150097..8150171,
FT                   8151483..8151595,8151684..8151735,8151940..8152040,
FT                   8152113..8152224,8152466..8152674,8152768..8152837,
FT                   8152947..8153041,8153119..8153218,8154983..8155108,
FT                   8155285..8155394,8155483..8155593,8155688..8155835)
FT                   /codon_start=1
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, isoform CRA_a"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT177837.0
FT                   protein_id=mCP100759.0 isoform=CRA_a"
FT                   /protein_id="EDL15052.1"
FT                   "
FT   CDS             join(8146929..8147027,8147225..8147278,8148672..8148730,
FT                   8149227..8149410,8149769..8149813,8149899..8149994,
FT                   8150097..8150171,8151468..8151595,8151684..8151735,
FT                   8151940..8152040,8152113..8152224,8152466..8152674,
FT                   8152768..8152837,8152947..8153041,8153119..8153321,
FT                   8153558..8153665,8154688..8154786,8154873..8155108,
FT                   8155285..8155394,8155483..8155593,8155688..8155835)
FT                   /codon_start=1
FT                   /gene="Centb5"
FT                   /locus_tag="mCG_23347"
FT                   /product="centaurin, beta 5, isoform CRA_c"
FT                   /note="gene_id=mCG23347.2 transcript_id=mCT23182.2
FT                   protein_id=mCP21744.2 isoform=CRA_c"
FT                   /protein_id="EDL15054.1"
FT   gene            complement(<8160144..8161262)
FT                   /locus_tag="mCG_132192"
FT                   /note="gene_id=mCG132192.1"
FT   mRNA            complement(join(<8160144..8160238,8160342..8160571,
FT                   8161111..8161262))
FT                   /locus_tag="mCG_132192"
FT                   /product="mCG132192"
FT                   /note="gene_id=mCG132192.1 transcript_id=mCT133541.1
FT                   created on 30-DEC-2002"
FT   CDS             complement(join(<8160144..8160238,8160342..8160571,
FT                   8161111..8161181))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132192"
FT                   /product="mCG132192"
FT                   /note="gene_id=mCG132192.1 transcript_id=mCT133541.1
FT                   protein_id=mCP76698.1"
FT                   /protein_id="EDL15055.1"
FT   assembly_gap    8165571..8166193
FT                   /estimated_length=623
FT                   /gap_type="unknown"
FT   assembly_gap    8167467..8167486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8168141..8171051
FT                   /estimated_length=2911
FT                   /gap_type="unknown"
FT   gene            complement(8173004..8176541)
FT                   /locus_tag="mCG_132174"
FT                   /note="gene_id=mCG132174.1"
FT   mRNA            complement(join(8173004..8175348,8175745..8176541))
FT                   /locus_tag="mCG_132174"
FT                   /product="mCG132174"
FT                   /note="gene_id=mCG132174.1 transcript_id=mCT133523.1
FT                   created on 30-DEC-2002"
FT   CDS             complement(join(8174687..8175348,8175745..8176318))
FT                   /codon_start=1
FT                   /locus_tag="mCG_132174"
FT                   /product="mCG132174"
FT                   /note="gene_id=mCG132174.1 transcript_id=mCT133523.1
FT                   protein_id=mCP76913.1"
FT                   /protein_id="EDL15056.1"
FT                   LFTLWIFSEEKT"
FT   assembly_gap    8178434..8178453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8179481..8179500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8180874..8180893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8185498..8185567
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            8185933..8200064
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /note="gene_id=mCG23339.2"
FT   mRNA            join(8185933..8186078,8188315..8188477,8191102..8191232,
FT                   8193564..8193604,8197584..8197686,8197772..8197910,
FT                   8198712..8198792,8199429..8200064)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT176820"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT176820.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8186057..8186078,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..>8199501)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT190906"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190906.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8186058..8186078,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..>8199501)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190906.0
FT                   protein_id=mCP111838.0 isoform=CRA_a"
FT                   /protein_id="EDL15057.1"
FT   mRNA            join(8186063..8186223,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8200064)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT23171"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT23171.1 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8186231..8186332,8188315..8188477,8191102..8191232,
FT                   8193564..8193604,8197584..8197686,8197772..8197910,
FT                   8198712..8198792,8199429..8200064)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT190907"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190907.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8188313..8188477,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8199696,8199796..8199991)
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), transcript variant mCT190908"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190908.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8188415..8188477,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8199696,8199796..8199869)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_c"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190908.0
FT                   protein_id=mCP111840.0 isoform=CRA_c"
FT                   /protein_id="EDL15059.1"
FT                   DSRASLFKNLKEKAKTKM"
FT   CDS             join(<8188415..8188477,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8199713)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT190907.0
FT                   protein_id=mCP111839.0 isoform=CRA_b"
FT                   /protein_id="EDL15058.1"
FT   CDS             join(8188442..8188477,8191102..8191232,8193564..8193604,
FT                   8197584..8197686,8197772..8197910,8198712..8198792,
FT                   8199429..8199713)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_e"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT176820.0
FT                   protein_id=mCP99742.0 isoform=CRA_e"
FT                   /db_xref="GOA:B1ASK8"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="MGI:MGI:2153608"
FT                   /db_xref="UniProtKB/TrEMBL:B1ASK8"
FT                   /protein_id="EDL15061.1"
FT   assembly_gap    8188511..8188530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(8191102..8191232,8193564..8193604,8197584..8197686,
FT                   8197772..8197910,8198712..8198792,8199429..8199713)
FT                   /codon_start=1
FT                   /gene="Ube2j2"
FT                   /locus_tag="mCG_23339"
FT                   /product="ubiquitin-conjugating enzyme E2, J2 homolog
FT                   (yeast), isoform CRA_d"
FT                   /note="gene_id=mCG23339.2 transcript_id=mCT23171.1
FT                   protein_id=mCP21753.1 isoform=CRA_d"
FT                   /protein_id="EDL15060.1"
FT   gene            8204679..8208962
FT                   /gene="C1qdc2"
FT                   /locus_tag="mCG_23337"
FT                   /note="gene_id=mCG23337.0"
FT   mRNA            join(8204679..8205103,8206888..8207004,8207113..8207233,
FT                   8207325..8207476,8207932..8208040,8208203..8208293,
FT                   8208419..8208497,8208741..8208962)
FT                   /gene="C1qdc2"
FT                   /locus_tag="mCG_23337"
FT                   /product="C1q domain containing 2"
FT                   /note="gene_id=mCG23337.0 transcript_id=mCT23172.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(8204945..8205103,8206888..8207004,8207113..8207233,
FT                   8207325..8207476,8207932..8208040,8208203..8208293,
FT                   8208419..8208497,8208741..8208839)
FT                   /codon_start=1
FT                   /gene="C1qdc2"
FT                   /locus_tag="mCG_23337"
FT                   /product="C1q domain containing 2"
FT                   /note="gene_id=mCG23337.0 transcript_id=mCT23172.0
FT                   protein_id=mCP21745.1"
FT                   /protein_id="EDL15062.1"
FT   assembly_gap    8223997..8224016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8229840..8229859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8233133..8235201)
FT                   /gene="B3galt6"
FT                   /locus_tag="mCG_51249"
FT                   /note="gene_id=mCG51249.2"
FT   mRNA            complement(8233133..8235201)
FT                   /gene="B3galt6"
FT                   /locus_tag="mCG_51249"
FT                   /product="UDP-Gal:betaGal beta 1,3-galactosyltransferase,
FT                   polypeptide 6"
FT                   /note="gene_id=mCG51249.2 transcript_id=mCT51432.2 created
FT                   on 06-DEC-2002"
FT   CDS             complement(8234218..8235195)
FT                   /codon_start=1
FT                   /gene="B3galt6"
FT                   /locus_tag="mCG_51249"
FT                   /product="UDP-Gal:betaGal beta 1,3-galactosyltransferase,
FT                   polypeptide 6"
FT                   /note="gene_id=mCG51249.2 transcript_id=mCT51432.2
FT                   protein_id=mCP41714.1"
FT                   /protein_id="EDL15063.1"
FT   gene            <8235419..8252496
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /note="gene_id=mCG23336.3"
FT   mRNA            join(<8235419..8235553,8235700..8235881,8238739..8239068,
FT                   8241768..8241904,8243040..8243153,8250965..8251123,
FT                   8251322..8251497,8251952..8252387)
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, transcript variant
FT                   mCT190901"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT190901.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(8235458..8235881,8238739..8239068,8241768..8241904,
FT                   8243040..8243153,8250965..8251123,8251322..8251497,
FT                   8251952..8252496)
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, transcript variant
FT                   mCT23170"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT23170.1 created
FT                   on 06-DEC-2002"
FT   CDS             join(<8235826..8235881,8238739..8239068,8241768..8241904,
FT                   8243040..8243153,8250965..8251123,8251322..8251497,
FT                   8251952..8252128)
FT                   /codon_start=1
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, isoform CRA_b"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT190901.0
FT                   protein_id=mCP111837.0 isoform=CRA_b"
FT                   /protein_id="EDL15065.1"
FT   mRNA            join(<8235920..8236116,8238739..8239068,8241768..8241904,
FT                   8243040..8243153,8250965..8251123,8251322..8251497,
FT                   8251952..8252384)
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, transcript variant
FT                   mCT190900"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT190900.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8235920..8236116,8238739..8239068,8241768..8241904,
FT                   8243040..8243153,8250965..8251123,8251322..8251497,
FT                   8251952..8252128)
FT                   /codon_start=1
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, isoform CRA_a"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT190900.0
FT                   protein_id=mCP111836.0 isoform=CRA_a"
FT                   /protein_id="EDL15064.1"
FT   CDS             join(8238746..8239068,8241768..8241904,8243040..8243153,
FT                   8250965..8251123,8251322..8251497,8251952..8252128)
FT                   /codon_start=1
FT                   /gene="Sdf4"
FT                   /locus_tag="mCG_23336"
FT                   /product="stromal cell derived factor 4, isoform CRA_c"
FT                   /note="gene_id=mCG23336.3 transcript_id=mCT23170.1
FT                   protein_id=mCP21735.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q61112"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:108079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61112"
FT                   /protein_id="EDL15066.1"
FT   assembly_gap    8239562..8239581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8240799..8240986
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   gene            8255834..8258740
FT                   /gene="Tnfrsf4"
FT                   /locus_tag="mCG_23346"
FT                   /note="gene_id=mCG23346.0"
FT   mRNA            join(8255834..8256145,8256367..8256489,8257041..8257148,
FT                   8257525..8257591,8258029..8258225,8258305..8258424,
FT                   8258513..8258740)
FT                   /gene="Tnfrsf4"
FT                   /locus_tag="mCG_23346"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 4"
FT                   /note="gene_id=mCG23346.0 transcript_id=mCT23180.1 created
FT                   on 06-DEC-2002"
FT   CDS             join(8256013..8256145,8256367..8256489,8257041..8257148,
FT                   8257525..8257591,8258029..8258225,8258305..8258424,
FT                   8258513..8258583)
FT                   /codon_start=1
FT                   /gene="Tnfrsf4"
FT                   /locus_tag="mCG_23346"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 4"
FT                   /note="gene_id=mCG23346.0 transcript_id=mCT23180.1
FT                   protein_id=mCP21733.1"
FT                   /db_xref="GOA:B1ASL3"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR011641"
FT                   /db_xref="InterPro:IPR020445"
FT                   /db_xref="InterPro:IPR034022"
FT                   /db_xref="MGI:MGI:104512"
FT                   /db_xref="UniProtKB/TrEMBL:B1ASL3"
FT                   /protein_id="EDL15067.1"
FT   gene            complement(8264170..8265986)
FT                   /locus_tag="mCG_142754"
FT                   /note="gene_id=mCG142754.0"
FT   mRNA            complement(join(8264170..8264473,8265553..8265602,
FT                   8265862..8265986))
FT                   /locus_tag="mCG_142754"
FT                   /product="mCG142754"
FT                   /note="gene_id=mCG142754.0 transcript_id=mCT182077.0
FT                   created on 25-APR-2003"
FT   CDS             complement(8264326..8264424)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142754"
FT                   /product="mCG142754"
FT                   /note="gene_id=mCG142754.0 transcript_id=mCT182077.0
FT                   protein_id=mCP104999.0"
FT                   /protein_id="EDL15068.1"
FT                   /translation="MVGREIFICSPLSPRFDEQLPVFPRGLFHRIQ"
FT   gene            8268136..8270814
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /note="gene_id=mCG23344.2"
FT   mRNA            join(8268136..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270814)
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, transcript variant mCT176821"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT176821.0 created
FT                   on 06-DEC-2002"
FT   mRNA            join(8268136..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270352,8270420..8270814)
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, transcript variant mCT23178"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT23178.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(8268136..8268466,8269245..8269367,8269891..8269978,
FT                   8270420..8270814)
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, transcript variant mCT133522"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT133522.1 created
FT                   on 06-DEC-2002"
FT   gene            complement(8268226..8273535)
FT                   /locus_tag="mCG_1027457"
FT                   /note="gene_id=mCG1027457.2"
FT   mRNA            complement(join(8268226..8268815,8270400..8270479,
FT                   8272335..8272429,8273491..8273535))
FT                   /locus_tag="mCG_1027457"
FT                   /product="mCG1027457"
FT                   /note="gene_id=mCG1027457.2 transcript_id=mCT181159.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(<8268271..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270352,8270409..8270814)
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, transcript variant mCT190875"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT190875.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8268271..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270352,8270409..8270728)
FT                   /codon_start=1
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, isoform CRA_c"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT190875.0
FT                   protein_id=mCP111843.0 isoform=CRA_c"
FT                   /protein_id="EDL15071.1"
FT   CDS             join(8268316..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270352,8270420..8270541)
FT                   /codon_start=1
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, isoform CRA_d"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT23178.2
FT                   protein_id=mCP21723.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q540M6"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR022318"
FT                   /db_xref="InterPro:IPR034018"
FT                   /db_xref="MGI:MGI:894675"
FT                   /db_xref="UniProtKB/TrEMBL:Q540M6"
FT                   /protein_id="EDL15072.1"
FT                   LGGRWP"
FT   CDS             join(8268316..8268466,8269245..8269367,8269891..8269978,
FT                   8270150..8270456)
FT                   /codon_start=1
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, isoform CRA_b"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT176821.0
FT                   protein_id=mCP99743.0 isoform=CRA_b"
FT                   /protein_id="EDL15070.1"
FT                   "
FT   CDS             join(8268316..8268466,8269245..8269367,8269891..8269978,
FT                   8270420..8270456)
FT                   /codon_start=1
FT                   /gene="Tnfrsf18"
FT                   /locus_tag="mCG_23344"
FT                   /product="tumor necrosis factor receptor superfamily,
FT                   member 18, isoform CRA_a"
FT                   /note="gene_id=mCG23344.2 transcript_id=mCT133522.1
FT                   protein_id=mCP76909.1 isoform=CRA_a"
FT                   /protein_id="EDL15069.1"
FT   CDS             complement(join(8270414..8270479,8272335..8272429,
FT                   8273491..8273497))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027457"
FT                   /product="mCG1027457"
FT                   /note="gene_id=mCG1027457.2 transcript_id=mCT181159.0
FT                   protein_id=mCP104081.0"
FT                   /protein_id="EDL15073.1"
FT                   TAPPRMAGSL"
FT   gene            complement(8276761..8285559)
FT                   /locus_tag="mCG_141922"
FT                   /note="gene_id=mCG141922.0"
FT   mRNA            complement(join(8276761..8277378,8277673..8277766,
FT                   8278064..8278180,8284854..8284994,8285431..8285559))
FT                   /locus_tag="mCG_141922"
FT                   /product="mCG141922"
FT                   /note="gene_id=mCG141922.0 transcript_id=mCT177679.0
FT                   created on 20-DEC-2002"
FT   CDS             complement(join(8276840..8277378,8277673..8277766,
FT                   8278064..8278180,8284854..8284994,8285431..8285547))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141922"
FT                   /product="mCG141922"
FT                   /note="gene_id=mCG141922.0 transcript_id=mCT177679.0
FT                   protein_id=mCP100601.0"
FT                   /protein_id="EDL15074.1"
FT   assembly_gap    8282363..8283409
FT                   /estimated_length=1047
FT                   /gap_type="unknown"
FT   gene            complement(8285567..8301160)
FT                   /locus_tag="mCG_23345"
FT                   /note="gene_id=mCG23345.2"
FT   mRNA            complement(join(8285567..8285602,8287116..8287201,
FT                   8288665..8288791,8288868..8288986,8289131..8289263,
FT                   8289344..8289424,8289683..8289758,8290073..8290485,
FT                   8291982..8292047,8300810..8301160))
FT                   /locus_tag="mCG_23345"
FT                   /product="mCG23345"
FT                   /note="gene_id=mCG23345.2 transcript_id=mCT23179.2 created
FT                   on 20-DEC-2002"
FT   CDS             complement(join(8285577..8285602,8287116..8287201,
FT                   8288665..8288791,8288868..8288986,8289131..8289263,
FT                   8289344..8289404))
FT                   /codon_start=1
FT                   /locus_tag="mCG_23345"
FT                   /product="mCG23345"
FT                   /note="gene_id=mCG23345.2 transcript_id=mCT23179.2
FT                   protein_id=mCP21722.2"
FT                   /protein_id="EDL15075.1"
FT   gene            complement(8294499..8301616)
FT                   /locus_tag="mCG_147507"
FT                   /note="gene_id=mCG147507.0"
FT   mRNA            complement(join(8294499..8295810,8301396..8301616))
FT                   /locus_tag="mCG_147507"
FT                   /product="mCG147507"
FT                   /note="gene_id=mCG147507.0 transcript_id=mCT187770.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8295518..8295703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147507"
FT                   /product="mCG147507"
FT                   /note="gene_id=mCG147507.0 transcript_id=mCT187770.0
FT                   protein_id=mCP109466.0"
FT                   /protein_id="EDL15076.1"
FT                   DHSLNIQAPLSLTAFL"
FT   assembly_gap    8318852..8318952
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    8336803..8336822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8343271..8343290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8351559..8368880
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /note="gene_id=mCG22598.3"
FT   mRNA            join(8351559..8351600,8355466..8355578,8358605..8358698,
FT                   8360766..8360841,8363548..8363643,8363966..8364031,
FT                   8365156..8365290,8365597..8365622,8365713..8365743,
FT                   8367038..8368879)
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, transcript variant
FT                   mCT23091"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT23091.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(<8351560..8351600,8355466..8355578,8358605..8358698,
FT                   8360766..8360841,8363548..8364031,8365156..8365290,
FT                   8365597..8365743,8367038..8368880)
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, transcript variant
FT                   mCT190853"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190853.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8351573..8351600,8355466..8355578,8358605..8358698,
FT                   8360766..8360841,8363548..8363643,8363966..8364031,
FT                   8365156..8365290,8365597..8365622,8365713..8365830)
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, transcript variant
FT                   mCT190851"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190851.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8351574..8351600,8355506..8355578,8358605..8358698,
FT                   8360766..8360841,8363966..8364031,8365156..8365290,
FT                   8365597..8365622,8365713..8365743,8367038..8367842)
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, transcript variant
FT                   mCT190852"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190852.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<8355577..8355578,8358605..8358698,8360766..8360841,
FT                   8363966..8364031,8365156..8365290,8365597..8365622,
FT                   8365713..8365743,8367038..8367135)
FT                   /codon_start=1
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, isoform CRA_b"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190852.0
FT                   protein_id=mCP111831.0 isoform=CRA_b"
FT                   /protein_id="EDL15078.1"
FT                   AFSTVEAHISNV"
FT   CDS             join(<8355577..8355578,8358605..8358698,8360766..8360841,
FT                   8363548..8363643,8363966..8364031,8365156..8365290,
FT                   8365597..8365622,8365713..8365805)
FT                   /codon_start=1
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, isoform CRA_a"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190851.0
FT                   protein_id=mCP111830.0 isoform=CRA_a"
FT                   /protein_id="EDL15077.1"
FT   CDS             join(<8355577..8355578,8358605..8358698,8360766..8360841,
FT                   8363548..8363798)
FT                   /codon_start=1
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, isoform CRA_c"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT190853.0
FT                   protein_id=mCP111832.0 isoform=CRA_c"
FT                   /protein_id="EDL15079.1"
FT   CDS             join(8358627..8358698,8360766..8360841,8363548..8363643,
FT                   8363966..8364031,8365156..8365290,8365597..8365622,
FT                   8365713..8365743,8367038..8367135)
FT                   /codon_start=1
FT                   /gene="9430015G10Rik"
FT                   /locus_tag="mCG_22598"
FT                   /product="RIKEN cDNA 9430015G10, isoform CRA_d"
FT                   /note="gene_id=mCG22598.3 transcript_id=mCT23091.2
FT                   protein_id=mCP21721.2 isoform=CRA_d"
FT                   /protein_id="EDL15080.1"
FT   gene            complement(8399378..>8433188)
FT                   /gene="Agrin"
FT                   /locus_tag="mCG_146388"
FT                   /note="gene_id=mCG146388.0"
FT   mRNA            complement(join(8399378..8400737,8400995..8401098,
FT                   8401366..8401590,8404598..8404685,8404768..8404960,
FT                   8405085..8405201,8405635..8405746,8405931..8406095,
FT                   8406180..8406276,8406444..8406578,8406666..8406895,
FT                   8407263..8407478,8407649..8407841,8407936..8408283,
FT                   8408423..8408542,8408629..8408743,8408864..8408991,
FT                   8409404..8409541,8409646..8409951,8410038..8410143,
FT                   8410217..8410341,8410432..8410575,8410717..8410881,
FT                   8410961..8411077,8412080..8412185,8412265..8412413,
FT                   8412495..8412695,8412817..8413011,8413084..8413302,
FT                   8414290..8414496,8414644..8414868,8414959..8415183,
FT                   8415254..8415469,8420952..8420999,8431093..8431354,
FT                   8433063..>8433188))
FT                   /gene="Agrin"
FT                   /locus_tag="mCG_146388"
FT                   /product="agrin"
FT                   /note="gene_id=mCG146388.0 transcript_id=mCT186596.0
FT                   created on 15-JUL-2003"
FT   CDS             complement(join(8400580..8400737,8400995..8401098,
FT                   8401366..8401590,8404598..8404685,8404768..8404960,
FT                   8405085..8405201,8405635..8405746,8405931..8406095,
FT                   8406180..8406276,8406444..8406578,8406666..8406895,
FT                   8407263..8407478,8407649..8407841,8407936..8408283,
FT                   8408423..8408542,8408629..8408743,8408864..8408991,
FT                   8409404..8409541,8409646..8409951,8410038..8410143,
FT                   8410217..8410341,8410432..8410575,8410717..8410881,
FT                   8410961..8411077,8412080..8412185,8412265..8412413,
FT                   8412495..8412695,8412817..8413011,8413084..8413302,
FT                   8414290..8414496,8414644..8414868,8414959..8415183,
FT                   8415254..8415469,8420952..8420999,8431093..8431354,
FT                   8433063..>8433188))
FT                   /codon_start=1
FT                   /gene="Agrin"
FT                   /locus_tag="mCG_146388"
FT                   /product="agrin"
FT                   /note="gene_id=mCG146388.0 transcript_id=mCT186596.0
FT                   protein_id=mCP107831.0"
FT                   /protein_id="EDL15081.1"
FT                   EDAVTKPELRPCPTL"
FT   assembly_gap    8403143..8403162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8420068..8420087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8433189..8433946
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   gene            complement(8435316..8436632)
FT                   /gene="Isg15"
FT                   /locus_tag="mCG_22597"
FT                   /note="gene_id=mCG22597.1"
FT   mRNA            complement(join(8435316..8435902,8436542..8436632))
FT                   /gene="Isg15"
FT                   /locus_tag="mCG_22597"
FT                   /product="ISG15 ubiquitin-like modifier"
FT                   /note="gene_id=mCG22597.1 transcript_id=mCT23090.1 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(8435420..8435902,8436542..8436544))
FT                   /codon_start=1
FT                   /gene="Isg15"
FT                   /locus_tag="mCG_22597"
FT                   /product="ISG15 ubiquitin-like modifier"
FT                   /note="gene_id=mCG22597.1 transcript_id=mCT23090.1
FT                   protein_id=mCP21769.1"
FT                   /db_xref="GOA:Q4FJR9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1855694"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJR9"
FT                   /protein_id="EDL15082.1"
FT   gene            8439105..8446440
FT                   /locus_tag="mCG_1027459"
FT                   /note="gene_id=mCG1027459.2"
FT   mRNA            join(8439105..8439645,8444067..8445424,8445472..8445886)
FT                   /locus_tag="mCG_1027459"
FT                   /product="mCG1027459, transcript variant mCT145163"
FT                   /note="gene_id=mCG1027459.2 transcript_id=mCT145163.1
FT                   created on 13-MAR-2003"
FT   mRNA            join(<8439138..8439645,8444100..8446440)
FT                   /locus_tag="mCG_1027459"
FT                   /product="mCG1027459, transcript variant mCT190881"
FT                   /note="gene_id=mCG1027459.2 transcript_id=mCT190881.0
FT                   created on 08-MAR-2004"
FT   CDS             <8439138..8439623
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027459"
FT                   /product="mCG1027459, isoform CRA_a"
FT                   /note="gene_id=mCG1027459.2 transcript_id=mCT190881.0
FT                   protein_id=mCP111806.0 isoform=CRA_a"
FT                   /protein_id="EDL15083.1"
FT   CDS             8444670..8444870
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027459"
FT                   /product="mCG1027459, isoform CRA_b"
FT                   /note="gene_id=mCG1027459.2 transcript_id=mCT145163.1
FT                   protein_id=mCP76802.1 isoform=CRA_b"
FT                   /protein_id="EDL15084.1"
FT   gene            complement(8449173..8450898)
FT                   /locus_tag="mCG_141941"
FT                   /note="gene_id=mCG141941.0"
FT   mRNA            complement(join(8449173..8449499,8449673..8450148,
FT                   8450204..8450898))
FT                   /locus_tag="mCG_141941"
FT                   /product="mCG141941"
FT                   /note="gene_id=mCG141941.0 transcript_id=mCT177835.0
FT                   created on 30-DEC-2002"
FT   CDS             complement(join(8449871..8450148,8450204..8450276))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141941"
FT                   /product="mCG141941"
FT                   /note="gene_id=mCG141941.0 transcript_id=mCT177835.0
FT                   protein_id=mCP100757.0"
FT                   /protein_id="EDL15085.1"
FT                   WCMGWAGSSQLG"
FT   gene            8451812..8457178
FT                   /gene="2310042D19Rik"
FT                   /locus_tag="mCG_22603"
FT                   /note="gene_id=mCG22603.1"
FT   mRNA            join(8451812..8451832,8452576..8455044,8455602..8455727,
FT                   8455980..8457178)
FT                   /gene="2310042D19Rik"
FT                   /locus_tag="mCG_22603"
FT                   /product="RIKEN cDNA 2310042D19"
FT                   /note="gene_id=mCG22603.1 transcript_id=mCT23168.1 created
FT                   on 20-DEC-2002"
FT   CDS             join(8452860..8455044,8455602..8455727,8455980..8456092)
FT                   /codon_start=1
FT                   /gene="2310042D19Rik"
FT                   /locus_tag="mCG_22603"
FT                   /product="RIKEN cDNA 2310042D19"
FT                   /note="gene_id=mCG22603.1 transcript_id=mCT23168.1
FT                   protein_id=mCP21671.2"
FT                   /protein_id="EDL15086.1"
FT   gene            complement(8457300..8464917)
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /note="gene_id=mCG145703.0"
FT   mRNA            complement(join(8457300..8457811,8458121..8458348,
FT                   8458510..8458650,8458811..8458951,8459168..8459308,
FT                   8459436..8459584,8459727..8459802,8460408..8460488,
FT                   8460595..8460708,8460787..8460911,8461065..8461137,
FT                   8461218..8461298,8461396..8461542,8464081..8464180,
FT                   8464273..8464917))
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, transcript variant mCT185257"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT185257.0
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(8457325..8457752,8457838..8457886,
FT                   8458121..8458348,8458510..8458650,8458811..8458951,
FT                   8459168..8459308,8459436..8459584,8459727..8459802,
FT                   8460408..8460488,8460595..8460708,8460787..8460911,
FT                   8461065..8461137,8461218..8461298,8461396..8461542,
FT                   8464081..8464180,8464273..8464852))
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, transcript variant mCT185256"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT185256.0
FT                   created on 12-JUN-2003"
FT   mRNA            complement(join(8457326..8457752,8457838..8457886,
FT                   8458121..8458259,8458510..8458650,8458811..8458951,
FT                   8459168..8459308,8459436..8459584,8459727..8459802,
FT                   8460408..8460488,8460595..8460708,8460787..8460911,
FT                   8461065..8461137,8461218..8461298,8461396..>8463729))
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, transcript variant mCT190858"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT190858.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(8457649..8457752,8457838..8457886,
FT                   8458121..8458348,8458510..8458650,8458811..8458951,
FT                   8459168..8459308,8459436..8459584,8459727..8459802,
FT                   8460408..8460488,8460595..8460708,8460787..8460911,
FT                   8461065..8461137,8461218..8461298,8461396..8461542,
FT                   8464081..8464180,8464273..8464355))
FT                   /codon_start=1
FT                   /gene="Plekhn1"
FT                   /locus_tag="mCG_145703"
FT                   /product="pleckstrin homology domain containing, family N
FT                   member 1, isoform CRA_a"
FT                   /note="gene_id=mCG145703.0 transcript_id=mCT185256.0
FT                   protein_id=mCP106515.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:2387630"
FT                   /db_xref="