Dbfetch

ID   CH466593; SV 2; linear; genomic DNA; CON; MUS; 8571122 BP.
XX
AC   CH466593;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009793835 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8571122
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-8571122
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-8571122
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 93725497dab3ad17ffed9cdd0b4daee1.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000215.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001249; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001794; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002602; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002603; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003123; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003378; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004056; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005447; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006313; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006315; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009687; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000011632; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000011752; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013083; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013921; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019429; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020420; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030483; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030579; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030584; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030587; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030595; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030598; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000030603; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035523; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036521; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036957; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037337; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037563; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040390; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040466; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040907; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042831; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044786; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045587; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046223; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046924; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049761; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050605; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052212; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053522; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053964; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054342; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054808; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055200; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055826; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057092; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057093; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058402; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058709; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060376; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060407; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060791; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061099; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061286; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061702; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062028; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062483; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062556; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063160; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066721; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070699; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074199; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074218; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074261; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074272; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074282; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074283; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078762; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000087598; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089661; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091867; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094187; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095632; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096859; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096916; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109336; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025130; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031809; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031813; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031818; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031820; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031822; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031823; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031824; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031826; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031828; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031829; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031833; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031835; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031840; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031851; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031852; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031860; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031864; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031865; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031867; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031869; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031870; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031872; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031873; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031874; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031876; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031879; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031881; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031886; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031897; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031900; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031911; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031912; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031917; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031918; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031920; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031921; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031922; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031924; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031928; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031937; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031940; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031941; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031942; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031946; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031953; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031955; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031957; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031959; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031965; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031967; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031969; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031974; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031977; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031979; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031982; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031990; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032001; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032004; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032005; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032011; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032012; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032016; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032017; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032020; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032033; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032037; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032038; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032039; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032041; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032042; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032047; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032056; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032060; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032061; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032064; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025107; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031785; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031789; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031799; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031801; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031802; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031803; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031805; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031807; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031808; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031812; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031814; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031819; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031821; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031830; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031831; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031839; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031843; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031844; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031847; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031848; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031849; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031851; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031852; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031853; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031855; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031858; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031860; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031866; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031876; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031879; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031890; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031891; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031896; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031897; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031899; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031900; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031902; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031907; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031916; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031919; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031920; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031921; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031925; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031931; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031933; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031935; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031937; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031942; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031943; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031945; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031947; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031952; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031955; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031957; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031960; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031961; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031967; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031978; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031981; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031982; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031988; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031989; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031993; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031994; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0031997; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032010; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032014; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032015; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032016; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032018; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032019; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032024; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032033; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032037; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032038; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032041; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0032042; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025075; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031715; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031717; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031726; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031727; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031728; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031730; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031731; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031732; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031734; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031736; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031737; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031741; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031743; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031748; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031750; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031759; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031760; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031768; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031772; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031773; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031777; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031778; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031780; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031781; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031782; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031784; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031787; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031789; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031796; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031806; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031809; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031820; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031821; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031826; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031827; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031829; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031830; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031831; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031834; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031838; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031847; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031851; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031852; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031856; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031863; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031865; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031867; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031869; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031874; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031875; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031877; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031879; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031888; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031890; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031893; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031894; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031900; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031911; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031914; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031915; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031921; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031922; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031926; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031927; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031930; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031943; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031947; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031948; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031949; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031951; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031952; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031957; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031966; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031970; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031971; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031974; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0031975; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025101; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031790; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031795; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031805; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031807; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031808; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031809; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031811; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031813; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031814; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031818; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031820; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031825; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031827; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031837; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031838; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031846; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031850; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031851; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031853; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031854; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031856; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031857; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031858; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031860; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031863; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031865; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031871; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031881; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031884; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031895; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031896; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031901; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031902; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031904; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031905; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031906; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031909; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031913; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031922; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031925; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031926; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031927; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031931; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031938; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031940; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031942; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031944; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031949; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031950; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031952; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031954; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031959; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031962; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031964; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031967; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031968; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031974; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031985; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031988; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031989; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031995; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031996; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032000; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032001; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032004; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032017; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032021; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032022; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032023; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032025; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032026; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032031; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032040; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032044; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032045; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032048; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032049; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024861; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031515; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031525; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031526; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031527; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031528; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031529; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031531; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031533; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031534; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031538; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031545; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031547; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031556; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031557; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031565; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031569; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031570; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031572; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031574; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031575; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031577; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031578; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031579; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031581; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031584; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031586; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031593; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031603; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031606; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031617; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031618; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031623; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031624; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031626; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031627; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031628; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031631; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031635; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031644; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031647; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031648; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031649; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031653; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031657; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031659; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031661; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031663; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031669; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031671; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031673; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031678; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031681; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031683; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031686; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031687; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031693; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031704; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031707; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031708; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031714; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031715; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031719; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031720; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031723; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031736; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031740; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031741; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031742; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031744; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031745; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031750; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031757; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031761; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031762; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031765; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031766; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032257; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032259; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032267; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032268; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032269; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032270; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032271; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032272; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032274; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032276; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032277; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032281; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032283; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032290; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032299; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032300; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032308; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032312; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032313; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032317; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032318; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032320; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032321; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032322; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032324; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032327; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032329; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032333; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032346; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032349; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032360; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032361; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032366; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032367; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032369; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032370; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032371; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032374; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032377; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032378; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032387; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032390; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032391; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032392; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032396; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032402; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032404; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032406; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032408; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032413; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032414; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032416; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032418; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032423; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032427; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032429; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032432; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032433; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032439; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032450; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032453; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032454; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032460; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032462; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032466; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032467; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032470; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032483; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032487; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032488; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032489; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032491; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032492; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032497; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032506; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032510; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032511; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032514; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032515; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024326; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030859; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030864; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030865; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030866; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030869; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030870; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030872; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030874; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030875; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030879; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030881; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030887; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030896; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030897; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030905; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030909; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030910; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030914; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030915; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030917; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030918; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030919; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030921; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030924; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030926; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030929; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030935; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030938; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030941; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030952; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030953; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030958; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030961; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030962; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030963; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030970; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030979; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030982; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030983; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030984; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030988; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030994; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030996; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030998; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031004; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031006; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031008; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031013; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031015; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031017; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031020; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031021; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031027; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031038; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031041; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031042; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031048; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031049; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031053; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031054; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031057; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031070; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031074; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031075; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031076; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031078; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031079; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031084; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031093; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031097; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031098; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031102; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024841; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031475; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031479; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031488; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031489; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031490; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031492; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031493; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031494; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031496; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031498; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031499; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031503; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031505; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031510; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031512; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031521; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031522; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031530; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031534; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031535; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031537; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031539; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031540; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031542; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031543; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031544; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031546; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031549; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031551; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031558; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031568; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031571; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031582; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031583; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031588; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031589; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031591; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031593; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031595; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031598; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031607; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031611; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031612; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031616; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031623; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031625; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031627; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031629; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031635; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031637; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031639; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031644; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031647; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031649; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031652; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031653; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031659; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031670; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031673; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031674; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031680; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031681; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031685; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031686; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031689; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031702; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031706; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031707; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031708; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031710; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031711; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031716; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031725; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031730; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031733; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0031734; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031628; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031633; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031642; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031643; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031644; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031646; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031647; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031648; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031650; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031652; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031653; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031657; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031659; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031664; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031666; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031675; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031676; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031684; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031688; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031689; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031693; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031694; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031696; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031697; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031698; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031700; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031703; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031705; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031709; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031720; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031723; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031734; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031735; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031740; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031741; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031743; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031744; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031745; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031747; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031751; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031760; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031763; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031764; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031765; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031769; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031775; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031777; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031779; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031781; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031786; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031787; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031789; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031791; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031796; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031799; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031801; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031804; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031805; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031811; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031822; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031825; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031826; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031832; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031833; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031837; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031838; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031841; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031854; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031858; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031859; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031860; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031862; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031868; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031877; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031881; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031882; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031885; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0031886; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024934; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031580; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031581; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031586; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031595; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031596; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031597; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031599; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031600; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031601; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031603; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031606; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031610; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031612; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031617; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031619; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031628; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031629; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031637; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031641; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031642; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031646; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031647; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031649; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031650; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031651; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031653; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031656; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031658; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031676; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031679; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031690; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031691; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031696; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031697; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031699; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031700; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031704; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031708; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031717; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031721; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031722; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031726; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031732; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031734; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031736; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031738; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031743; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031744; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031746; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031748; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031753; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031756; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031758; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031761; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031768; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031779; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031782; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031783; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031789; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031790; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031794; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031795; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031798; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031811; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031815; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031816; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031817; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031819; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031820; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031825; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031833; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031837; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031838; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0031841; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031711; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031714; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031717; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031722; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031723; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031724; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031725; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031726; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031727; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031729; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031731; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031732; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031736; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031738; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031743; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031745; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031754; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031755; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031763; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031767; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031768; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031771; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031772; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031773; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031775; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031776; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031777; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031779; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031782; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031784; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031790; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031800; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031803; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031814; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031815; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031820; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031821; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031823; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031825; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031828; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031832; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031841; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031844; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031845; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031846; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031850; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031855; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031857; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031859; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031861; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031867; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031869; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031871; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031876; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031879; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031881; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031884; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031885; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031892; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031903; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031906; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031907; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031913; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031914; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031918; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031919; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031922; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031935; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031939; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031940; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031941; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031943; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031944; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031949; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031958; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031962; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031963; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0031966; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024965; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031619; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031623; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031632; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031633; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031634; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031636; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031637; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031638; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031640; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031642; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031643; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031647; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031649; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031654; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031656; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031665; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031666; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031674; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031678; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031679; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031683; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031684; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031686; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031687; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031688; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031690; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031693; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031695; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031711; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031714; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031725; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031726; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031731; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031732; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031734; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031735; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031736; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031737; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031743; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031752; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031755; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031756; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031757; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031761; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031768; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031770; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031772; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031774; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031779; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031780; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031782; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031784; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031789; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031791; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031793; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031796; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031797; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031804; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031815; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031818; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031819; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031825; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031826; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031830; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031831; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031834; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031847; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031851; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031853; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031855; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031861; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031870; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031874; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031875; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031878; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031879; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025602; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032284; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032286; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032290; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032299; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032300; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032301; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032302; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032303; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032304; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032306; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032308; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032309; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032313; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032315; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032320; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032322; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032331; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032340; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032344; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032345; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032347; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032349; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032350; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032352; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032353; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032354; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032356; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032361; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032366; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032377; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032380; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032391; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032392; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032397; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032398; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032400; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032401; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032402; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032408; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032417; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032420; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032421; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032422; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032426; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032432; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032436; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032438; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032443; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032444; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032446; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032448; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032453; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032456; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032458; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032461; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032462; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032468; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032479; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032482; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032483; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032489; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032490; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032494; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032495; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032498; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032511; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032515; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032517; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032519; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032520; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032525; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032532; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032536; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032537; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032540; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032541; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030583; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030588; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030589; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030590; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030592; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030593; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030594; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030596; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030598; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030599; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030603; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030605; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030611; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030620; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030621; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030629; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030633; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030634; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030638; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030639; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030641; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030642; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030643; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030645; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030648; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030650; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030654; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030659; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030662; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030665; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030676; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030677; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030682; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030683; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030685; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030686; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030688; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030693; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030702; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030705; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030706; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030707; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030711; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030719; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030721; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030723; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030728; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030729; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030731; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030733; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030738; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030741; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030743; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030746; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030747; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030753; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030764; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030767; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030768; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030774; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030775; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030779; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030780; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030783; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030794; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030798; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030799; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030800; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030802; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030803; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030808; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030815; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030819; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030820; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030823; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024396; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030956; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030960; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030962; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030968; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030969; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030971; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030972; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030973; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030975; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030977; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030978; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030982; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030984; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030989; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030991; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030999; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031000; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031008; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031012; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031013; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031017; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031018; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031020; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031021; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031022; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031024; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031027; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031029; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031033; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031046; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031049; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031060; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031061; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031066; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031067; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031069; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031070; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031077; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031086; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031089; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031090; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031091; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031095; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031101; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031103; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031105; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031107; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031112; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031113; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031115; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031117; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031122; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031125; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031127; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031130; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031131; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031137; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031148; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031151; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031152; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031158; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031159; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031163; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031164; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031167; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031180; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031184; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031185; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031186; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031188; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031194; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031203; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031207; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031208; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031211; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031212; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003468; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006478; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006828; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000011776; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000011896; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014065; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019697; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032673; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032815; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037399; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037448; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038694; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046351; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049977; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051356; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051714; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056683; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057652; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060834; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067386; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068045; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069562; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071329; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072438; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074758; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075552; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076421; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077780; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085809; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085851; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094583; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098596; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098663; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098669; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108292; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108315; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108336; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108405; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119386; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119990; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120004; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121848; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132862; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138243; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164527; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167435; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167591; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170166; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173101; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187493; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205776; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205966; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205982; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206362; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206514; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000206777; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207185; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000208199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000208441; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051767; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082099; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082103; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082122; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082129; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082133; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082143; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082149; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082151; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082163; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082168; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082181; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082195; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082205; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082208; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082254; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082259; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082303; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082316; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082318; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082326; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082336; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082337; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082347; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082350; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082356; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082366; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082384; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082396; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082407; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082433; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082446; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082506; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082511; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082528; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082536; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082551; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082556; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082557; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082562; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082567; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082594; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082605; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082608; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082618; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082630; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082648; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082657; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082666; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082668; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082704; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082708; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082717; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082749; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082755; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082761; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082766; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082810; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082850; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082856; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082857; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082883; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082890; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082920; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082921; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082927; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083012; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083018; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083024; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083026; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083032; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083033; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083062; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083109; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083146; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083157; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0083182; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0051776; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082177; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082181; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082203; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082205; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082214; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082220; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082222; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082234; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082239; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082252; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082266; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082273; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082278; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082324; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082329; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082373; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082386; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082388; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082399; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082409; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082410; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082420; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082422; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082428; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082438; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082456; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082468; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082480; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082504; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082517; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082575; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082579; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082595; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082603; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082618; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082623; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082626; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082639; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082664; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082675; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082678; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082688; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082700; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082717; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082726; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082735; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082737; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082770; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082776; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082780; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082820; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082826; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082832; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082837; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082847; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082878; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082918; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082924; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082925; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082951; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082958; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082988; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082989; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0082995; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083080; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083086; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083093; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083095; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083101; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083102; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083132; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083171; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083208; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083219; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083244; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0083245; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0051725; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082113; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082115; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082135; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082141; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082142; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082146; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082155; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082161; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082163; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082175; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082180; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082193; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082207; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082215; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082220; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082266; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082271; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082314; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082327; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082329; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082340; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082341; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082352; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082354; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082360; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082370; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082389; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082401; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082414; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082436; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082449; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082509; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082513; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082529; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082537; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082549; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082554; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082555; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082562; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082567; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082593; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082607; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082617; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082629; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082648; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082657; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082666; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082668; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082701; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082707; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082711; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082752; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082765; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082771; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082776; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082786; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082816; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082856; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082862; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082863; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082889; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082896; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082926; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082927; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0082933; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083018; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083024; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083030; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083032; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083038; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083039; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083069; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083108; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083145; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083156; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083181; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0083182; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051721; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082122; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082127; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082155; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082159; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082168; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082174; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082176; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082188; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082193; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082206; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082220; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082228; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082232; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082282; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082287; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082330; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082343; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082345; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082363; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082364; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082374; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082376; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082382; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082392; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082410; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082422; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082434; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082461; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082474; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082532; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082536; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082552; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082560; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082576; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082581; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082582; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082591; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082596; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082620; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082631; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082634; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082644; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082656; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082675; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082684; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082693; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082696; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082729; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082735; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082739; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082749; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082780; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082790; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082796; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082801; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082811; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082841; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082881; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082887; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082888; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082912; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082919; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082949; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082950; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082956; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083039; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083045; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083051; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083053; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083059; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083060; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083088; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083135; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083172; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083183; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083208; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0083209; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051452; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081736; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081758; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081759; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081762; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081771; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081777; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081779; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081792; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081797; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081810; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081824; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081832; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081836; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081882; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081887; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081931; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081944; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081946; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081954; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081960; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081971; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081973; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081979; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081989; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082007; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082019; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082035; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082058; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082071; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082130; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082135; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082152; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082160; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082175; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082180; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082181; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082190; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082195; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082218; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082229; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082233; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082243; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082255; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082271; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082280; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082289; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082292; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082326; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082330; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082340; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082372; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082378; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082384; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082389; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082399; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082430; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082469; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082475; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082476; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082501; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082508; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082539; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082540; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082544; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082629; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082635; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082641; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082643; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082649; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082650; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082677; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082717; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082754; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082765; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082790; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082791; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082604; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082607; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082624; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082630; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082633; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082636; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082645; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082651; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082653; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082665; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082670; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082683; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082697; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082710; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082754; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082759; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082803; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082816; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082818; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082829; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082830; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082840; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082842; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082848; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082858; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082876; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082888; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082898; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082928; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082941; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082999; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083003; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083019; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083027; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083042; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083047; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083049; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083060; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083063; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083089; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083100; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083101; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083111; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083124; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083141; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083150; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083159; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083161; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083194; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083200; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083204; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083215; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083244; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083269; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083274; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083284; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083314; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083353; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083359; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083360; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083386; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083395; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083425; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083426; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083430; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083515; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083521; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083527; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083529; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083535; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083536; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083565; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083604; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083641; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083652; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083677; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0083678; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051588; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082257; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082275; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082281; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082282; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082286; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082295; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082301; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082303; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082315; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082320; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082333; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082347; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082360; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082407; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082412; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082457; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082471; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082473; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082488; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082489; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082499; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082501; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082507; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082517; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082535; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082547; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082555; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082571; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082577; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082589; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082649; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082654; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082671; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082689; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082695; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082696; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082707; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082732; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082743; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082747; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082757; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082771; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082796; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082805; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082807; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082842; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082846; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082858; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082889; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082894; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082901; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082906; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082916; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082947; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082986; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082992; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082993; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083018; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083025; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083055; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083056; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083062; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083145; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083151; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083157; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083159; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083165; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083166; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083194; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083237; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083274; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083285; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0083311; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051399; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081675; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081679; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081701; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081707; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081708; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081712; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081721; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081727; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081729; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081741; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081746; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081759; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081773; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081780; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081783; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081826; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081831; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081874; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081887; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081889; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081897; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081908; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081909; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081919; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081921; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081927; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081937; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081955; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081967; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0081981; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082005; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082018; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082078; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082082; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082098; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082106; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082121; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082127; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082134; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082138; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082163; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082177; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082199; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082218; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082227; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082236; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082238; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082274; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082278; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082288; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082320; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082326; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082332; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082337; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082347; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082377; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082422; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082423; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082450; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082457; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082488; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082489; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082493; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082578; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082584; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082590; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082592; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082598; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082599; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082627; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082665; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082702; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082713; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082738; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0082739; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0081831; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081836; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081858; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081864; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081865; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081869; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081878; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081884; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081886; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081898; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081903; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081916; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081930; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081938; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081942; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081988; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0081993; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082038; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082051; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082053; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082072; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082073; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082083; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082085; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082091; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082101; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082119; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082131; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082140; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082176; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082236; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082240; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082255; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082263; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082278; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082283; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082284; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082291; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082296; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082324; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082335; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082338; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082348; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082360; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082375; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082384; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082393; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082395; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082428; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082434; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082438; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082448; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082480; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082490; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082496; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082501; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082511; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082546; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082586; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082592; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082593; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082619; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082626; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082656; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082657; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082663; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082746; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082752; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082759; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082761; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082767; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082796; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082843; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082880; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082891; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082916; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0082917; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051459; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081709; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081710; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081715; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081736; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081742; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081743; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081747; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081756; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081762; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081764; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081777; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081782; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081795; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081809; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081817; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081820; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081864; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081869; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081912; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081925; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081927; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081945; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081946; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081956; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081958; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081964; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081974; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0081992; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082004; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082041; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082054; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082113; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082135; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082143; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082158; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082163; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082175; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082180; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082205; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082219; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082229; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082241; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082259; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082268; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082277; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082279; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082312; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082318; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082322; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082332; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082364; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082373; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082379; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082384; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082423; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082462; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082468; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082469; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082496; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082503; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082533; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082534; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082538; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082623; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082629; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082635; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082637; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082643; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082644; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082674; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082721; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082758; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082769; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0082794; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0051626; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081865; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081868; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081871; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081888; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081893; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081894; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081897; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081906; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081912; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081914; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081926; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081931; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081944; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081958; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081966; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0081969; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082014; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082019; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082062; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082075; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082077; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082086; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082090; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082091; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082101; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082103; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082109; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082119; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082137; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082149; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082162; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082188; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082201; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082260; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082265; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082282; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082290; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082305; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082311; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082319; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082324; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082348; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082359; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082362; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082372; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082384; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082398; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082407; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082416; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082418; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082457; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082461; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082471; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082503; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082509; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082515; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082520; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082530; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082564; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082603; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082609; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082610; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082636; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082643; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082673; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082674; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082680; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082764; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082770; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082776; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082778; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082784; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082785; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082815; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082863; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082900; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082911; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0082936; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051458; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081733; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081737; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081757; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081762; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081763; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081767; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081776; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081782; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081784; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081796; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081801; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081814; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081828; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081838; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081842; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081886; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081891; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081935; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081948; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081950; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081968; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081969; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081979; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081981; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081987; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081997; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082015; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082027; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082073; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082127; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082149; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082157; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082172; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082177; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082179; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082186; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082196; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082224; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082235; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082238; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082248; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082260; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082277; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082286; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082295; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082297; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082330; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082336; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082340; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082351; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082383; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082388; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082394; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082399; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082409; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082442; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082481; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082487; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082488; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082516; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082524; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082554; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082555; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082561; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082646; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082652; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082659; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082661; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082667; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082698; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082745; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082782; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082793; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082818; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082819; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052341; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082871; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082873; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082878; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082901; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082906; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082907; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082910; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082919; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082925; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082927; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082939; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082944; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082957; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082971; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082983; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082987; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083032; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083037; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083080; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083093; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083095; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083103; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083112; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083113; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083123; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083125; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083132; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083142; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083160; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083172; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083183; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083209; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083222; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083281; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083301; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083309; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083324; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083329; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083331; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083347; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083373; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083384; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083387; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083397; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083409; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083424; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083433; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083442; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083444; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083477; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083487; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083496; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083528; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083534; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083540; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083545; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083555; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083586; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083626; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083632; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083633; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083658; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083665; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083695; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083696; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083702; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083787; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083793; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083799; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083801; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083807; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083808; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083837; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083882; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083919; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083930; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083955; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083956; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081686; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081702; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081706; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081707; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081711; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081720; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081726; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081728; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081738; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081747; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081760; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081774; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081786; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081831; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081836; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081880; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081892; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081894; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081917; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081918; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081928; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081930; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081936; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081946; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081965; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081977; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081983; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082000; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082006; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082019; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082078; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082083; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082100; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082108; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082120; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082126; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082129; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082141; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082165; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082176; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082179; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082189; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082203; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082229; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082238; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082240; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082273; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082279; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082283; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082295; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082325; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082332; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082343; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082353; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082382; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082422; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082428; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082429; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082455; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082462; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082493; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082494; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082500; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082580; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082586; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082593; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082601; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082602; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082631; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082675; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082703; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082714; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082739; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050737; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080785; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080789; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080792; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080814; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080815; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080819; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080828; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080834; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080836; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080848; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080853; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080866; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080880; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080888; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080892; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080937; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080942; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080986; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080999; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081001; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081011; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081012; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081023; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081025; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081031; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081041; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081059; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081071; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081081; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081111; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081124; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081184; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081188; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081204; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081212; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081224; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081229; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081240; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081265; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081276; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081279; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081289; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081301; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081316; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081325; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081334; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081336; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081369; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081375; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081379; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081390; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081423; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081434; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081440; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081445; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081485; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081524; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081530; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081531; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081554; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081561; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081592; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081593; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081599; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081684; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081690; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081696; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081698; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081704; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081734; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081776; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081813; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081824; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081849; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081850; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70977365.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8571122
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    2462..2481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3786..3950
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    6837..7506
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   assembly_gap    20035..20399
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   gene            22388..29659
FT                   /locus_tag="mCG_147831"
FT                   /note="gene_id=mCG147831.0"
FT   mRNA            join(22388..22406,22496..22666,29230..29659)
FT                   /locus_tag="mCG_147831"
FT                   /product="mCG147831"
FT                   /note="gene_id=mCG147831.0 transcript_id=mCT188094.0
FT                   created on 13-JAN-2004"
FT   CDS             join(22402..22406,22496..22666,29230..29311)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147831"
FT                   /product="mCG147831"
FT                   /note="gene_id=mCG147831.0 transcript_id=mCT188094.0
FT                   protein_id=mCP108450.0"
FT                   /protein_id="EDL24377.1"
FT                   /translation="MELEACALTGACCEDLASSFTHCKTLLGINLQENALDHSGLVALF
FT                   EAMKQQQCTVNLRGLRITDFDKETQEFLMAEKEKNPYLSI"
FT   gene            24479..26233
FT                   /pseudo
FT                   /locus_tag="mCG_113312"
FT                   /note="gene_id=mCG113312.1"
FT   mRNA            24479..26233
FT                   /pseudo
FT                   /locus_tag="mCG_113312"
FT                   /note="gene_id=mCG113312.1 transcript_id=mCT114393.1
FT                   created on 14-AUG-2002"
FT   gene            <53262..111897
FT                   /locus_tag="mCG_113308"
FT                   /note="gene_id=mCG113308.2"
FT   mRNA            join(<53262..53330,74054..74131,74737..74814,77412..77489,
FT                   78080..78160,79889..79966,87235..88810,91321..91491,
FT                   93873..94040,96517..96687,99927..100097,103501..103671,
FT                   105730..105900,107870..108040,111657..111897)
FT                   /locus_tag="mCG_113308"
FT                   /product="mCG113308, transcript variant mCT191935"
FT                   /note="gene_id=mCG113308.2 transcript_id=mCT191935.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(53262..53330,74054..74131,74737..74814,77412..77489,
FT                   78080..78160,79889..79966,83254..83301,87235..88810,
FT                   91321..91491,93873..94040,96517..96687,99927..100097,
FT                   103501..103671,105730..105900,107870..108040,
FT                   111657..111892)
FT                   /locus_tag="mCG_113308"
FT                   /product="mCG113308, transcript variant mCT114389"
FT                   /note="gene_id=mCG113308.2 transcript_id=mCT114389.1
FT                   created on 08-AUG-2002"
FT   mRNA            join(53262..53330,74054..74131,74737..74814,78080..78153,
FT                   91334..91512,93873..94040,99927..100097,103501..103671,
FT                   105730..105900,107870..108040,111657..111892)
FT                   /locus_tag="mCG_113308"
FT                   /product="mCG113308, transcript variant mCT171716"
FT                   /note="gene_id=mCG113308.2 transcript_id=mCT171716.0
FT                   created on 08-AUG-2002"
FT   CDS             join(<53264..53330,74054..74131,74737..74814,77412..77489,
FT                   78080..78160,79889..79966,87235..88810,91321..91491,
FT                   93873..94040,96517..96687,99927..100097,103501..103671,
FT                   105730..105900,107870..108040,111657..111789)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113308"
FT                   /product="mCG113308, isoform CRA_c"
FT                   /note="gene_id=mCG113308.2 transcript_id=mCT191935.0
FT                   protein_id=mCP112865.0 isoform=CRA_c"
FT                   /protein_id="EDL24376.1"
FT                   /translation="RDRIGFLFAVVTGLQKVGSALRESTMGPPEKESKAILKARGLEEE
FT                   QKSERKMTSPENDSKSIQKDQGPEQEQTSESTMGPPEKDSKAILKARGLEEEQKSESTM
FT                   SPSENVSRAILKDSGSEEVEQASERKMTSPENDSKSIQKDQGPEQEQTSDNGGDLQDYK
FT                   AHVIAKFDTSVDLHYDSPEMKLLSDAFKPYQKTFQPHTIILHGRPGVGKSALARSIVLG
FT                   WAQGKLFQKMSFVIFFSVREIKWTEKSSLAQLIAKECPDSWDLVTKIMSQPERLLFVID
FT                   GLDDMDSVLQHDDMTLSRDWKDEQPIYILMYSLLRKALLPQSFLIITTRNTGLEKLKSM
FT                   VVSPLYILVEGLSASRRSQLVLENISNESDRIQVFHSLIENHQLFDQCQAPSVCSLVCE
FT                   ALQLQKKLGKRCTLPCQTLTGLYATLVFHQLTLKRPSQSALSQEEQITLVGLCMMAAEG
FT                   VWTMRSVFYDDDLKNYSLKESEILALFHMNILLQVGHNSEQCYVFSHLSLQDFFAALYY
FT                   VLEGLEEWNQHFCFIENQRSIMEVKRTDDTRLLGMKRFLFGLMNKDILKTLEVLFEYPV
FT                   IPTVEQKLQHWVSLIAQQVNGTSPMDTLDAFYCLFESQDEEFVGGALKRFQEVWLLINQ
FT                   KMDLKVSSYCLKHCQNLKAIRVDIRDLLSVDNTLELCPVVTVQETQCKPLLMEWWGNFC
FT                   SVLGSLRNLKELDLGDSILSQRAMKILCLELRNQSCRIQKLTFKSAEVVSGLKHLWKLL
FT                   FSNQNLKYLNLGNTPMKDDDMKLACEALKHPKCSVETLRLDSCELTIIGYEMISTLLIS
FT                   TTRLKCLSLAKNRVGVKSMISLGNALSSSMCLLQKLILDNCGLTPASCHLLVSALFSNQ
FT                   NLTHLCLSNNSLGTEGVQQLCQFLRNPECALQRLILNHCNIVDDAYGFLAMRLANNTKL
FT                   THLSLTMNPVGDGAMKLLCEALKEPTCYLQELELVDCQLTQNCCEDLACMITTTKHLKS
FT                   LDLGNNALGDKGVITLCEGLKQSSSSLRRLGLGACKLTSNCCEALSLAISCNPHLNSLN
FT                   LVKNDFSTSGMLKLCSAFQCPVSNLGIIGLWKQEYYARVRRQLEEVEFVKPHVVIDGDW
FT                   YASDEDDRNWWKN"
FT   assembly_gap    55566..56483
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    66664..66683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    67802..67821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(74062..74131,74737..74814,77412..77489,78080..78160,
FT                   79889..79966,83254..83301,87235..88810,91321..91491,
FT                   93873..94040,96517..96687,99927..100097,103501..103671,
FT                   105730..105900,107870..108040,111657..111789)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113308"
FT                   /product="mCG113308, isoform CRA_a"
FT                   /note="gene_id=mCG113308.2 transcript_id=mCT114389.1
FT                   protein_id=mCP57765.1 isoform=CRA_a"
FT                   /protein_id="EDL24374.1"
FT                   /translation="MGPPEKESKAILKARGLEEEQKSERKMTSPENDSKSIQKDQGPEQ
FT                   EQTSESTMGPPEKDSKAILKARGLEEEQKSESTMSPSENVSRAILKDSGSEEVEQASER
FT                   KMTSPENDSKSIQKDQGPEQEQTSETLQSKEEDEVTEADKDNGGDLQDYKAHVIAKFDT
FT                   SVDLHYDSPEMKLLSDAFKPYQKTFQPHTIILHGRPGVGKSALARSIVLGWAQGKLFQK
FT                   MSFVIFFSVREIKWTEKSSLAQLIAKECPDSWDLVTKIMSQPERLLFVIDGLDDMDSVL
FT                   QHDDMTLSRDWKDEQPIYILMYSLLRKALLPQSFLIITTRNTGLEKLKSMVVSPLYILV
FT                   EGLSASRRSQLVLENISNESDRIQVFHSLIENHQLFDQCQAPSVCSLVCEALQLQKKLG
FT                   KRCTLPCQTLTGLYATLVFHQLTLKRPSQSALSQEEQITLVGLCMMAAEGVWTMRSVFY
FT                   DDDLKNYSLKESEILALFHMNILLQVGHNSEQCYVFSHLSLQDFFAALYYVLEGLEEWN
FT                   QHFCFIENQRSIMEVKRTDDTRLLGMKRFLFGLMNKDILKTLEVLFEYPVIPTVEQKLQ
FT                   HWVSLIAQQVNGTSPMDTLDAFYCLFESQDEEFVGGALKRFQEVWLLINQKMDLKVSSY
FT                   CLKHCQNLKAIRVDIRDLLSVDNTLELCPVVTVQETQCKPLLMEWWGNFCSVLGSLRNL
FT                   KELDLGDSILSQRAMKILCLELRNQSCRIQKLTFKSAEVVSGLKHLWKLLFSNQNLKYL
FT                   NLGNTPMKDDDMKLACEALKHPKCSVETLRLDSCELTIIGYEMISTLLISTTRLKCLSL
FT                   AKNRVGVKSMISLGNALSSSMCLLQKLILDNCGLTPASCHLLVSALFSNQNLTHLCLSN
FT                   NSLGTEGVQQLCQFLRNPECALQRLILNHCNIVDDAYGFLAMRLANNTKLTHLSLTMNP
FT                   VGDGAMKLLCEALKEPTCYLQELELVDCQLTQNCCEDLACMITTTKHLKSLDLGNNALG
FT                   DKGVITLCEGLKQSSSSLRRLGLGACKLTSNCCEALSLAISCNPHLNSLNLVKNDFSTS
FT                   GMLKLCSAFQCPVSNLGIIGLWKQEYYARVRRQLEEVEFVKPHVVIDGDWYASDEDDRN
FT                   WWKN"
FT   CDS             join(93970..94040,99927..100097,103501..103671,
FT                   105730..105900,107870..108040,111657..111789)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113308"
FT                   /product="mCG113308, isoform CRA_b"
FT                   /note="gene_id=mCG113308.2 transcript_id=mCT171716.0
FT                   protein_id=mCP94635.0 isoform=CRA_b"
FT                   /protein_id="EDL24375.1"
FT                   /translation="MKDDDMKLACEALKHPKCSVETLRLDNCGLTPASCHLLVSALFSN
FT                   QNLTHLCLSNNSLGTEGVQQLCQFLRNPECALQRLILNHCNIVDDAYGFLAMRLANNTK
FT                   LTHLSLTMNPVGDGAMKLLCEALKEPTCYLQELELVDCQLTQNCCEDLACMITTTKHLK
FT                   SLDLGNNALGDKGVITLCEGLKQSSSSLRRLGLGACKLTSNCCEALSLAISCNPHLNSL
FT                   NLVKNDFSTSGMLKLCSAFQCPVSNLGIIGLWKQEYYARVRRQLEEVEFVKPHVVIDGD
FT                   WYASDEDDRNWWKN"
FT   gene            116245..116755
FT                   /pseudo
FT                   /locus_tag="mCG_1031270"
FT                   /note="gene_id=mCG1031270.1"
FT   mRNA            116245..116755
FT                   /pseudo
FT                   /locus_tag="mCG_1031270"
FT                   /note="gene_id=mCG1031270.1 transcript_id=mCT148974.1
FT                   created on 14-AUG-2002"
FT   assembly_gap    124519..127822
FT                   /estimated_length=3304
FT                   /gap_type="unknown"
FT   assembly_gap    132419..142062
FT                   /estimated_length=9644
FT                   /gap_type="unknown"
FT   assembly_gap    152189..154468
FT                   /estimated_length=2280
FT                   /gap_type="unknown"
FT   assembly_gap    156278..170905
FT                   /estimated_length=14628
FT                   /gap_type="unknown"
FT   gene            complement(171179..>172142)
FT                   /locus_tag="mCG_1031296"
FT                   /note="gene_id=mCG1031296.1"
FT   mRNA            complement(171179..>172142)
FT                   /locus_tag="mCG_1031296"
FT                   /product="mCG1031296"
FT                   /note="gene_id=mCG1031296.1 transcript_id=mCT149000.1
FT                   created on 14-AUG-2002"
FT   CDS             complement(171195..172142)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031296"
FT                   /product="mCG1031296"
FT                   /note="gene_id=mCG1031296.1 transcript_id=mCT149000.1
FT                   protein_id=mCP57724.1"
FT                   /db_xref="GOA:G3UW71"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3644421"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW71"
FT                   /protein_id="EDL24373.1"
FT                   /translation="MIIPLSNEVVSMLSQNKSVKTTEEVALQILLLCQVGVGTAVNIFL
FT                   IVHNLSPILNGSQQRPIKVILANLAVGNTLILLFAFPNNMTIFVPKDPPTDLKCKLGYF
FT                   IWLVARSTNMCSTCSLSTYQLVTLAPGTWGRVMLLGRAPKFVRYTCYSCWLFSVLNNAH
FT                   IPMKVSGPQKTHNDTNSKSKWVCSTSGFSIGMRILSFAHDGVFISIIIWSSVSMVILLN
FT                   RHHQRLQYIQSPNQKLRVHAETRAAHTILMLVVTFVTCYLLDCICTFCHIYFVDSRLWL
FT                   RRVNQILAVSFPTFSPLLLIFRDPKDPCSLLFCC"
FT   assembly_gap    186009..186028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    187425..187444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    201876..203768
FT                   /estimated_length=1893
FT                   /gap_type="unknown"
FT   assembly_gap    205672..205691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <209326..210257
FT                   /gene="V1rd12"
FT                   /locus_tag="mCG_1031295"
FT                   /note="gene_id=mCG1031295.1"
FT   mRNA            <209326..210257
FT                   /gene="V1rd12"
FT                   /locus_tag="mCG_1031295"
FT                   /product="vomeronasal 1 receptor, D12"
FT                   /note="gene_id=mCG1031295.1 transcript_id=mCT148999.1
FT                   created on 13-AUG-2002"
FT   CDS             209326..210234
FT                   /codon_start=1
FT                   /gene="V1rd12"
FT                   /locus_tag="mCG_1031295"
FT                   /product="vomeronasal 1 receptor, D12"
FT                   /note="gene_id=mCG1031295.1 transcript_id=mCT148999.1
FT                   protein_id=mCP57719.1"
FT                   /protein_id="EDL24372.1"
FT                   /translation="MKTTEEVALQIVLLCQFGIGTMANILLFVHNFSPLLTGCQLRPKE
FT                   VICANMAVSSILILFMTVFPNNVFVAQRNLLNDLQCKLEYFVYMVARSTNLCSTCVLST
FT                   YQFVTLVPGNFSELMVRGRSPKVISYSCCSCWLFGILYNVYIPMKVSGPQNRHNKTSTK
FT                   SKWVCFTSGFSVGIVFLSFAHDAIFISIMVWASVSMVRLLYRHYQRLQYIFPPHQGNRG
FT                   YAEIRAAHSIVLLVVTFVSFYLLHCICFILHIVFVDSHLWLRHIGEVLTSSFPTISPLL
FT                   LIFRDPSYPCSLIFNYKKPVI"
FT   assembly_gap    221898..221917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    228970..229287
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    233670..233691
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            240110..241060
FT                   /pseudo
FT                   /locus_tag="mCG_1031294"
FT                   /note="gene_id=mCG1031294.1"
FT   mRNA            240110..241060
FT                   /pseudo
FT                   /locus_tag="mCG_1031294"
FT                   /note="gene_id=mCG1031294.1 transcript_id=mCT148998.1
FT                   created on 23-FEB-2003"
FT   assembly_gap    255947..256079
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    260064..260083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <267651..268573
FT                   /locus_tag="mCG_1031350"
FT                   /note="gene_id=mCG1031350.1"
FT   mRNA            <267651..268573
FT                   /locus_tag="mCG_1031350"
FT                   /product="mCG1031350"
FT                   /note="gene_id=mCG1031350.1 transcript_id=mCT149054.1
FT                   created on 13-AUG-2002"
FT   CDS             267651..268565
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031350"
FT                   /product="mCG1031350"
FT                   /note="gene_id=mCG1031350.1 transcript_id=mCT149054.1
FT                   protein_id=mCP57457.1"
FT                   /db_xref="GOA:K7N6W9"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3644326"
FT                   /db_xref="UniProtKB/TrEMBL:K7N6W9"
FT                   /protein_id="EDL24371.1"
FT                   /translation="MLLQNKSVKTTEEVALQVLLLCQVGVGTAVNIFLIVHNLSPNLNG
FT                   SQQRPIKVILANLAVGNTLILLFAFPNNMTLFVPKDPPTDLKCKLGYFIWLVARSTNMC
FT                   STCSLSTYQLVTLAPGTWGRVMLRGRAPKFVRYICYSCWLFSVLNNAHIPMKVSGPQKT
FT                   HNDTNTKNKWVCSTTGFSIGMRILSFAHDAVFISIIIWSSVSMVILLNRHHHRLQHIQS
FT                   TNQKLRVHAESRASHTILMLVVTFVTCYHLDCICTFCNISFLDSQLWLRRVKQILDASF
FT                   PTFSPLLLIFRDPKDPCSLLFCC"
FT   assembly_gap    282868..282917
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            292219..294605
FT                   /locus_tag="mCG_8175"
FT                   /note="gene_id=mCG8175.1"
FT   mRNA            join(292219..293891,293931..294605)
FT                   /locus_tag="mCG_8175"
FT                   /product="mCG8175"
FT                   /note="gene_id=mCG8175.1 transcript_id=mCT7737.1 created on
FT                   08-AUG-2002"
FT   CDS             292593..293543
FT                   /codon_start=1
FT                   /locus_tag="mCG_8175"
FT                   /product="mCG8175"
FT                   /note="gene_id=mCG8175.1 transcript_id=mCT7737.1
FT                   protein_id=mCP1340.2"
FT                   /db_xref="GOA:Q9EPS6"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3033476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EPS6"
FT                   /protein_id="EDL24370.1"
FT                   /translation="MITIPLTNEVVSMLSQNKSVKTTEEVALQILLLCQVGVGTAVNIF
FT                   LIVHNLSPILNGSQQRPIKVILANLAVGNTLILLFAFPNNMTLFVPKDPPTDLKCKLGY
FT                   FIWLVARSTNMCSTCSLSTYQLVTLAPGTWGRVMLRGRAPKFVRYICYSCWLSSVLNNA
FT                   HIPMKVSGPQKTHNDTNTKNKWVCSTTGFSIGMRILSFAHDAVFISIIIWSSVSMVILL
FT                   NRHHQRLQHIQSPNQKLRVHAETRAAHTILMLVVTFVTCYLLDCICTFLHISFVDSRLW
FT                   LRRVKEILAVSFPTFSPLLLIFRDPNDPCSLLFSC"
FT   gene            318631..320978
FT                   /gene="V1rd9"
FT                   /locus_tag="mCG_113311"
FT                   /note="gene_id=mCG113311.0"
FT   mRNA            join(318631..318780,319904..320978)
FT                   /gene="V1rd9"
FT                   /locus_tag="mCG_113311"
FT                   /product="vomeronasal 1 receptor, D9"
FT                   /note="gene_id=mCG113311.0 transcript_id=mCT114392.0
FT                   created on 08-AUG-2002"
FT   CDS             320007..320948
FT                   /codon_start=1
FT                   /gene="V1rd9"
FT                   /locus_tag="mCG_113311"
FT                   /product="vomeronasal 1 receptor, D9"
FT                   /note="gene_id=mCG113311.0 transcript_id=mCT114392.0
FT                   protein_id=mCP57445.1"
FT                   /db_xref="GOA:Q9EPS4"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3033478"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EPS4"
FT                   /protein_id="EDL24369.1"
FT                   /translation="MSALNKALKTTEEVALQIILLCQVGIAAVANILLLVHNLSPNFAG
FT                   PQLRPKHVILAHIAVGNLLIILLTGFPSNMTVFVPRNPLNNLNCKLEYFIRLVARSANM
FT                   CTTCVLSTYQFIVLVPGKWSRVILRGNTSTFVHYSCNSCWIISVLNNVYIPIKISGPWN
FT                   TDNDTDPNSKWVCSNSGFELVMVFLRFVHDAIFISIMVWTSVSMMLLLYRHHQSLKHIH
FT                   RSNGSLGLQPEARAAYTILMLVITFVCFYLLDCICIFFHISFVHFRVWLRHVSGIWAAS
FT                   FPTISPLMLIFRGPKKISAKGINTENAFINSH"
FT   assembly_gap    348410..349116
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   assembly_gap    352356..352478
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    353681..353700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    364670..366202
FT                   /estimated_length=1533
FT                   /gap_type="unknown"
FT   assembly_gap    367024..367593
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    371912..380747
FT                   /estimated_length=8836
FT                   /gap_type="unknown"
FT   assembly_gap    383057..383076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <383453..384445
FT                   /gene="V1rd22"
FT                   /locus_tag="mCG_1031349"
FT                   /note="gene_id=mCG1031349.1"
FT   mRNA            <383453..384445
FT                   /gene="V1rd22"
FT                   /locus_tag="mCG_1031349"
FT                   /product="vomeronasal 1 receptor, D22"
FT                   /note="gene_id=mCG1031349.1 transcript_id=mCT149053.1
FT                   created on 13-AUG-2002"
FT   CDS             383453..384394
FT                   /codon_start=1
FT                   /gene="V1rd22"
FT                   /locus_tag="mCG_1031349"
FT                   /product="vomeronasal 1 receptor, D22"
FT                   /note="gene_id=mCG1031349.1 transcript_id=mCT149053.1
FT                   protein_id=mCP57450.1"
FT                   /protein_id="EDL24368.1"
FT                   /translation="MSALNKALKTTEEVALQIILLCQVGIAAVANILLLVHNLSPNFAG
FT                   PQLRPKHVILAHITVGNLLIILLTGFPSNMTVFVPRNPLNDLNCKLEYFIRLVARSANM
FT                   CTTCILSSYQFIVLVPGKWSRVILRGNTSTFVHYSCNSCWIISVLNNVYIPIKISGPWN
FT                   TDNNTDPNSKWVCSNSGFELVMGFLRFVHDAIFISIMVWTSVSMMLLLYRHHQSLKHIH
FT                   RSNGSLGLQPEARAANTILMLMITFVCFYLLDCICIFFHISFVHFRVWLRHVSEILAAS
FT                   FPTISPLMLIVRGPRKISAKGINTENAFINSH"
FT   assembly_gap    384924..387560
FT                   /estimated_length=2637
FT                   /gap_type="unknown"
FT   assembly_gap    389368..389465
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   gene            408022..408909
FT                   /pseudo
FT                   /locus_tag="mCG_1031348"
FT                   /note="gene_id=mCG1031348.1"
FT   mRNA            408022..408909
FT                   /pseudo
FT                   /locus_tag="mCG_1031348"
FT                   /note="gene_id=mCG1031348.1 transcript_id=mCT149052.1
FT                   created on 13-AUG-2002"
FT   gene            416199..417162
FT                   /pseudo
FT                   /locus_tag="mCG_67382"
FT                   /note="gene_id=mCG67382.2"
FT   mRNA            416199..417162
FT                   /pseudo
FT                   /locus_tag="mCG_67382"
FT                   /note="gene_id=mCG67382.2 transcript_id=mCT67565.2 created
FT                   on 13-AUG-2002"
FT   assembly_gap    424919..425588
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   assembly_gap    426870..430393
FT                   /estimated_length=3524
FT                   /gap_type="unknown"
FT   assembly_gap    431772..431791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    432856..432875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    440254..440273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(440658..>441588)
FT                   /locus_tag="mCG_1031346"
FT                   /note="gene_id=mCG1031346.1"
FT   mRNA            complement(440658..>441588)
FT                   /locus_tag="mCG_1031346"
FT                   /product="mCG1031346"
FT                   /note="gene_id=mCG1031346.1 transcript_id=mCT149050.1
FT                   created on 13-AUG-2002"
FT   CDS             complement(440674..441588)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031346"
FT                   /product="mCG1031346"
FT                   /note="gene_id=mCG1031346.1 transcript_id=mCT149050.1
FT                   protein_id=mCP57770.1"
FT                   /db_xref="GOA:K7N6T9"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3648367"
FT                   /db_xref="UniProtKB/TrEMBL:K7N6T9"
FT                   /protein_id="EDL24367.1"
FT                   /translation="MLLQNKSVKTTEEVALQVLLLCQVGFGTAVNIFLIVHNLSPILNG
FT                   SQQRPIKVILANLAVGNTLILLFAFPNNMTLFVPKDPPTDLKCKLGYFIWLVARSTNMC
FT                   STCFLSTYQLVTLAPGTWGRVMLRGRAPKFVRYICYSCWLFSVLNNAHIPMKVNGPQKT
FT                   HNDTNTKNKWVCSTTGFSIGMRILSFAHDAVFISIIIWSSVSMVILLNRHHQRLQHIQS
FT                   TNQKLRVHAETRASHTILLLVVTFVTCYLLDCICTVCNISFLDSRVWLRRVKQILDVSF
FT                   PTFSPLLLIFRDPKDPCSLLFCC"
FT   assembly_gap    446252..446271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(467165..468134)
FT                   /locus_tag="mCG_1031293"
FT                   /note="gene_id=mCG1031293.1"
FT   mRNA            complement(467165..468134)
FT                   /locus_tag="mCG_1031293"
FT                   /product="mCG1031293"
FT                   /note="gene_id=mCG1031293.1 transcript_id=mCT148997.1
FT                   created on 13-FEB-2003"
FT   CDS             complement(467176..468090)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031293"
FT                   /product="mCG1031293"
FT                   /note="gene_id=mCG1031293.1 transcript_id=mCT148997.1
FT                   protein_id=mCP57712.1"
FT                   /db_xref="GOA:G3UW31"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3809206"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW31"
FT                   /protein_id="EDL24366.1"
FT                   /translation="MLSQNKSVKTTVEVTLQILLLCQVGVGTVVNIFLFVHNLSPFLNG
FT                   SQQRPIKVILANLALGNTLILLFAFPNNIRVFIPREFPTDLKCKLGYFIWLVARSTNMC
FT                   STCSLSTYQFVTLAPGTWGRVMLPGRAPNFLRYTCYSCWLFSVLNNAHIPMKVSGPQKT
FT                   HNDSNSKSKWVCSTSGFSIGMRILSFAHDAVFISIIIWSSVSMVILLNRHHQRLQHIQS
FT                   TNQKLRVHAETRASHTILLLVVTFVTCYLLDCICTVCNISFVDSRVWLRRVKEILSVSF
FT                   PTFSPLLLIFRDPKDPCSLLFGC"
FT   assembly_gap    470155..492523
FT                   /estimated_length=22369
FT                   /gap_type="unknown"
FT   assembly_gap    495804..497435
FT                   /estimated_length=1632
FT                   /gap_type="unknown"
FT   assembly_gap    519840..520877
FT                   /estimated_length=1038
FT                   /gap_type="unknown"
FT   assembly_gap    533385..533404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            542608..>543607
FT                   /gene="V1rd17"
FT                   /locus_tag="mCG_1031255"
FT                   /note="gene_id=mCG1031255.1"
FT   mRNA            542608..>543607
FT                   /gene="V1rd17"
FT                   /locus_tag="mCG_1031255"
FT                   /product="vomeronasal 1 receptor, D17"
FT                   /note="gene_id=mCG1031255.1 transcript_id=mCT148959.1
FT                   created on 13-AUG-2002"
FT   CDS             542636..543607
FT                   /codon_start=1
FT                   /gene="V1rd17"
FT                   /locus_tag="mCG_1031255"
FT                   /product="vomeronasal 1 receptor, D17"
FT                   /note="gene_id=mCG1031255.1 transcript_id=mCT148959.1
FT                   protein_id=mCP57458.1"
FT                   /db_xref="GOA:Q8R2B4"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3033486"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R2B4"
FT                   /protein_id="EDL24365.1"
FT                   /translation="MSYLIITPVSAKALSMCTLDKSLKTTEEVALQIFLLCQFGVGTVA
FT                   NVFLFVHNFYPVLTGSQQSPRQVILSHMAVANILILFITIFPTNVMTFAPRNPPTDLKC
FT                   KLEFFIRLVARSTNLCSTCVLSIYQFVTLVPVNRGKLILRASVPSLARYSCYSCWFFSV
FT                   LNNIYIPIKVTGPQIADNNTDCRSKLFCFTFGYSRVIFFLRIAYDATFMSIMVWTSVSM
FT                   VLLLHRHHHKMQHIFTTNRHYRGQAETRATSTILMLVVTFVSFYLLNFTCIIIQALVTD
FT                   SHAFVRHWSEALVTGFPTISPLLLIFRKSKDPCSVFFRLLKS"
FT   gene            complement(560892..561538)
FT                   /locus_tag="mCG_113310"
FT                   /note="gene_id=mCG113310.0"
FT   mRNA            complement(560892..561538)
FT                   /locus_tag="mCG_113310"
FT                   /product="mCG113310"
FT                   /note="gene_id=mCG113310.0 transcript_id=mCT114391.0
FT                   created on 13-AUG-2002"
FT   CDS             complement(561038..561478)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113310"
FT                   /product="mCG113310"
FT                   /note="gene_id=mCG113310.0 transcript_id=mCT114391.0
FT                   protein_id=mCP57442.1"
FT                   /protein_id="EDL24364.1"
FT                   /translation="MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKRPQMPTDES
FT                   LSSLAVRRPLTSLIPSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLI
FT                   IGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM"
FT   assembly_gap    569508..569527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <569671..>570536
FT                   /locus_tag="mCG_1031254"
FT                   /note="gene_id=mCG1031254.1"
FT   mRNA            <569671..>570536
FT                   /locus_tag="mCG_1031254"
FT                   /product="mCG1031254"
FT                   /note="gene_id=mCG1031254.1 transcript_id=mCT148958.1
FT                   created on 13-AUG-2002"
FT   CDS             <569673..570536
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031254"
FT                   /product="mCG1031254"
FT                   /note="gene_id=mCG1031254.1 transcript_id=mCT148958.1
FT                   protein_id=mCP57456.1"
FT                   /protein_id="EDL24363.1"
FT                   /translation="QQFIELDDNRQRLLQKCKELMKKARQVCNLSADQAVPQEFQTAFQ
FT                   DLPNTLDEIDALLTEERSRASCFTGLNPSVVEEYSKREVEIQQLTEELQGKKVELDEYR
FT                   ENISQVKERWLNPLKELVEKINEKFSNFFSSMQCAGEVDLHTENEEDYDKYGIRIRVKF
FT                   RSSTQLHELTPHHQSGGERSVSTMLYLMALQELNRCPFRVVDEINQGMDPINERRVFEM
FT                   VVNTACKENTSQYFFITPKLLQNLPYSEKMTVLFVYNGPHMLEPNRWNLKAFQRRQRRI
FT                   TFTQPQ"
FT   assembly_gap    573556..573575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    574959..574978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    580234..580359
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            581066..>581602
FT                   /locus_tag="mCG_1031292"
FT                   /note="gene_id=mCG1031292.1"
FT   mRNA            581066..>581602
FT                   /locus_tag="mCG_1031292"
FT                   /product="mCG1031292"
FT                   /note="gene_id=mCG1031292.1 transcript_id=mCT148996.1
FT                   created on 13-FEB-2003"
FT   CDS             581075..581602
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031292"
FT                   /product="mCG1031292"
FT                   /note="gene_id=mCG1031292.1 transcript_id=mCT148996.1
FT                   protein_id=mCP57708.1"
FT                   /protein_id="EDL24362.1"
FT                   /translation="MMTTLSEGNFLVVKLDFHVPTFTTVSAKILQNTKYALVIRREARI
FT                   MKSLSHPNIIKLFHVVQRREATYLVMEYASEGELQDRVIKVGSLEESETRRLFAQIVHA
FT                   VQYCHGHHIVHTDIKASNILIDCRGNAKLCDFDLAAEVIPGQKLAGFCGTLPRTPICRG
FT                   ISGPPMDIWSSS"
FT   assembly_gap    589043..590032
FT                   /estimated_length=990
FT                   /gap_type="unknown"
FT   assembly_gap    591512..592103
FT                   /estimated_length=592
FT                   /gap_type="unknown"
FT   gene            598070..>600536
FT                   /locus_tag="mCG_63678"
FT                   /note="gene_id=mCG63678.2"
FT   mRNA            join(598070..598373,599471..>600536)
FT                   /locus_tag="mCG_63678"
FT                   /product="mCG63678"
FT                   /note="gene_id=mCG63678.2 transcript_id=mCT63861.2 created
FT                   on 13-AUG-2002"
FT   CDS             599568..600536
FT                   /codon_start=1
FT                   /locus_tag="mCG_63678"
FT                   /product="mCG63678"
FT                   /note="gene_id=mCG63678.2 transcript_id=mCT63861.2
FT                   protein_id=mCP36610.1"
FT                   /protein_id="EDL24361.1"
FT                   /translation="MIAVSCLIITLGLYKALSMSAHDKSLKTTEEVALQILLLCQFGVG
FT                   TFANVFLFVHNFFPILTGSKQRPRQVILSHIAVANALTLFITTFPNNMAFAPRSPQNDL
FT                   KCKLEFFIRMVARSTGLCSTCVLSIHQFLTLVPVNRGKLILRTSVPNLVSYSCYSCWFF
FT                   SVLNNIYIPIKVTGPQITDSKNDSKSKLFCSTSGFNVGIVFLRFAHDATFMSIMVWTSV
FT                   SMVLLLHRHRQRMQYIFTLNQDHRSQAETKATHTILMLVVIFVSFYLLHFICIIFYTFF
FT                   IYSHQFLRHCSEVLVVGFPTISPLLLIFRDPQGPCSVFFNC"
FT   gene            <618555..>619472
FT                   /locus_tag="mCG_1031345"
FT                   /note="gene_id=mCG1031345.0"
FT   mRNA            <618555..>619472
FT                   /locus_tag="mCG_1031345"
FT                   /product="mCG1031345"
FT                   /note="gene_id=mCG1031345.0 transcript_id=mCT149049.1
FT                   created on 13-AUG-2002"
FT   CDS             618555..619472
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031345"
FT                   /product="mCG1031345"
FT                   /note="gene_id=mCG1031345.0 transcript_id=mCT149049.1
FT                   protein_id=mCP57640.1"
FT                   /db_xref="GOA:Q8R2B3"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R2B3"
FT                   /protein_id="EDL24360.1"
FT                   /translation="MSTHDTSLKTTEEVAFQIILLCQFGVGTFANVFLFVYNFSPISTG
FT                   SKQRPRQVILRHMAVANALTLFLTIFPNNMMTFAPIIPQTDLKCKLEFFTRLVARSTNL
FT                   CSTCVLSIHQFVTLVPVNSGKGILRASVTNMASYSCYSCWFFSVLNNIYIPIKVTGPQL
FT                   TDNNNNSKSKLFCSTSEFSVGIVFLRFAHDATFMSIMVWTSVSMVLLLHRHCQRMQYIF
FT                   TLNQDPRGQAETTATHTILMLVVTFVGFYLLSLICIIFYTYFIYSHHFLRHCNDILVSG
FT                   FPTISPLLLIFRDPKGPCSVFFNC"
FT   assembly_gap    638666..638685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    641168..641187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    652212..653553
FT                   /estimated_length=1342
FT                   /gap_type="unknown"
FT   assembly_gap    655567..655605
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    657455..657474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <662779..663749
FT                   /locus_tag="mCG_1031344"
FT                   /note="gene_id=mCG1031344.1"
FT   mRNA            <662779..663749
FT                   /locus_tag="mCG_1031344"
FT                   /product="mCG1031344"
FT                   /note="gene_id=mCG1031344.1 transcript_id=mCT149048.1
FT                   created on 13-AUG-2002"
FT   CDS             662779..663696
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031344"
FT                   /product="mCG1031344"
FT                   /note="gene_id=mCG1031344.1 transcript_id=mCT149048.1
FT                   protein_id=mCP57637.1"
FT                   /protein_id="EDL24359.1"
FT                   /translation="MSAHGKSLKTTEEVALQILLLCQFGVGTVANVCLFVHNFYPVLTG
FT                   SQQRPRQVLLSHMAVTNALTLFLTIFPNNMMAFAPRNPLTDLKCKLEFFTRLVARSTNL
FT                   CSTCVLSIHQFVTLVPVNKGKLILRASVTNMASYSCYSCWFFSVLNNIHIPIKVTGPQI
FT                   TDNNNDSKSKLFCSTSGFSVGIVFLRFAHDATFMSIMVWTSVSMVLLLHRHRQRMQHIL
FT                   TPNQNPRGQAESRATNTILMLVVTFVSFYLLNFICIIFQTFFIDSRLFVRHVGEVFVAS
FT                   FPTISPLLLIFRDPKDPCSVLFSC"
FT   gene            671751..672287
FT                   /locus_tag="mCG_1031253"
FT                   /note="gene_id=mCG1031253.1"
FT   mRNA            671751..672287
FT                   /locus_tag="mCG_1031253"
FT                   /product="mCG1031253"
FT                   /note="gene_id=mCG1031253.1 transcript_id=mCT148957.1
FT                   created on 13-AUG-2002"
FT   CDS             671881..672222
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031253"
FT                   /product="mCG1031253"
FT                   /note="gene_id=mCG1031253.1 transcript_id=mCT148957.1
FT                   protein_id=mCP57449.1"
FT                   /protein_id="EDL24358.1"
FT                   /translation="MSDAAVDTSSEITTKDLKEKKEAVAEKAENGRDAPANRNGQNEGN
FT                   GEQEADNEVDEEEEEGGDEEEEEGGDSEEEGVDEDEEAEAPTVKWIAKDDEDDNVDTKK
FT                   QNLNVVTLE"
FT   gene            complement(677534..679670)
FT                   /pseudo
FT                   /locus_tag="mCG_1031269"
FT                   /note="gene_id=mCG1031269.1"
FT   mRNA            complement(join(677534..677592,678013..678279,
FT                   678985..679239,679397..679670))
FT                   /pseudo
FT                   /locus_tag="mCG_1031269"
FT                   /note="gene_id=mCG1031269.1 transcript_id=mCT148973.1
FT                   created on 30-AUG-2002"
FT   assembly_gap    680509..680696
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   gene            <689881..717091
FT                   /gene="Zfp180"
FT                   /locus_tag="mCG_144025"
FT                   /note="gene_id=mCG144025.0"
FT   mRNA            join(<689881..690196,693379..693459,713826..717091)
FT                   /gene="Zfp180"
FT                   /locus_tag="mCG_144025"
FT                   /product="zinc finger protein 180, transcript variant
FT                   mCT183449"
FT                   /note="gene_id=mCG144025.0 transcript_id=mCT183449.0
FT                   created on 04-JUN-2003"
FT   mRNA            join(<689912..690196,693379..693459,707232..707306,
FT                   710880..710995,713826..717091)
FT                   /gene="Zfp180"
FT                   /locus_tag="mCG_144025"
FT                   /product="zinc finger protein 180, transcript variant
FT                   mCT191915"
FT                   /note="gene_id=mCG144025.0 transcript_id=mCT191915.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<693429..693459,713826..715546)
FT                   /codon_start=1
FT                   /gene="Zfp180"
FT                   /locus_tag="mCG_144025"
FT                   /product="zinc finger protein 180, isoform CRA_a"
FT                   /note="gene_id=mCG144025.0 transcript_id=mCT183449.0
FT                   protein_id=mCP105733.0 isoform=CRA_a"
FT                   /protein_id="EDL24356.1"
FT                   /translation="VPGVPAGLCGDLPAVHGTEGATAKQTIFNEEPSHGLKLEGSARDD
FT                   PWLSTCEEVRDCKEQSGKQPNKQEEVAFTQGSAGSPDTVYRGHDPDRSCLSTSRPSFPM
FT                   IPLRNHFHKQASHVKKLHGDVVASSHQKISDSSDLLEDDTAGAVPQSIRPSQFVSSPQG
FT                   EEAYELNGHVQASGRGAPRNLNEKVPLEGKTFGFKGRGQVLNHSMVLGGQQELLVKEGQ
FT                   DKCKTAPSPSLPQSLRNYSEEKRFECKYCGKSFSWSSHLIAHQRTHTGEKPYKCNLCGK
FT                   FFTRSSHVVSHQRIHTGEKPYKCNLCGKSFTQRYVLVVHQRTHTGERPYECTQCGKSFR
FT                   QSYKLIAHQRTHTGEKPYECTQCGKSFIQSYKLIAHQKIHSGEKPYECSHCGKSFSQSY
FT                   KLVAHQRTHTGEKPFECNHCGKSFSWSSQLVSHQRTHTGEKPYECNECGKSFNRSSHLV
FT                   MHQRTHTGEKPYQCKQCGKSFSQSYVLVVHQRTHTGEKPYECGQCGKTFRQSSCFTQHQ
FT                   RTHTGEKPYECNQCGKTFSLSARLIVHQRTHTGEKPYKCGQCGKAFISSSKRSRHQATH
FT                   SEDACKS"
FT   assembly_gap    693935..694036
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    695332..695351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    698539..698558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    699809..699828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<707257..707306,710880..710995,713826..715546)
FT                   /codon_start=1
FT                   /gene="Zfp180"
FT                   /locus_tag="mCG_144025"
FT                   /product="zinc finger protein 180, isoform CRA_b"
FT                   /note="gene_id=mCG144025.0 transcript_id=mCT191915.0
FT                   protein_id=mCP112880.0 isoform=CRA_b"
FT                   /protein_id="EDL24357.1"
FT                   /translation="SLKWREKMLGHWTSCLSTDFKIVTVDLTEEGQSTWNNAQRTPEKT
FT                   VILEGHRDLWDLPAVHGTEGATAKQTIFNEEPSHGLKLEGSARDDPWLSTCEEVRDCKE
FT                   QSGKQPNKQEEVAFTQGSAGSPDTVYRGHDPDRSCLSTSRPSFPMIPLRNHFHKQASHV
FT                   KKLHGDVVASSHQKISDSSDLLEDDTAGAVPQSIRPSQFVSSPQGEEAYELNGHVQASG
FT                   RGAPRNLNEKVPLEGKTFGFKGRGQVLNHSMVLGGQQELLVKEGQDKCKTAPSPSLPQS
FT                   LRNYSEEKRFECKYCGKSFSWSSHLIAHQRTHTGEKPYKCNLCGKFFTRSSHVVSHQRI
FT                   HTGEKPYKCNLCGKSFTQRYVLVVHQRTHTGERPYECTQCGKSFRQSYKLIAHQRTHTG
FT                   EKPYECTQCGKSFIQSYKLIAHQKIHSGEKPYECSHCGKSFSQSYKLVAHQRTHTGEKP
FT                   FECNHCGKSFSWSSQLVSHQRTHTGEKPYECNECGKSFNRSSHLVMHQRTHTGEKPYQC
FT                   KQCGKSFSQSYVLVVHQRTHTGEKPYECGQCGKTFRQSSCFTQHQRTHTGEKPYECNQC
FT                   GKTFSLSARLIVHQRTHTGEKPYKCGQCGKAFISSSKRSRHQATHSEDACKS"
FT   assembly_gap    717092..717111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            721716..737995
FT                   /gene="Zfp112"
FT                   /locus_tag="mCG_22849"
FT                   /note="gene_id=mCG22849.1"
FT   mRNA            join(721716..721838,732273..732399,733958..734053,
FT                   734874..737995)
FT                   /gene="Zfp112"
FT                   /locus_tag="mCG_22849"
FT                   /product="zinc finger protein 112"
FT                   /note="gene_id=mCG22849.1 transcript_id=mCT23838.1 created
FT                   on 08-AUG-2002"
FT   assembly_gap    729219..729238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(732276..732399,733958..734053,734874..737275)
FT                   /codon_start=1
FT                   /gene="Zfp112"
FT                   /locus_tag="mCG_22849"
FT                   /product="zinc finger protein 112"
FT                   /note="gene_id=mCG22849.1 transcript_id=mCT23838.1
FT                   protein_id=mCP15755.2"
FT                   /protein_id="EDL24355.1"
FT                   /translation="MVTFRDVAVVFSEEELGLLDAAQWKLYREVMLENFRMLLSVAHQP
FT                   FKPGLIAQLENGEQLWMVEAEAHAGGLSGRRNGHAVENAEDVEVNSLCPEDLSFCQTWP
FT                   WGACTLPSGQEFIKRCQGSNGESQSQEASPRLVWAGMPMQISEDGNYGLPPAHEDSASM
FT                   KNQEFPPPRSQQSQGEPYLGRPCVTCQWKGQQTSIRNHFCRYGSVCWSPYHSDNEELYS
FT                   KGKSYGFHDDRGKTVKVLLLNQDFIELGPEPCPRTKNREAWGHDNDHSSHTHQQCHSRG
FT                   KPCTRSLSGEGCGDRSALHGHPGLEAGDEGADGSPPLQSSPRVCMEQVPRECSGNVHYG
FT                   SPLNTCGCAHPGNTSQTCSIPKQAVGSPVHCNSTFRAHPREEPNNYEENRNVFNQSSCL
FT                   QVSRKIGAEEKLCQGVECRKNFTHCSSLNIPHRVPVEETLCNPDCGNHFSLPPHFQDFP
FT                   GVRAREQPHNRLCRTGFSQTLCLQGHQKLHIREKPSHREGGSGCNWSSTPKDPQKQKLH
FT                   KCNACGKGFSHRSVLDIHHRIHTGEKPYKCEECGKGFSRSAYLQGHQRVHTGEKPYKCE
FT                   ECGKGFSRSSHLQGHQRVHTGEKPYKCEECGKGFSWSFNLQIHQRVHTGEKPYKCGECG
FT                   KGFSKASTLLAHERVHTGEKPYQCHECGKNFSQKSYLQSHQSVHSGERPHICEVCGKGF
FT                   SQRAYLQGHLRVHTRVKPYKCEVCGKGFSQGSRLEAHRRVHTGRKPFKCETCTKGFSES
FT                   SRLQAHQRIHEEGRPYKCDQCGKGFSGYSSLQAHHRVHTGEKPYKCEVCGKGFSQRSNL
FT                   QAHQRVHTGEKPYTCDACGKGFRWSSGLLIHQRAHSSDTFYRSGECGSSYPPENLCRNE
FT                   GL"
FT   gene            complement(740517..>744270)
FT                   /locus_tag="mCG_1031343"
FT                   /note="gene_id=mCG1031343.0"
FT   mRNA            complement(join(740517..740697,743932..>744270))
FT                   /locus_tag="mCG_1031343"
FT                   /product="mCG1031343"
FT                   /note="gene_id=mCG1031343.0 transcript_id=mCT149047.0
FT                   created on 13-AUG-2002"
FT   assembly_gap    742565..743587
FT                   /estimated_length=1023
FT                   /gap_type="unknown"
FT   CDS             complement(744023..>744268)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031343"
FT                   /product="mCG1031343"
FT                   /note="gene_id=mCG1031343.0 transcript_id=mCT149047.0
FT                   protein_id=mCP57631.0"
FT                   /protein_id="EDL24354.1"
FT                   /translation="VSLRNRFLGARSPGVLFGFFIFEMPCKTSMDTFLFLFCFVLFCFF
FT                   PEAVSLRSPGSPGILFVDQAGLKLRDPFVSRSRVLG"
FT   gene            744431..753470
FT                   /gene="Zfp235"
FT                   /locus_tag="mCG_19169"
FT                   /note="gene_id=mCG19169.1"
FT   mRNA            join(744431..744718,745489..745546,747277..747403,
FT                   750532..753470)
FT                   /gene="Zfp235"
FT                   /locus_tag="mCG_19169"
FT                   /product="zinc finger protein 235"
FT                   /note="gene_id=mCG19169.1 transcript_id=mCT17597.1 created
FT                   on 08-AUG-2002"
FT   CDS             join(745532..745546,747277..747403,750532..752498)
FT                   /codon_start=1
FT                   /gene="Zfp235"
FT                   /locus_tag="mCG_19169"
FT                   /product="zinc finger protein 235"
FT                   /note="gene_id=mCG19169.1 transcript_id=mCT17597.1
FT                   protein_id=mCP2914.2"
FT                   /protein_id="EDL24353.1"
FT                   /translation="MTKLQEAVTFRDVAVVFSEEEMGLLDAAQRKLYHDVMLENFLNLL
FT                   AVGSQSPNKVDTLDSTGLRHLSLGWLPCWHMTGHDVKKLASTPDVVVNIQGKSSHFLEQ
FT                   CHSSCHGGTEEPLQVSEDNGCLESLTSDHSSITENQEFLSGRAQSSWSKTHFSERWNHE
FT                   KHCTQTLVKTKSQLLALGVDILNCISHQDNNILHKRDKVPSSGDCDQVIFPMACLTQSP
FT                   VYTEQKAYQCNTGQDAFIDSPSQETQQVLLGNKSPVHGTYEDTSYTSSVIQQSVHPGRK
FT                   RYWCQECGKAFSQSSNLQTHQRVHTGEKPYTCPECGKSFNQSSHLYAHLPIHTGEKPYC
FT                   CDNCGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQAHERIHTGEKPYKCGD
FT                   CGKCFSCSSNLHTHQRVHTEEKPYKCDECGKRFSLSFNLHSHQRVHTGEKPYKCEECGK
FT                   GFSSASSFQSHQRVHTGEKPFCCSVCGKGFSQSSYFQAHQRVHTGEKPYRCDVCGKRFN
FT                   WSLNLHNHQRVHTGERPYKCEECGKGFSQASNLQAHQSVHTGEKPFRCNACQKRFSQAS
FT                   HLQAHQRVHTGERPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEECGKEFSWSAGLT
FT                   AHQRVHTGEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICSICSKGFSQRSHLVYHQ
FT                   RVHSAGNP"
FT   assembly_gap    755745..756035
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    757584..757603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    761950..762136
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    777208..777227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    778596..779392
FT                   /estimated_length=797
FT                   /gap_type="unknown"
FT   gene            <783904..>790006
FT                   /locus_tag="mCG_145393"
FT                   /note="gene_id=mCG145393.0"
FT   mRNA            join(<783904..783993,784955..785012,786596..786722,
FT                   789241..>790006)
FT                   /locus_tag="mCG_145393"
FT                   /product="mCG145393"
FT                   /note="gene_id=mCG145393.0 transcript_id=mCT184817.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<783992..783993,784955..785012,786596..786722,
FT                   789241..>790006)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145393"
FT                   /product="mCG145393"
FT                   /note="gene_id=mCG145393.0 transcript_id=mCT184817.0
FT                   protein_id=mCP105752.0"
FT                   /protein_id="EDL24352.1"
FT                   /translation="RLLPRALPCLKEKRTMTKLQEAVTFRDVAVVFSEEELGLLDAAQR
FT                   KLYHDVMLENFRNLLAVGGQSPGKTTHLHTTGLRFLSLGRLPCWQVTSHDANKLAGAPE
FT                   AVISIQGKGPHLLEQCHFPCHWGAEQLPQASEDASCPESPTNSHSSIIENQEFLSGRAQ
FT                   SSWGKTHLSKKQKPQKQCPKTLVKTEPRQLLPGVDTLSCISHHNNALHKRDKAHSSGDC
FT                   GKVIFPVSPSTQHHVYIERRVYQCSKGQEALTDRPNHELHQPVLVGEKSPVRSTHEDTP
FT                   IQQSVHPGKKQYSRHKCGTGFSKNAHLQTNQRVQTG"
FT   assembly_gap    794668..794762
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            complement(805709..812415)
FT                   /locus_tag="mCG_22852"
FT                   /note="gene_id=mCG22852.1"
FT   mRNA            complement(join(805709..808874,812202..812415))
FT                   /locus_tag="mCG_22852"
FT                   /product="mCG22852"
FT                   /note="gene_id=mCG22852.1 transcript_id=mCT23841.1 created
FT                   on 08-AUG-2002"
FT   CDS             complement(join(806914..808874,812202..812346))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22852"
FT                   /product="mCG22852"
FT                   /note="gene_id=mCG22852.1 transcript_id=mCT23841.1
FT                   protein_id=mCP15753.2"
FT                   /db_xref="GOA:Q9R164"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:1929114"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R164"
FT                   /protein_id="EDL24351.1"
FT                   /translation="MCLPSQEAVTFRDVAVVFSEEELGLLDAAQRKLYHDVMLENFRNL
FT                   LAVGGQSPNKMEIVDATGLRCLSLGQLLCWGETSHNINKLARALEAVINTQGKCSHSLE
FT                   QCHSSCHRVSEEPPRDSEDSSSPDLTNDHSSITENQEFLSGRAQGSWGKRRLRKRQNHQ
FT                   KNCLQTLMKNKPQLLAQHSPVHSTQEDTRHSFSVPVQESIYPGRKRYRCQECGKAFRQS
FT                   SALQTHQRVHTGEKPYRGNSRGKNFSRSSDLNIHRQVHTREKPYTCKVCKKRFMQCSLL
FT                   QAHKRIHTGEKPYKCGDCGKRFSCISNFHIHQRVHTKSKPSKCDYGKPFNLRCNFHSHQ
FT                   RVHTGEKPYKCEECGKGFTSASSFQRHQRVHTGEKPFVCSVCGKGFSRTSYLQTHQRVH
FT                   SGDKPYQCDSCGKGFTQLSHLQAHERIHTDQKPYKCGDCGKRFSCSSNLHTHQRVHTGE
FT                   KPYKCEECGKGFSLVSGLQAHQRVETGKKPFKCNACQKRFSQAWNLHAHQRVHTGEKPY
FT                   KCDTCGKAFGQRSGLQIHQRIHTGEKPFKCEECGKEFSLNSGLIAHRRVHTGEKPYECK
FT                   DCGKGFSLASSLRTHQRVHTGEKPFQCNECQKRFSQVSHLQSHQRVHTGEKPYKCDRCG
FT                   KAFSQKSGLQVHKRIHTGEKPFKCEECGKEFIWSSGLSAHRKVHTGEKPYRRRQYGKGL
FT                   IRPHTSD"
FT   gene            complement(836395..846382)
FT                   /gene="Zfp109"
FT                   /locus_tag="mCG_126287"
FT                   /note="gene_id=mCG126287.0"
FT   mRNA            complement(join(836395..838663,843174..843300,
FT                   845440..845497,845905..846382))
FT                   /gene="Zfp109"
FT                   /locus_tag="mCG_126287"
FT                   /product="zinc finger protein 109"
FT                   /note="gene_id=mCG126287.0 transcript_id=mCT127554.0
FT                   created on 08-AUG-2002"
FT   CDS             complement(join(836871..838663,843174..843300,
FT                   845440..845454))
FT                   /codon_start=1
FT                   /gene="Zfp109"
FT                   /locus_tag="mCG_126287"
FT                   /product="zinc finger protein 109"
FT                   /note="gene_id=mCG126287.0 transcript_id=mCT127554.0
FT                   protein_id=mCP57634.1"
FT                   /db_xref="GOA:Q9R166"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:1929099"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R166"
FT                   /protein_id="EDL24350.1"
FT                   /translation="MTKLQEAVTFRDVAVVFSEEELGLLDAAQRKLYHDVMLENFRNLL
FT                   AVGGQVPNKMENLHTTGVRCLSLGQLPCGHMASHDANKLARAPEGVINTQGMVSYFPEQ
FT                   CHFSCHRGPEEPPWASKDNGCLEILTNDHSSITESQKFLSGIAQCSWSKKHLSKRQNYQ
FT                   KHCVQTPVKTKPRRLLAPGIDRMSCVSHQDNNTLHKGDKGQSNSDFDKLTFPVSPVTPH
FT                   HVYTERKSYKCSKAQEAFIDRPTLELHQQDLVGKKSPVRSTYEVSRHSSIQKSVHAGTK
FT                   RYWCHECGKAFSQSSALQTHRRVHTGEKPYRCDSCGKAFTQWSVLHAHQRIHTGEKPYK
FT                   CGDCGRRFRFSSNLHIHQRVHTGEKPYKCHVCGKCFRFRFYSHQRVHTGEKPYKCDECG
FT                   KGFTSASNVKVHQRVHTGVKPFCCNVCGKCFSRSFHLHTHQRVHTGEKLYKCDACGKAF
FT                   SQRSSLQVHRLIHTGEKPYKCEECGKGFTSASSFQGHQRVHTGEKPFHCDVCGKDFSRS
FT                   SYLQIHQRMHTGEKPYKCDSCGKAFSQRAHLQVHQRTHTGEKPFKCEECGKEFRQRSGL
FT                   SSHQIVHKEEKPYTCWECGKGFSQPSLFERHRRVHTGERPYICGTCCKGFSQRSHLVKH
FT                   QRVHSAANL"
FT   gene            863642..870752
FT                   /locus_tag="mCG_22848"
FT                   /note="gene_id=mCG22848.1"
FT   mRNA            join(863642..863744,864655..864712,867275..867401,
FT                   868950..870752)
FT                   /locus_tag="mCG_22848"
FT                   /product="mCG22848"
FT                   /note="gene_id=mCG22848.1 transcript_id=mCT23837.1 created
FT                   on 08-AUG-2002"
FT   CDS             join(864698..864712,867275..867401,868950..870736)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22848"
FT                   /product="mCG22848"
FT                   /note="gene_id=mCG22848.1 transcript_id=mCT23837.1
FT                   protein_id=mCP15745.2"
FT                   /db_xref="GOA:Q8CCP6"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:1891198"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CCP6"
FT                   /protein_id="EDL24349.1"
FT                   /translation="MTKLQEAVTFRDVAVVFSKEELGLLDAAQRKLYHDVMLENFRNLL
FT                   AVGGQSPNKIETLHAMGVRCLSLERLPCWQMTSHDVNKLARTPEDGINTQGKGSHFLEP
FT                   CHKGAEKPPWASEDDGCLERLTSNHSGITESQEFLSGGAQSSSSKSHPSERHDQWKHCP
FT                   QTWVKNKAQLSALSADVLSCISHQDNNILHKRDKVPSSGDCDQVINPMSSLTQDCDYTQ
FT                   QKAYQCSKGQEVFSDSPSLELHQQTLLGKKSPVHSTHKDTRQSPSVLIQPSVHLGTKRY
FT                   WCHECGKGFSHSSTLQTHQRVHTGEKPYRCDSCGKGFSRSSDLNIHRRVHTGEKLYKCE
FT                   VCGKGFTKWDHLQIHERIHTGEKPYKCGDCGKRFSCSWNLHTHQRVHTEEKPYECNECG
FT                   KRFSLSFNLHSHQRVHTGEKPYKCEECGKDFSSASSFQRHQRVHTGEKPFVCSVCGKGF
FT                   SQSSNFQAHQRVHTREKPYRCDVCGKHFTWSLHNHQRVHTGEKPYMCVECGKGFSHASS
FT                   LQAHQSVHTGERPFKCNVCQKRFRQASILQDHERVHTGEKPYKCDTCGKVFSQRSGLQV
FT                   HQRIHTGEKPFKCEECGKEFRWNSGLSSHQRVHTAEKPYMCQQCGKGFSQASHFHTHLK
FT                   MHTTERI"
FT   gene            <879247..886308
FT                   /locus_tag="mCG_68215"
FT                   /note="gene_id=mCG68215.2"
FT   mRNA            join(<879247..879493,881970..882096,883448..886308)
FT                   /locus_tag="mCG_68215"
FT                   /product="mCG68215"
FT                   /note="gene_id=mCG68215.2 transcript_id=mCT68402.2 created
FT                   on 06-DEC-2004"
FT   CDS             join(<879401..879493,881970..882096,883448..885129)
FT                   /codon_start=1
FT                   /locus_tag="mCG_68215"
FT                   /product="mCG68215"
FT                   /note="gene_id=mCG68215.2 transcript_id=mCT68402.2
FT                   protein_id=mCP43414.2"
FT                   /protein_id="EDL24348.1"
FT                   /translation="HTSAPCRAPGEASFPGEPGRGAMMRDGPCPEEMVTFRDVAVVFSE
FT                   EELGLLDAAQRKLYHDVMLENFRNLLAVGCQSPNKMAPLDTTGIRCLPLGQLPCWQMTS
FT                   HDVNKLARAPEDGINTPGKGPHLLEQCHSSCHWGAEQPSQAPEDDGCLENLPSNHSSSS
FT                   DNQEFLSGRAQSSWSKAHFSERWNHEKHCPQTLVKTKSQLLAPGVNILGCISHHDHNIL
FT                   HKRDKVPSSGDCDQVIFPMTLLTQHCVYREQKAYQCSRGQEVFSDSPSLELHQQTLLGK
FT                   KSPVHSTHKDTRHSPSVPIQPSVHPGRKRYWCHECGKGFRQSSALQTHQRVHTGEKPYR
FT                   CDSCGKGFSRSSDLNIHRRVHTGEKPYKCEVCGKGFTQWAHLQAHERIHTGEKPYKCGD
FT                   CGKRFSCSSNLHTHQRVHTEEKPYECNECGKRFSLSGNLDIHQRVHTGEKPYKCEECGK
FT                   GFSSASSFQSHQRVHTGEKPFHCSVCGKNFSRSSHFLDHQRIHTGEKPYRCEVCGKRFP
FT                   WSLSLHSHQSVHTGKNRINVGSVGKASVMPPVCRPITVSTPVKNHSNAMFARSSSARPQ
FT                   TSMPTRGFTQGRSPTNATRVGKPSARSPVSKSIREFTLGRSRSSVRSVGRNSDGAWG"
FT   assembly_gap    879494..880855
FT                   /estimated_length=1362
FT                   /gap_type="unknown"
FT   assembly_gap    894976..896211
FT                   /estimated_length=1236
FT                   /gap_type="unknown"
FT   gene            complement(900037..908583)
FT                   /gene="Zfp61"
FT                   /locus_tag="mCG_22847"
FT                   /note="gene_id=mCG22847.1"
FT   mRNA            complement(join(900037..901495,902335..902424,
FT                   903945..904071,904969..905014,906563..906728,
FT                   907264..907365,908183..908583))
FT                   /gene="Zfp61"
FT                   /locus_tag="mCG_22847"
FT                   /product="zinc finger protein 61"
FT                   /note="gene_id=mCG22847.1 transcript_id=mCT23836.1 created
FT                   on 08-AUG-2002"
FT   CDS             complement(join(900048..901495,902335..902424,
FT                   903945..904071,904969..904971))
FT                   /codon_start=1
FT                   /gene="Zfp61"
FT                   /locus_tag="mCG_22847"
FT                   /product="zinc finger protein 61"
FT                   /note="gene_id=mCG22847.1 transcript_id=mCT23836.1
FT                   protein_id=mCP15744.2"
FT                   /db_xref="GOA:Q923D1"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:99663"
FT                   /db_xref="UniProtKB/TrEMBL:Q923D1"
FT                   /protein_id="EDL24347.1"
FT                   /translation="MEAVTFKDVAVVFTKEEFRLLDSAQRTLYQDVMVENFRNLLSVEY
FT                   QLFKRDKPYLEREEKPQMRRAAPRERDSGINGQSARGAVRGRGSPEALPCWQIWQWVTD
FT                   DLTTSQNSVVNTPQLQGKAPCQSRPRPSAPVSVDENYIKSHTISVPIHSGRPPLPTLRA
FT                   QGTSLTERQTRKDQYHQGSHRDEAGQRKRDAHPTSWIPRPRSDHRVCKSKGRCSPSDHG
FT                   RDGVEVVPFDQNGGIHTRQKSSQHREAVTDLSSSDPHQVLDSGGRACACVECGRGSPCG
FT                   TDGCIHQGGRTGEERKEFGHQRVCTPVKPYTCEQCGKVFTCRSALNVHVKVHTRERPYN
FT                   CETCGSAFSQASHLQDHQRLHTGEKPFKCDACGKSFSRSSHLRSHQRVHTGEKPYKCGE
FT                   CGKSFICSSNLYIHQRVHTGEKPYKCVDCGKEFSRPSSLQAHQGIHTGEKSYVCTMCGK
FT                   GYTLNSNLQVHLRVHTGEKPYSCDVCGKGFSRSSQLQSHQRVHTGEKPYKCDVCGKSFG
FT                   WRSNLIIHHRIHSSGKPYKSKRDDKNIKESTQEKCSIK"
FT   gene            complement(910786..925600)
FT                   /gene="Zfp94"
FT                   /locus_tag="mCG_22846"
FT                   /note="gene_id=mCG22846.1"
FT   mRNA            complement(join(910786..912863,918068..918194,
FT                   921375..921488,923343..923404,925512..925600))
FT                   /gene="Zfp94"
FT                   /locus_tag="mCG_22846"
FT                   /product="zinc finger protein 94"
FT                   /note="gene_id=mCG22846.1 transcript_id=mCT23835.1 created
FT                   on 08-AUG-2002"
FT   CDS             complement(join(911545..912863,918068..918191))
FT                   /codon_start=1
FT                   /gene="Zfp94"
FT                   /locus_tag="mCG_22846"
FT                   /product="zinc finger protein 94"
FT                   /note="gene_id=mCG22846.1 transcript_id=mCT23835.1
FT                   protein_id=mCP15736.2"
FT                   /db_xref="GOA:Q61117"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR026613"
FT                   /db_xref="MGI:MGI:107610"
FT                   /db_xref="UniProtKB/TrEMBL:Q61117"
FT                   /protein_id="EDL24346.1"
FT                   /translation="MVTFRDVAVVFSEEELGLLDAAQRKLYHDVMLENFRMLLSVGDKN
FT                   PEEMESLEEVGLRHLSHEALFCSQIWQQVSRDLMKAGDCRVSIRETGSPLKRDDAHGAD
FT                   RKYSKHSGQKPWLQLHCGTDGGEEPYREERSEKDSWDSPLQANGRPPAGEKRYRCEKCD
FT                   HAFCRLSGLQAHQVRHTGEKPYKCEECGKGFTRASTLLDHQRGHTGNKPYQCHACWKSF
FT                   CHSSEFNNHIRVHTGEKPYVCEECGKGFSQASHLLAHQRGHTGEKPYKCSTCGKGFSRS
FT                   SDLNVHCRIHTGEKPYKCETCGKAFSRVSILQVHQRVHSEDKPYQCAECGRGFTVESHL
FT                   QAHQRSHTGERPYQCEECGRGFCRASNFLAHRGVHTGEKPYRCDICGKRFRQRSYLHDH
FT                   HRIHTGEKPYKCEECGKVFSWSSYLKAHQRVHTGEKPYRCEECGKGFSWSSSLLIHQRA
FT                   HAEDEGRKDLPASEGSQGKQTL"
FT   gene            927385..927939
FT                   /pseudo
FT                   /locus_tag="mCG_1031268"
FT                   /note="gene_id=mCG1031268.1"
FT   mRNA            927385..927939
FT                   /pseudo
FT                   /locus_tag="mCG_1031268"
FT                   /note="gene_id=mCG1031268.1 transcript_id=mCT148972.1
FT                   created on 11-FEB-2003"
FT   gene            complement(929000..930336)
FT                   /pseudo
FT                   /locus_tag="mCG_1031267"
FT                   /note="gene_id=mCG1031267.1"
FT   mRNA            complement(join(929000..929235,930225..930336))
FT                   /pseudo
FT                   /locus_tag="mCG_1031267"
FT                   /note="gene_id=mCG1031267.1 transcript_id=mCT148971.1
FT                   created on 07-FEB-2003"
FT   gene            complement(942089..942946)
FT                   /gene="1700008P20Rik"
FT                   /locus_tag="mCG_126291"
FT                   /note="gene_id=mCG126291.0"
FT   mRNA            complement(942089..942946)
FT                   /gene="1700008P20Rik"
FT                   /locus_tag="mCG_126291"
FT                   /product="RIKEN cDNA 1700008P20"
FT                   /note="gene_id=mCG126291.0 transcript_id=mCT127558.0
FT                   created on 08-AUG-2002"
FT   CDS             complement(942210..942905)
FT                   /codon_start=1
FT                   /gene="1700008P20Rik"
FT                   /locus_tag="mCG_126291"
FT                   /product="RIKEN cDNA 1700008P20"
FT                   /note="gene_id=mCG126291.0 transcript_id=mCT127558.0
FT                   protein_id=mCP57647.1"
FT                   /db_xref="GOA:Q9DAJ7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1916551"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAJ7"
FT                   /protein_id="EDL24345.1"
FT                   /translation="MGASLSSKEEWERESRTDLWWAHIQEVLNKCDFSWEQIKQLHQRF
FT                   RLLSGDQPTLQPESFDNILDLEFNPIRSRIVRAFFDNRNLGKGTSGLAEEITFQDFLTI
FT                   ISYFRPLRPSLNKEEAEQNRKDKMRFLFNMYDQDGDGIITLQEYRRVVESLLSAHPQVE
FT                   RDTVRSVANAIAQGALKEAARASDQPLMAGQQYEGITFEDFVKTWKSLELEVKMQVSFL
FT                   NLEATVLCQ"
FT   assembly_gap    943430..943576
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    945715..945734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    949298..949317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    950486..950505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    952629..957609
FT                   /estimated_length=4981
FT                   /gap_type="unknown"
FT   gene            <959017..961749
FT                   /locus_tag="mCG_22843"
FT                   /note="gene_id=mCG22843.1"
FT   mRNA            join(<959017..959152,959949..960125,960457..960603,
FT                   960931..961749)
FT                   /locus_tag="mCG_22843"
FT                   /product="mCG22843"
FT                   /note="gene_id=mCG22843.1 transcript_id=mCT23832.1 created
FT                   on 13-AUG-2002"
FT   CDS             join(<959017..959152,959949..960125,960457..960603,
FT                   960931..961190)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22843"
FT                   /product="mCG22843"
FT                   /note="gene_id=mCG22843.1 transcript_id=mCT23832.1
FT                   protein_id=mCP15707.1"
FT                   /protein_id="EDL24344.1"
FT                   /translation="LLGSQALQCYSYEHTYFGPFDLSAVKLPSVSCPEGCSEVVLSLDT
FT                   GYRSLVTMVRKGCWTGPTTGPMQTNQDALPPDYAVVRGCATDYCNSNLKTHDALPNLSQ
FT                   APNPQTLSGTECYACLGTHPEDCSPEKSRRVQCHQDQSACFQGNGRMNIGNFSVPVYIR
FT                   TCHRPSCTTMGTTSPWTSIDLQGYCCEGHLCNRASVTQILPGTMSSAPPRAPRILTLLT
FT                   AAPLLAIALGASVGFPA"
FT   assembly_gap    971422..971441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            980816..995560
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /note="gene_id=mCG22845.2"
FT   mRNA            join(980816..981151,985100..985263,985306..985597,
FT                   989505..989640,992002..992112,992512..992630,
FT                   992822..992891,994359..994532,995072..995558)
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 4,
FT                   transcript variant mCT171746"
FT                   /note="gene_id=mCG22845.2 transcript_id=mCT171746.0 created
FT                   on 08-AUG-2002"
FT   mRNA            join(980817..981151,985100..985195,987711..988132,
FT                   989505..989640,992002..992112,992512..992630,
FT                   992822..992891,994359..994532,995072..995558)
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 4,
FT                   transcript variant mCT23834"
FT                   /note="gene_id=mCG22845.2 transcript_id=mCT23834.2 created
FT                   on 08-AUG-2002"
FT   mRNA            join(980860..981046,992047..992112,992512..992630,
FT                   992822..992891,994359..994532,995072..995560)
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 4,
FT                   transcript variant mCT171748"
FT                   /note="gene_id=mCG22845.2 transcript_id=mCT171748.0 created
FT                   on 08-AUG-2002"
FT   mRNA            join(980894..981151,985100..985195,994464..994532,
FT                   995072..995109)
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 4,
FT                   transcript variant mCT171747"
FT                   /note="gene_id=mCG22845.2 transcript_id=mCT171747.0 created
FT                   on 08-AUG-2002"
FT   CDS             join(980993..981151,985100..985195,987711..988132,
FT                   989505..989640,992002..992112,992512..992630,
FT                   992822..992891,994359..994523)
FT                   /codon_start=1
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG22845.2 transcript_id=mCT23834.2
FT                   protein_id=mCP15731.2 isoform=CRA_c"
FT                   /protein_id="EDL24342.1"
FT                   /translation="MGGELVTGLGALRRRKRLLEQEKRVAGWALVLAGTGIGLMVLHAE
FT                   MLWFLGCKWVLYLLLVKCLITLSTAFLLCLIVVFHAKEVQLFMTDNGLRDWRVALTRRQ
FT                   VAQILLELLVCGVHPVPLRSPHCALAGEATDAQPWPGFLGEGEALLSLAMLLRLYLVPR
FT                   AVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLS
FT                   VAERQAVNATGHLTDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVA
FT                   VVARKLEFNKAEKHVHNFMMDIHYAKEMKESAARLLQEAWMYYKHTRRKDSRAARRHQR
FT                   KMLAAIHTFRQVRLKHRKLREQVNSMVDISKMHMILCDLQLGLSSSHRALEKRIDGLAG
FT                   KLDALTELLGTALQQQQLPEPSQEAT"
FT   CDS             join(980993..981151,985100..985195,994464..994523)
FT                   /codon_start=1
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22845.2 transcript_id=mCT171747.0
FT                   protein_id=mCP94665.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0U1RP82"
FT                   /db_xref="InterPro:IPR015449"
FT                   /db_xref="MGI:MGI:1277957"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RP82"
FT                   /protein_id="EDL24341.1"
FT                   /translation="MGGELVTGLGALRRRKRLLEQEKRVAGWALVLAGTGIGLMVLHAE
FT                   MLWFLGCKWVLYLLLVKCLITLSTAFLLCLIVVFHAKEVQLLGTALQQQQLPEPSQEAT
FT                   "
FT   CDS             join(980993..981046,992047..992112,992512..992630,
FT                   992822..992891,994359..994523)
FT                   /codon_start=1
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 4, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG22845.2 transcript_id=mCT171748.0
FT                   protein_id=mCP94666.0 isoform=CRA_d"
FT                   /protein_id="EDL24343.1"
FT                   /translation="MGGELVTGLGALRRRKRLLEFNKAEKHVHNFMMDIHYAKEMKESA
FT                   ARLLQEAWMYYKHTRRKDSRAARRHQRKMLAAIHTFRQVRLKHRKLREQVNSMVDISKM
FT                   HMILCDLQLGLSSSHRALEKRIDGLAGKLDALTELLGTALQQQQLPEPSQEAT"
FT   CDS             join(989602..989640,992002..992112,992512..992630,
FT                   992822..992891,994359..994523)
FT                   /codon_start=1
FT                   /gene="Kcnn4"
FT                   /locus_tag="mCG_22845"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22845.2 transcript_id=mCT171746.0
FT                   protein_id=mCP94667.0 isoform=CRA_a"
FT                   /db_xref="GOA:D1MQ07"
FT                   /db_xref="InterPro:IPR004178"
FT                   /db_xref="InterPro:IPR015449"
FT                   /db_xref="MGI:MGI:1277957"
FT                   /db_xref="UniProtKB/TrEMBL:D1MQ07"
FT                   /protein_id="EDL24340.1"
FT                   /translation="MWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFMMDI
FT                   HYAKEMKESAARLLQEAWMYYKHTRRKDSRAARRHQRKMLAAIHTFRQVRLKHRKLREQ
FT                   VNSMVDISKMHMILCDLQLGLSSSHRALEKRIDGLAGKLDALTELLGTALQQQQLPEPS
FT                   QEAT"
FT   gene            1010080..1033197
FT                   /gene="1500002O20Rik"
FT                   /locus_tag="mCG_22842"
FT                   /note="gene_id=mCG22842.1"
FT   mRNA            join(1010080..1010343,1013844..1013999,1015979..1016053,
FT                   1016140..1016404,1016487..1016584,1017973..1018085,
FT                   1025390..1025501,1026950..1027045,1027340..1027425,
FT                   1030432..1030538,1030994..1031101,1031231..1031359,
FT                   1031538..1031682,1032718..1033197)
FT                   /gene="1500002O20Rik"
FT                   /locus_tag="mCG_22842"
FT                   /product="RIKEN cDNA 1500002O20"
FT                   /note="gene_id=mCG22842.1 transcript_id=mCT23831.1 created
FT                   on 13-AUG-2002"
FT   CDS             join(1013850..1013999,1015979..1016053,1016140..1016404,
FT                   1016487..1016584,1017973..1018085,1025390..1025501,
FT                   1026950..1027045,1027340..1027425,1030432..1030538,
FT                   1030994..1031101,1031231..1031359,1031538..1031682,
FT                   1032718..1032796)
FT                   /codon_start=1
FT                   /gene="1500002O20Rik"
FT                   /locus_tag="mCG_22842"
FT                   /product="RIKEN cDNA 1500002O20"
FT                   /note="gene_id=mCG22842.1 transcript_id=mCT23831.1
FT                   protein_id=mCP15754.2"
FT                   /protein_id="EDL24339.1"
FT                   /translation="MSESGHSQPGLYGIERRRRWKEPGSSGPQNLSGPGGRERDYIAPW
FT                   ERERRDGSEDPSTNVMQKTPIILSKPPAERSKQPPPSTAPAAPPAPAPLEKPIVLMKPR
FT                   EEGKGPVAGTGASTPEGTAPPPPTAPAPPKGEKEGQRPTQPVYQIQNRGMGTAAPTAMD
FT                   PVVGQAKLLPPERMKHSIKLVDDQMNWCDSAIEYLLDQTDVLVVGVLGLQGTGKSMVMS
FT                   LLSANTPEEDQRAYVFRAQSAEMKERGGNQTSGIDFFITQERIVFLDTQPILSPSILDH
FT                   LINNDRKLPPEYNLPHTYVEMQSLQIAAFLFTVCHVVIVVQDWFTDLSLYRFLQTAEMV
FT                   KPSTPSPSHESSSSAGSDEGTEYYPHLVFLQNKARREDFCPRKLRQMHLMIDQLMAHSH
FT                   LRYKGTLSMLQCNVFPGLPPDFLDAEVNLFLVPFMDSEAENENPPRAGPGSSPLFSLLP
FT                   GYRGHPSFQSLVSKLRSQVMSMARPQLSHTILTEKNWFHYAARIWDGVKKSSALAEYSR
FT                   LLA"
FT   gene            complement(1042354..1045963)
FT                   /locus_tag="mCG_22844"
FT                   /note="gene_id=mCG22844.1"
FT   mRNA            complement(join(1042354..1043873,1045751..1045963))
FT                   /locus_tag="mCG_22844"
FT                   /product="mCG22844"
FT                   /note="gene_id=mCG22844.1 transcript_id=mCT23833.1 created
FT                   on 13-AUG-2002"
FT   CDS             complement(1042426..1043817)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22844"
FT                   /product="mCG22844"
FT                   /note="gene_id=mCG22844.1 transcript_id=mCT23833.1
FT                   protein_id=mCP15730.1"
FT                   /db_xref="GOA:D3Z720"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030385"
FT                   /db_xref="MGI:MGI:2685948"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z720"
FT                   /protein_id="EDL24338.1"
FT                   /translation="MATSRLPAVPEETTILMAKEELEALRTAFESGDIPQAASRLRELL
FT                   ANSETTRLEVGVTGESGAGKSSLINALRGLGAEDPGAALTGVVETTMQPSPYPHPQFPD
FT                   VTLWDLPGAGSPGCSADKYLKQVDFGRYDFFLLVSPRRCGAVESRLASEILRQGKKFYF
FT                   VRTKVDEDLAATRSQRPSGFSEAAVLQEIRDHCTERLRVAGVNDPRIFLVSNLSPTRYD
FT                   FPMLVTTWEHDLPAHRRHAGLLSLPDISLEALQKKKDMLQEQVLKTALVSGVIQALPVP
FT                   GLAAAYDDALLIRSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPET
FT                   VLRLYSQSSDGAMRVARAFERGIPVFGTLVAGGISFGTVYTMLQGCLNEMAEDAQRVRI
FT                   KALEEDEPQGGEVSLEAAGDNLVEKRSTGEGTSEEAPLSTRRKLGLLLKYILDSWKRRD
FT                   LSEDK"
FT   assembly_gap    1054920..1058469
FT                   /estimated_length=3550
FT                   /gap_type="unknown"
FT   assembly_gap    1061365..1061384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1062582..1076123
FT                   /gene="Plaur"
FT                   /locus_tag="mCG_7264"
FT                   /note="gene_id=mCG7264.2"
FT   mRNA            join(1062582..1062721,1065285..1065395,1066829..1066972,
FT                   1072054..1072862,1074365..1074511,1075395..1076123)
FT                   /gene="Plaur"
FT                   /locus_tag="mCG_7264"
FT                   /product="plasminogen activator, urokinase receptor,
FT                   transcript variant mCT171760"
FT                   /note="gene_id=mCG7264.2 transcript_id=mCT171760.0 created
FT                   on 08-AUG-2002"
FT   mRNA            join(1062582..1062721,1065285..1065395,1066829..1066972,
FT                   1072054..1072427,1072728..1072862,1074365..1074511,
FT                   1075395..1076123)
FT                   /gene="Plaur"
FT                   /locus_tag="mCG_7264"
FT                   /product="plasminogen activator, urokinase receptor,
FT                   transcript variant mCT171761"
FT                   /note="gene_id=mCG7264.2 transcript_id=mCT171761.0 created
FT                   on 08-AUG-2002"
FT   mRNA            join(1062582..1062721,1065285..1065395,1066829..1066972,
FT                   1072054..1072209,1072728..1072862,1074365..1074511,
FT                   1075395..1076123)
FT                   /gene="Plaur"
FT                   /locus_tag="mCG_7264"
FT                   /product="plasminogen activator, urokinase receptor,
FT                   transcript variant mCT3672"
FT                   /note="gene_id=mCG7264.2 transcript_id=mCT3672.1 created on
FT                   08-AUG-2002"
FT   CDS             join(1062664..1062721,1065285..1065395,1066829..1066972,
FT                   1072054..1072209,1072728..1072862,1074365..1074511,
FT                   1075395..1075627)
FT                   /codon_start=1
FT                   /gene="Plaur"
FT                   /locus_tag="mCG_7264"
FT                   /product="plasminogen activator, urokinase receptor,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7264.2 transcript_id=mCT3672.1
FT                   protein_id=mCP15739.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q545X5"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="InterPro:IPR018363"
FT                   /db_xref="InterPro:IPR033084"
FT                   /db_xref="MGI:MGI:97612"
FT                   /db_xref="UniProtKB/TrEMBL:Q545X5"
FT                   /protein_id="EDL24337.1"
FT                   /translation="MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQD
FT                   LCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRP
FT                   GARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDED
FT                   YTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNN
FT                   TLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHL
FT                   NVSVSCCHGSGCNSPTGGAPRPGPAQLSLIASLLLTLGLWGVLLWT"
FT   CDS             join(1062664..1062721,1065285..1065395,1066829..1066972,
FT                   1072054..1072409)
FT                   /codon_start=1
FT                   /gene="Plaur"
FT                   /locus_tag="mCG_7264"
FT                   /product="plasminogen activator, urokinase receptor,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7264.2 transcript_id=mCT171761.0
FT                   protein_id=mCP94679.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0U1RNN0"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="InterPro:IPR018363"
FT                   /db_xref="InterPro:IPR033084"
FT                   /db_xref="MGI:MGI:97612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RNN0"
FT                   /protein_id="EDL24335.1"
FT                   /translation="MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQD
FT                   LCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRP
FT                   GARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTESKLPSAG
FT                   QLLVEIFKSWEQSASKRQLNPHTVTGPTFSVTGSSRSLDQLGSDQEPSYLIMSPILLSF
FT                   "
FT   CDS             join(1062664..1062721,1065285..1065395,1066829..1066972,
FT                   1072054..1072409)
FT                   /codon_start=1
FT                   /gene="Plaur"
FT                   /locus_tag="mCG_7264"
FT                   /product="plasminogen activator, urokinase receptor,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7264.2 transcript_id=mCT171760.0
FT                   protein_id=mCP94680.0 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0U1RNN0"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="InterPro:IPR018363"
FT                   /db_xref="InterPro:IPR033084"
FT                   /db_xref="MGI:MGI:97612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RNN0"
FT                   /protein_id="EDL24336.1"
FT                   /translation="MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQD
FT                   LCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRP
FT                   GARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTESKLPSAG
FT                   QLLVEIFKSWEQSASKRQLNPHTVTGPTFSVTGSSRSLDQLGSDQEPSYLIMSPILLSF
FT                   "
FT   gene            <1082248..1103896
FT                   /gene="Igsf4c"
FT                   /locus_tag="mCG_7253"
FT                   /note="gene_id=mCG7253.2"
FT   mRNA            join(<1082248..1082311,1099312..1099458,1099669..1099821,
FT                   1100079..1100213,1100631..1100795,1100887..1100977,
FT                   1101720..1101892,1102821..1102949,1103666..1103896)
FT                   /gene="Igsf4c"
FT                   /locus_tag="mCG_7253"
FT                   /product="immunoglobulin superfamily, member 4C"
FT                   /note="gene_id=mCG7253.2 transcript_id=mCT3692.2 created on
FT                   13-AUG-2002"
FT   CDS             join(1082248..1082311,1099312..1099458,1099669..1099821,
FT                   1100079..1100213,1100631..1100795,1100887..1100977,
FT                   1101720..1101892,1102821..1102949,1103666..1103775)
FT                   /codon_start=1
FT                   /gene="Igsf4c"
FT                   /locus_tag="mCG_7253"
FT                   /product="immunoglobulin superfamily, member 4C"
FT                   /note="gene_id=mCG7253.2 transcript_id=mCT3692.2
FT                   protein_id=mCP15711.1"
FT                   /protein_id="EDL24334.1"
FT                   /translation="MGRARRFQWPLLLLWAAAAGPGTGQEVQTENVTVAEGGVAEITCR
FT                   LHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFC
FT                   QLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVPRSRPAAVLRWYRDRK
FT                   ELKGVSSGQENGKVWSVASTVRFRVDRKDDGGIVICEAQNQALPSGHSKQTQYVLDVQY
FT                   SPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGL
FT                   VSADNGTYTCEAANKHGHARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICV
FT                   LVGMVWCSVRQKGSYLTHEASGLDEQGEAREAFLNGGDGHKRKEEFFI"
FT   assembly_gap    1082573..1082592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1107161..1115841
FT                   /gene="Zfp428"
FT                   /locus_tag="mCG_7255"
FT                   /note="gene_id=mCG7255.1"
FT   mRNA            join(1107161..1107590,1110703..1110910,1115233..1115841)
FT                   /gene="Zfp428"
FT                   /locus_tag="mCG_7255"
FT                   /product="zinc finger protein 428, transcript variant
FT                   mCT3685"
FT                   /note="gene_id=mCG7255.1 transcript_id=mCT3685.2 created on
FT                   13-AUG-2002"
FT   mRNA            join(<1107284..1107590,1110703..1110910,1115194..1115821)
FT                   /gene="Zfp428"
FT                   /locus_tag="mCG_7255"
FT                   /product="zinc finger protein 428, transcript variant
FT                   mCT191944"
FT                   /note="gene_id=mCG7255.1 transcript_id=mCT191944.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1110760..1110910,1115194..1115687)
FT                   /codon_start=1
FT                   /gene="Zfp428"
FT                   /locus_tag="mCG_7255"
FT                   /product="zinc finger protein 428, isoform CRA_a"
FT                   /note="gene_id=mCG7255.1 transcript_id=mCT191944.0
FT                   protein_id=mCP112858.0 isoform=CRA_a"
FT                   /protein_id="EDL24332.1"
FT                   /translation="PRESWPGRDPAQSLLCSCLLSPPPAMTETREPTETGGYASLEEDD
FT                   EDLSPGPEHSSDSEYTLSEPDSEEEEEEEEEETTDDPEYDPGYKVKQRIGGGRGGPSRR
FT                   APRATQPAGPPAQPCQLCGRSALGEAPPGTPPCRLCCPATATQEAPGPESRALGEEEEE
FT                   PSRTGETRPAGRDGDEDEEEGGTYHCTECEDSFDNLGELHGHFMLHARGEV"
FT   CDS             join(1110835..1110910,1115233..1115687)
FT                   /codon_start=1
FT                   /gene="Zfp428"
FT                   /locus_tag="mCG_7255"
FT                   /product="zinc finger protein 428, isoform CRA_b"
FT                   /note="gene_id=mCG7255.1 transcript_id=mCT3685.2
FT                   protein_id=mCP15719.2 isoform=CRA_b"
FT                   /protein_id="EDL24333.1"
FT                   /translation="MTETREPTETGGYASLEEDDEDLSPEPDSEEEEEEEEEETTDDPE
FT                   YDPGYKVKQRIGGGRGGPSRRAPRATQPAGPPAQPCQLCGRSALGEAPPGTPPCRLCCP
FT                   ATATQEAPGPESRALGEEEEEPSRTGETRPAGRDGDEDEEEGGTYHCTECEDSFDNLGE
FT                   LHGHFMLHARGEV"
FT   gene            <1130897..1135003
FT                   /gene="Irgq"
FT                   /locus_tag="mCG_145388"
FT                   /note="gene_id=mCG145388.0"
FT   mRNA            join(<1130897..1131063,1131543..1132074,1133425..1135003)
FT                   /gene="Irgq"
FT                   /locus_tag="mCG_145388"
FT                   /product="immunity-related GTPase family, Q, transcript
FT                   variant mCT184812"
FT                   /note="gene_id=mCG145388.0 transcript_id=mCT184812.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<1130955..1131063,1131543..1132074,1133425..1134646)
FT                   /codon_start=1
FT                   /gene="Irgq"
FT                   /locus_tag="mCG_145388"
FT                   /product="immunity-related GTPase family, Q, isoform CRA_a"
FT                   /note="gene_id=mCG145388.0 transcript_id=mCT184812.0
FT                   protein_id=mCP105749.0 isoform=CRA_a"
FT                   /protein_id="EDL24330.1"
FT                   /translation="RSPDVSKSGHSCPFSLRQLVLRGWASVLSRRVTSLIAMPLPQGDV
FT                   TALFLGPPGSGKSALIAALCGKNVDTVEIPDGRQDSGVPSLRAAAPGLFLGELSCPPAA
FT                   PGPWAAEANLLVLVLPGSEGSEEPLTPALGEAARAALARGTPLLAVRNLRPGDSQNAAK
FT                   ARDETAALLNSAGLGAAPLFVPPADCSSSDRCEELERLQVVLRTQAEALQRLLPPAQDG
FT                   FEVLGAAELEAVREAFETGGLEAALSWVRAGLERLGSARLDLAVAGTTNVGLVLDMLLG
FT                   LDPGDPGAAPASAPTGPTPYPAPERPNVVLWTVPLGPTATSPAVTPHPTHYDALILVTP
FT                   GAPTEENWAQVRSLVSPDAPLVGVRTDGQGEDPPEVLEEEKAQNASDGNSGDARSEGKK
FT                   AGIGDSGCTAARSPEDELWEVLEEAPPPVFPMRPGGLPGLGTWLQHALPTAQAGALLLA
FT                   LPPASPRAARRKAAALRAGAWRPALLASLAAAAAPVPGLGWACDVALLRGQLAEWRRAL
FT                   GLEPAAVARRERALGLAPGVLATRTRFPGPVTRAEVEARLGSWAGEGTAGGAALSALSF
FT                   LWPTGGAAATGGLGYRAAHGVLLQALDEMLADAEAVLGPPEPNQ"
FT   mRNA            join(<1131497..1132074,1133425..1134997)
FT                   /gene="Irgq"
FT                   /locus_tag="mCG_145388"
FT                   /product="immunity-related GTPase family, Q, transcript
FT                   variant mCT191911"
FT                   /note="gene_id=mCG145388.0 transcript_id=mCT191911.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1131512..1132074,1133425..1134646)
FT                   /codon_start=1
FT                   /gene="Irgq"
FT                   /locus_tag="mCG_145388"
FT                   /product="immunity-related GTPase family, Q, isoform CRA_b"
FT                   /note="gene_id=mCG145388.0 transcript_id=mCT191911.0
FT                   protein_id=mCP112883.0 isoform=CRA_b"
FT                   /protein_id="EDL24331.1"
FT                   /translation="PISFPASCFPAMPLPQGDVTALFLGPPGSGKSALIAALCGKNVDT
FT                   VEIPDGRQDSGVPSLRAAAPGLFLGELSCPPAAPGPWAAEANLLVLVLPGSEGSEEPLT
FT                   PALGEAARAALARGTPLLAVRNLRPGDSQNAAKARDETAALLNSAGLGAAPLFVPPADC
FT                   SSSDRCEELERLQVVLRTQAEALQRLLPPAQDGFEVLGAAELEAVREAFETGGLEAALS
FT                   WVRAGLERLGSARLDLAVAGTTNVGLVLDMLLGLDPGDPGAAPASAPTGPTPYPAPERP
FT                   NVVLWTVPLGPTATSPAVTPHPTHYDALILVTPGAPTEENWAQVRSLVSPDAPLVGVRT
FT                   DGQGEDPPEVLEEEKAQNASDGNSGDARSEGKKAGIGDSGCTAARSPEDELWEVLEEAP
FT                   PPVFPMRPGGLPGLGTWLQHALPTAQAGALLLALPPASPRAARRKAAALRAGAWRPALL
FT                   ASLAAAAAPVPGLGWACDVALLRGQLAEWRRALGLEPAAVARRERALGLAPGVLATRTR
FT                   FPGPVTRAEVEARLGSWAGEGTAGGAALSALSFLWPTGGAAATGGLGYRAAHGVLLQAL
FT                   DEMLADAEAVLGPPEPNQ"
FT   gene            complement(1141815..1146172)
FT                   /locus_tag="mCG_7273"
FT                   /note="gene_id=mCG7273.1"
FT   mRNA            complement(join(1141815..1142050,1142275..1142418,
FT                   1142600..1142752,1145097..1145213,1146090..1146172))
FT                   /locus_tag="mCG_7273"
FT                   /product="mCG7273"
FT                   /note="gene_id=mCG7273.1 transcript_id=mCT3666.0 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(1141896..1142050,1142275..1142418,
FT                   1142600..1142752,1145097..1145213,1146090..1146159))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7273"
FT                   /product="mCG7273"
FT                   /note="gene_id=mCG7273.1 transcript_id=mCT3666.0
FT                   protein_id=mCP15738.1"
FT                   /db_xref="GOA:B2RSX2"
FT                   /db_xref="InterPro:IPR004126"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:3615324"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSX2"
FT                   /protein_id="EDL24329.1"
FT                   /translation="MILFRRHRTFLLAFTLLCTLLGLGCPLTCEVCKGSGHTCSGKMKT
FT                   CEDGKDACVVLVSESSTKGRKSVNTFKACMKYKDCYSGFVSTTMTPSDYMVSNAHCCQS
FT                   DGCNSGSVPPPLNNRTENGLMCPSCIAPFQETCPGTQAARCVGRETHCIYFAGNVQAGI
FT                   IHTKFATRGCATESACHTKAGAEVPSAFYLYFLRRADCLPAPYPPGRGE"
FT   gene            1147347..1173598
FT                   /gene="Xrcc1"
FT                   /locus_tag="mCG_7256"
FT                   /note="gene_id=mCG7256.1"
FT   mRNA            join(1147347..1147525,1147955..1148047,1159900..1160016,
FT                   1165699..1165857,1166382..1166456,1166552..1166663,
FT                   1167021..1167130,1167202..1167307,1167477..1167735,
FT                   1167973..1168089,1170379..1170472,1170612..1170741,
FT                   1171035..1171089,1171178..1171314,1172372..1172462,
FT                   1173217..1173292,1173388..1173598)
FT                   /gene="Xrcc1"
FT                   /locus_tag="mCG_7256"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 1, transcript variant mCT3682"
FT                   /note="gene_id=mCG7256.1 transcript_id=mCT3682.1 created on
FT                   08-AUG-2002"
FT   mRNA            join(1147347..1147525,1147955..1148047,1159900..1160016,
FT                   1165699..1165857,1166382..1166456,1166552..1166663,
FT                   1167021..1167130,1167202..1167307,1167477..1167735,
FT                   1167973..1168089,1170379..1170472,1170612..1170741,
FT                   1171035..1171089,1172372..1172462,1173217..1173292,
FT                   1173388..1173598)
FT                   /gene="Xrcc1"
FT                   /locus_tag="mCG_7256"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 1, transcript variant mCT171757"
FT                   /note="gene_id=mCG7256.1 transcript_id=mCT171757.0 created
FT                   on 08-AUG-2002"
FT   CDS             join(1147475..1147525,1147955..1148047,1159900..1160016,
FT                   1165699..1165857,1166382..1166456,1166552..1166663,
FT                   1167021..1167130,1167202..1167307,1167477..1167735,
FT                   1167973..1168089,1170379..1170472,1170612..1170741,
FT                   1171035..1171089,1171178..1171314,1172372..1172462,
FT                   1173217..1173292,1173388..1173501)
FT                   /codon_start=1
FT                   /gene="Xrcc1"
FT                   /locus_tag="mCG_7256"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 1, isoform CRA_b"
FT                   /note="gene_id=mCG7256.1 transcript_id=mCT3682.1
FT                   protein_id=mCP15726.2 isoform=CRA_b"
FT                   /protein_id="EDL24328.1"
FT                   /translation="MPEISLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISV
FT                   VLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGATAGEQDYEVLLVTSSFMSPSESRSG
FT                   SNPNRVRIFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPYGLSFVKFHSPPDKDEAEAT
FT                   SQKVTVTKLGQFRVKEEDDSANSLKPGALFFSRINKTSSASTSDPAGPSYAAATLQASS
FT                   AASSASPVPKVVGSSSKPQEPPKGKRKLDLSLEDRKPPSKPSAGPSTLKRPKLSVPSRT
FT                   PAAAPASTPAQRAVPGKPRGEGTEPRGARTGPQELGKILQGVVVVLSGFQNPFRSELRD
FT                   KALELGAKYRPDWTPDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHHMRRRLPSR
FT                   RYLMAGLGSSSEDEGDSHSESGEDEAPKLPQKRPQPKAKTQAAGPSSPPRPPTPKETKA
FT                   PSPGPQDNSDTEGEESEGRDNGAEDSGDTEDELRRVAKQREQRQPPAPEENGEDPYAGS
FT                   TDENTDSETPSEADLPIPELPDFFEGKHFFLYGEFPGDERRRLIRYVTAFNGELEDYMN
FT                   ERVQFVITAQEWDPNFEEALMENPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA"
FT   CDS             join(1147475..1147525,1147955..1148047,1159900..1160016,
FT                   1165699..1165857,1166382..1166456,1166552..1166663,
FT                   1167021..1167130,1167202..1167307,1167477..1167735,
FT                   1167973..1168089,1170379..1170472,1170612..1170741,
FT                   1171035..1171089,1172372..1172423)
FT                   /codon_start=1
FT                   /gene="Xrcc1"
FT                   /locus_tag="mCG_7256"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 1, isoform CRA_a"
FT                   /note="gene_id=mCG7256.1 transcript_id=mCT171757.0
FT                   protein_id=mCP94676.0 isoform=CRA_a"
FT                   /protein_id="EDL24327.1"
FT                   /translation="MPEISLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISV
FT                   VLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGATAGEQDYEVLLVTSSFMSPSESRSG
FT                   SNPNRVRIFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPYGLSFVKFHSPPDKDEAEAT
FT                   SQKVTVTKLGQFRVKEEDDSANSLKPGALFFSRINKTSSASTSDPAGPSYAAATLQASS
FT                   AASSASPVPKVVGSSSKPQEPPKGKRKLDLSLEDRKPPSKPSAGPSTLKRPKLSVPSRT
FT                   PAAAPASTPAQRAVPGKPRGEGTEPRGARTGPQELGKILQGVVVVLSGFQNPFRSELRD
FT                   KALELGAKYRPDWTPDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHHMRRRLPSR
FT                   RYLMAGLGSSSEDEGDSHSESGEDEAPKLPQKRPQPKAKTQAAGPSSPPRPPTPKETKA
FT                   PSPGPQDNSDTEGEESEGRDNGAEDSGDTEDELRRLLRGQTLLPVWRVPWG"
FT   assembly_gap    1181673..1182413
FT                   /estimated_length=741
FT                   /gap_type="unknown"
FT   gene            complement(1185405..1187588)
FT                   /locus_tag="mCG_7277"
FT                   /note="gene_id=mCG7277.2"
FT   mRNA            complement(join(1185405..1186106,1186622..1186785,
FT                   1187126..1187210,1187419..1187588))
FT                   /locus_tag="mCG_7277"
FT                   /product="mCG7277"
FT                   /note="gene_id=mCG7277.2 transcript_id=mCT3661.2 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(1185463..1186106,1186622..1186697))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7277"
FT                   /product="mCG7277"
FT                   /note="gene_id=mCG7277.2 transcript_id=mCT3661.2
FT                   protein_id=mCP15727.2"
FT                   /db_xref="GOA:B2RX29"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:2141921"
FT                   /db_xref="UniProtKB/TrEMBL:B2RX29"
FT                   /protein_id="EDL24326.1"
FT                   /translation="MLGGSVKSEVRASEPSPTCQDPETKAPHQDLPRPNQPAASGSVPS
FT                   RPRRRPPPQRPHRCPDCPKAFSYPSKLATHRLAHGGTRPHPCPDCPKAFSYPSKLAAHR
FT                   LTHSGARPHSCPHCPKAFGHRSKLAAHLWTHAPARPYPCPDCPKSFCYPSKLAAHRHTH
FT                   HATDARPYPCPHCPKAFSFPSKLAAHRLCHDPPTAPSSQATGSHRCSSCNQAFGQRRLL
FT                   LVHQRSHHQSEGQGERE"
FT   gene            1193877..1208802
FT                   /gene="Ethe1"
FT                   /locus_tag="mCG_7250"
FT                   /note="gene_id=mCG7250.1"
FT   mRNA            join(1193877..1193979,1194386..1194530,1194968..1195116,
FT                   1206173..1206302,1207836..1207925,1208320..1208436,
FT                   1208691..1208802)
FT                   /gene="Ethe1"
FT                   /locus_tag="mCG_7250"
FT                   /product="ethylmalonic encephalopathy 1"
FT                   /note="gene_id=mCG7250.1 transcript_id=mCT3689.0 created on
FT                   08-AUG-2002"
FT   CDS             join(1193899..1193979,1194386..1194530,1194968..1195116,
FT                   1206173..1206302,1207836..1207925,1208320..1208436,
FT                   1208691..1208743)
FT                   /codon_start=1
FT                   /gene="Ethe1"
FT                   /locus_tag="mCG_7250"
FT                   /product="ethylmalonic encephalopathy 1"
FT                   /note="gene_id=mCG7250.1 transcript_id=mCT3689.0
FT                   protein_id=mCP15721.1"
FT                   /protein_id="EDL24325.1"
FT                   /translation="MASAVVRVAGRRLSQQSASGAPVLLRQMFEPKSCTYTYLLGDRES
FT                   REAVLIDPVLETAHRDAQLIKELGLKLLYAVNTHCHADHITGTGVLRSLLPGCQSVISR
FT                   LSGAQADLHIGEGDSIRFGRFALETRASPGHTPGCVTFVLNDQSMAFTGDALLIRGCGR
FT                   TDFQQGCAKTLYHSVHEKIFTLPGNCLIYPAHDYHGLTVSTVEEERTLNPRLTLSCEEF
FT                   IKVMDNLNLPKPQQIDIAVPANMRCGVQTPPS"
FT   gene            <1211313..1229266
FT                   /locus_tag="mCG_126296"
FT                   /note="gene_id=mCG126296.0"
FT   mRNA            join(<1211313..1211447,1217228..1217386,1219109..1219219,
FT                   1219350..1219433,1220045..1220158,1223822..1223921,
FT                   1224063..1224153,1224257..1224344,1224602..1224658,
FT                   1226451..1226688,1227243..1227328,1228813..1229266)
FT                   /locus_tag="mCG_126296"
FT                   /product="mCG126296"
FT                   /note="gene_id=mCG126296.0 transcript_id=mCT127563.1
FT                   created on 13-AUG-2002"
FT   CDS             join(1211313..1211447,1217228..1217386,1219109..1219219,
FT                   1219350..1219433,1220045..1220158,1223822..1223921,
FT                   1224063..1224153,1224257..1224344,1224602..1224658,
FT                   1226451..1226688,1227243..1227328,1228813..1228947)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126296"
FT                   /product="mCG126296"
FT                   /note="gene_id=mCG126296.0 transcript_id=mCT127563.1
FT                   protein_id=mCP57478.1"
FT                   /protein_id="EDL24324.1"
FT                   /translation="MGTPSTLEEGSSSPKVSECAVEVQPQGAVQPQGHPEDPKEHKEPE
FT                   IREQLDAAQRTYEDLEFQQLERESRVEEERESPAVPAPDSKVRELQSSVAQHRRRIQVL
FT                   EEQLRSLGEQMAAESWGLSRKKEEAVQALTQERSRLFELNCLQGTCGGDFSEPDQALTK
FT                   LLFTQKTDRQLLVLQDPTAHAAASSTSSCLFSVHSSLQGSIGLQRTGSLPRRRGERASQ
FT                   RGSSRPLSLHCTGPLEASALSQAVGTPGRHPLYQLLNCGPGNRHSVLRSDIAHMERLLQ
FT                   LAVAERERLLKDREGMRRSRESSTGPAVPAITAPPPPPPPPPPPPSPPGPQVLDLPQHL
FT                   ERWGHNPESCPHLRVTGGCCRGPLVKMGGRIKTWRKRWFCFDRQARRLAYYADKEETKL
FT                   KGVIYFQAIEEVYYDHLRCAFKSPSPRLTFCVKTYERLFYMVAPSPEAMRIWMDVIVTA
FT                   ADENHAP"
FT   gene            1236520..1241088
FT                   /gene="Lypd3"
FT                   /locus_tag="mCG_7266"
FT                   /note="gene_id=mCG7266.1"
FT   mRNA            join(1236520..1236642,1237093..1237224,1238396..1238566,
FT                   1238882..1239043,1240028..1241088)
FT                   /gene="Lypd3"
FT                   /locus_tag="mCG_7266"
FT                   /product="Ly6/Plaur domain containing 3"
FT                   /note="gene_id=mCG7266.1 transcript_id=mCT3674.0 created on
FT                   08-AUG-2002"
FT   CDS             join(1236558..1236642,1237093..1237224,1238396..1238566,
FT                   1238882..1239043,1240028..1240569)
FT                   /codon_start=1
FT                   /gene="Lypd3"
FT                   /locus_tag="mCG_7266"
FT                   /product="Ly6/Plaur domain containing 3"
FT                   /note="gene_id=mCG7266.1 transcript_id=mCT3674.0
FT                   protein_id=mCP15756.1"
FT                   /protein_id="EDL24323.1"
FT                   /translation="MDAARRGDTQPVMWTTGWLLLLPLLLCEGAQALECYSCVQKADDG
FT                   CSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAF
FT                   FQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNC
FT                   YNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPR
FT                   CNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQA
FT                   SHTSPHEMDLEVIQEEGASLSGGAAGHGGTAGHGGAAGHQDRSNMEKYPGKGGAQIPAK
FT                   GGSGTLGSWLSAVLLTVVAGAML"
FT   gene            1261260..1263077
FT                   /locus_tag="mCG_147824"
FT                   /note="gene_id=mCG147824.0"
FT   mRNA            join(1261260..1261547,1262284..1263077)
FT                   /locus_tag="mCG_147824"
FT                   /product="mCG147824"
FT                   /note="gene_id=mCG147824.0 transcript_id=mCT188087.0
FT                   created on 13-JAN-2004"
FT   CDS             join(1261387..1261547,1262284..1262395)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147824"
FT                   /product="mCG147824"
FT                   /note="gene_id=mCG147824.0 transcript_id=mCT188087.0
FT                   protein_id=mCP108443.0"
FT                   /protein_id="EDL24322.1"
FT                   /translation="MWKAPTACYNLPSRSRKGPLFRLSSPNLILDHACSGEGNAGSDLA
FT                   SSASRQDLRPCSQTSHGLTPWGHLCCPRPEATGKGNSESLKPRIT"
FT   gene            complement(1267981..1272018)
FT                   /gene="Tex101"
FT                   /locus_tag="mCG_7248"
FT                   /note="gene_id=mCG7248.1"
FT   mRNA            complement(join(1267981..1268370,1268477..1268608,
FT                   1269682..1269867,1270301..1270441,1270547..1270651,
FT                   1271920..1272018))
FT                   /gene="Tex101"
FT                   /locus_tag="mCG_7248"
FT                   /product="testis expressed gene 101"
FT                   /note="gene_id=mCG7248.1 transcript_id=mCT3687.1 created on
FT                   08-AUG-2002"
FT   CDS             complement(join(1268141..1268370,1268477..1268608,
FT                   1269682..1269867,1270301..1270441,1270547..1270610))
FT                   /codon_start=1
FT                   /gene="Tex101"
FT                   /locus_tag="mCG_7248"
FT                   /product="testis expressed gene 101"
FT                   /note="gene_id=mCG7248.1 transcript_id=mCT3687.1
FT                   protein_id=mCP15713.1"
FT                   /protein_id="EDL24321.1"
FT                   /translation="MGACRIQYVLLIFLLIASRWTLVQNTYCQVSQTLSLEDDPGRTFN
FT                   WTSKAEQCNPGELCQETVLLIKADGTRTVVLASKSCVSQGGEAVTFIQYTAPPGLVAIS
FT                   YSNYCNDSLCNNKDSLASVWRVPETTATSNMSGTRHCPTCVALGSCSSAPSMPCANGTT
FT                   QCYQGRLEFSGGGMDATVQVKGCTTTIGCRLMAMIDSVGPMTVKETCSYQSFLQPRKAE
FT                   IGASQMPTSLWVLELLFPLLLLPLTHFP"
FT   gene            1284208..1284610
FT                   /pseudo
FT                   /locus_tag="mCG_1031288"
FT                   /note="gene_id=mCG1031288.1"
FT   mRNA            1284208..1284610
FT                   /pseudo
FT                   /locus_tag="mCG_1031288"
FT                   /note="gene_id=mCG1031288.1 transcript_id=mCT148992.1
FT                   created on 13-FEB-2003"
FT   gene            1309226..1314500
FT                   /gene="BC049730"
FT                   /locus_tag="mCG_1050139"
FT                   /note="gene_id=mCG1050139.0"
FT   mRNA            join(1309226..1309264,1309879..1309995,1310084..1310188,
FT                   1312428..1312574,1313347..1313529,1313619..1313750,
FT                   1314054..1314500)
FT                   /gene="BC049730"
FT                   /locus_tag="mCG_1050139"
FT                   /product="cDNA sequence BC049730"
FT                   /note="gene_id=mCG1050139.0 transcript_id=mCT188804.0
FT                   created on 07-JAN-2004"
FT   CDS             join(1310125..1310188,1312428..1312574,1313347..1313529,
FT                   1313619..1313750,1314054..1314268)
FT                   /codon_start=1
FT                   /gene="BC049730"
FT                   /locus_tag="mCG_1050139"
FT                   /product="cDNA sequence BC049730"
FT                   /note="gene_id=mCG1050139.0 transcript_id=mCT188804.0
FT                   protein_id=mCP109793.0"
FT                   /db_xref="GOA:Q810N3"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:2681843"
FT                   /db_xref="UniProtKB/TrEMBL:Q810N3"
FT                   /protein_id="EDL24320.1"
FT                   /translation="MGACRIQYVLLLSLLGFCPCSDTLNCQEGSVMKFGQNFSRTSIEW
FT                   IVNQTVGSEKNKGEMCQEIFLLIDVGEKSLILGTKGITTVPGKRKKTDVFSPGPGIVSA
FT                   SYVHFCDTDLCNNASSTKVLLDLLKLSEYNEPGTTKCPVCLDFKGSCNTESNHTLCPKD
FT                   TKCYAASLGVHGGDLSAIFSISGCLNSSHTYLLNNQNTIGIISIKETLESNVTLSSQGL
FT                   LVPSILLTWMFGLLALCLQRSVLC"
FT   assembly_gap    1315786..1315805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<1323204..1327295)
FT                   /gene="MGC48079"
FT                   /locus_tag="mCG_7270"
FT                   /note="gene_id=mCG7270.1"
FT   mRNA            complement(join(<1323204..1323249,1323574..1323705,
FT                   1323795..1323980,1324775..1324915,1326294..1326398,
FT                   1327253..1327295))
FT                   /gene="MGC48079"
FT                   /locus_tag="mCG_7270"
FT                   /product="hypothetical protein MGC48079"
FT                   /note="gene_id=mCG7270.1 transcript_id=mCT3663.1 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(<1323204..1323249,1323574..1323705,
FT                   1323795..1323980,1324775..1324915,1326294..1326357))
FT                   /codon_start=1
FT                   /gene="MGC48079"
FT                   /locus_tag="mCG_7270"
FT                   /product="hypothetical protein MGC48079"
FT                   /note="gene_id=mCG7270.1 transcript_id=mCT3663.1
FT                   protein_id=mCP15741.2"
FT                   /protein_id="EDL24319.1"
FT                   /translation="MGACRIQYVLLLSLLGFCPCSDTLKCQKGIMVKLGSGFTKSEIKW
FT                   ISPGTTETAPEEICQETLLLIDVGEKSLILASKGSSKAESKSVNDVQVFSGGPGIVTAS
FT                   YVHFCNTELCNSANSTSVLIKNVKLSESSGQGSIQCPVCLHFRGSCSQHTKFVLCPKDT
FT                   RCYFSDMTVEGGGLKNFFSLDGCLANS"
FT   assembly_gap    1326516..1326898
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   gene            complement(1329867..1330535)
FT                   /pseudo
FT                   /locus_tag="mCG_1031266"
FT                   /note="gene_id=mCG1031266.1"
FT   mRNA            complement(1329867..1330535)
FT                   /pseudo
FT                   /locus_tag="mCG_1031266"
FT                   /note="gene_id=mCG1031266.1 transcript_id=mCT148970.1
FT                   created on 13-AUG-2002"
FT   assembly_gap    1330536..1331848
FT                   /estimated_length=1313
FT                   /gap_type="unknown"
FT   assembly_gap    1337333..1337575
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   gene            complement(1344544..1360870)
FT                   /gene="Cd177"
FT                   /locus_tag="mCG_140900"
FT                   /note="gene_id=mCG140900.0"
FT   mRNA            complement(join(1344544..1345012,1345393..1345524,
FT                   1345628..1345813,1346676..1346822,1350864..1350983,
FT                   1351134..1351253,1352522..1352707,1352821..1352955,
FT                   1354831..1354956,1355111..1355230,1356708..1356893,
FT                   1357140..1357280,1358554..1358670,1358888..1359007,
FT                   1360159..1360344,1360557..1360700,1360793..1360870))
FT                   /gene="Cd177"
FT                   /locus_tag="mCG_140900"
FT                   /product="CD177 antigen"
FT                   /note="gene_id=mCG140900.0 transcript_id=mCT172023.0
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(1344777..1345012,1345393..1345524,
FT                   1345628..1345813,1346676..1346822,1350864..1350983,
FT                   1351134..1351253,1352522..1352707,1352821..1352955,
FT                   1354831..1354956,1355111..1355230,1356708..1356893,
FT                   1357140..1357280,1358554..1358670,1358888..1359007,
FT                   1360159..1360344,1360557..1360700,1360793..1360844))
FT                   /codon_start=1
FT                   /gene="Cd177"
FT                   /locus_tag="mCG_140900"
FT                   /product="CD177 antigen"
FT                   /note="gene_id=mCG140900.0 transcript_id=mCT172023.0
FT                   protein_id=mCP94942.0"
FT                   /db_xref="GOA:Q8R2S8"
FT                   /db_xref="InterPro:IPR016054"
FT                   /db_xref="MGI:MGI:1916141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R2S8"
FT                   /protein_id="EDL24318.1"
FT                   /translation="MNSIPVLTLLGVTALLPCVPALTCQKSSAQAVRNVAELPLRWWGA
FT                   GEKTCEVSEGCQDLIMLLYNGPKVNLVIIKGCTEVEDQEPKVIWLRTGPGLSVVSYTRV
FT                   CRHGDLCNDVNSTKILEELPTPTVPGSLRCPLCLSNDSCENAPEQVCPVGSTHCYDGVL
FT                   RLRGDGIRTNLKVQGCMAQPDCNLLNGTQAIGTLYMSENCDLIGPQALDCNSGSLETVR
FT                   NVSDLHLSWTTGWQTCEAGEGCYETVMLIQNGHEFHMVLTKGCTRDMNKKARLTRHRTG
FT                   PGISIVSYVHVCRDRDFCNDLSTTDPLWTPPPDTELGTLRCRHCLSTGSCVSASELVCP
FT                   AGSTHCYSGVLSLRGGGVISDLKVQGCISQSQPGCNLLNGTQTIGPVDVREDCGLQLDA
FT                   LKCQHGTLKTIQDISKLPLQWTAGQKICNVGEGCQDTLMLIENGEQVNLVLTKGCTTAK
FT                   DQEAKVTEHRTGPGLSVTSYTRVCRKKDFCNDLSTTAPLWAPPPVTAPGTTRCPLCFSE
FT                   QACENAPEQVCPAGSTHCYSGVLSLRGGGIISDLKVQGCMSQPGCNLLNGTQTIGPVDV
FT                   SERCSPPSETTELSCYRGVMFELGNGFAEEPVKWTAPGSQVCAPDEICQETLLLIDVGQ
FT                   KSAFLGSKGCSSPGAQDNIGVSIFSRLPGMLVASYTKFCSSHLCNGADSSSVLLSILPR
FT                   PDVPPPGDVQCPMCVELFGSCKSTDSVTCPRGATHCYKGDIALQGGGLTTRVSIQGCMA
FT                   PPIKPLLGDSKTIGIFSAEESSNYRHEDDVTSAPSLAWTLRLSAWMLGLSALLSSLYAG
FT                   ICPLC"
FT   gene            1377813..1385215
FT                   /gene="Ceacam10"
FT                   /locus_tag="mCG_7244"
FT                   /note="gene_id=mCG7244.2"
FT   mRNA            join(1377813..1377897,1378684..1379043,1381428..1381787,
FT                   1385021..1385210)
FT                   /gene="Ceacam10"
FT                   /locus_tag="mCG_7244"
FT                   /product="CEA-related cell adhesion molecule 10, transcript
FT                   variant mCT3695"
FT                   /note="gene_id=mCG7244.2 transcript_id=mCT3695.0 created on
FT                   08-AUG-2002"
FT   CDS             join(1377834..1377897,1378684..1379043,1381428..1381787,
FT                   1385021..1385034)
FT                   /codon_start=1
FT                   /gene="Ceacam10"
FT                   /locus_tag="mCG_7244"
FT                   /product="CEA-related cell adhesion molecule 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG7244.2 transcript_id=mCT3695.0
FT                   protein_id=mCP15758.1 isoform=CRA_b"
FT                   /protein_id="EDL24317.1"
FT                   /translation="MELASAHLHKGQVPWVGLLLTASLLTYWSPATTAQVTVEAVPPNV
FT                   TADNNVLLLVHNLPQTLRVFYWYKGNSGAGHNEIGRFVTSINRSKMGLAHSGRETIYSN
FT                   GSLFFQSVTKNDEGVYTLYMLDQNFEITPISVRFHVHPSLLPSLSPPTTGQVTVEAVPP
FT                   NVAEGENVLLLVHNLPRTLRAIYWYRGTTAGERNEIARFITASNKIILGPAHSDREIIY
FT                   NNGSLFFQGVTKNDEGAYALDMLFQNFDHTLMPVQFNVHAKKQ"
FT   mRNA            join(1377839..1377897,1378684..1378819,1381428..1381787,
FT                   1385021..1385215)
FT                   /gene="Ceacam10"
FT                   /locus_tag="mCG_7244"
FT                   /product="CEA-related cell adhesion molecule 10, transcript
FT                   variant mCT171756"
FT                   /note="gene_id=mCG7244.2 transcript_id=mCT171756.0 created
FT                   on 08-AUG-2002"
FT   CDS             join(1378768..1378819,1381428..1381787,1385021..1385034)
FT                   /codon_start=1
FT                   /gene="Ceacam10"
FT                   /locus_tag="mCG_7244"
FT                   /product="CEA-related cell adhesion molecule 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG7244.2 transcript_id=mCT171756.0
FT                   protein_id=mCP94675.0 isoform=CRA_a"
FT                   /protein_id="EDL24316.1"
FT                   /translation="MFFYLFTICRRRSESFTASLLPSLSPPTTGQVTVEAVPPNVAEGE
FT                   NVLLLVHNLPRTLRAIYWYRGTTAGERNEIARFITASNKIILGPAHSDREIIYNNGSLF
FT                   FQGVTKNDEGAYALDMLFQNFDHTLMPVQFNVHAKKQ"
FT   gene            <1438821..>1440807
FT                   /locus_tag="mCG_126309"
FT                   /note="gene_id=mCG126309.0"
FT   mRNA            join(<1438821..1438876,1438996..1439043,1439509..1439548,
FT                   1440680..>1440807)
FT                   /locus_tag="mCG_126309"
FT                   /product="mCG126309"
FT                   /note="gene_id=mCG126309.0 transcript_id=mCT127576.1
FT                   created on 12-AUG-2002"
FT   CDS             join(<1438823..1438876,1438996..1439043,1439509..1439548,
FT                   1440680..>1440807)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126309"
FT                   /product="mCG126309"
FT                   /note="gene_id=mCG126309.0 transcript_id=mCT127576.1
FT                   protein_id=mCP57545.1"
FT                   /protein_id="EDL24315.1"
FT                   /translation="RARSKSILSEDSQHCPPRPSVAGGPHLFPATGDQVTGPTTTLLEC
FT                   EASGWRLSRTPKPSNPTSQLQPPGYSSHGTGPPGYSSHGTDFLKL"
FT   gene            1462760..1463236
FT                   /locus_tag="mCG_7243"
FT                   /note="gene_id=mCG7243.0"
FT   mRNA            1462760..1463236
FT                   /locus_tag="mCG_7243"
FT                   /product="mCG7243"
FT                   /note="gene_id=mCG7243.0 transcript_id=mCT3701.0 created on
FT                   12-AUG-2002"
FT   CDS             1463059..1463208
FT                   /codon_start=1
FT                   /locus_tag="mCG_7243"
FT                   /product="mCG7243"
FT                   /note="gene_id=mCG7243.0 transcript_id=mCT3701.0
FT                   protein_id=mCP15757.1"
FT                   /protein_id="EDL24314.1"
FT                   /translation="MDASHKLHCETRALRADATGPRVSEGDPSTNRTAKFHRFALGYYR
FT                   KLFV"
FT   assembly_gap    1463813..1465884
FT                   /estimated_length=2072
FT                   /gap_type="unknown"
FT   gene            complement(1466581..1471711)
FT                   /gene="Lypd4"
FT                   /locus_tag="mCG_7268"
FT                   /note="gene_id=mCG7268.1"
FT   mRNA            complement(join(1466581..1466856,1467137..1467463,
FT                   1468650..1468793,1469191..1469377,1471492..1471711))
FT                   /gene="Lypd4"
FT                   /locus_tag="mCG_7268"
FT                   /product="Ly6/Plaur domain containing 4"
FT                   /note="gene_id=mCG7268.1 transcript_id=mCT3668.2 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(1466654..1466856,1467137..1467463,
FT                   1468650..1468793,1469191..1469257))
FT                   /codon_start=1
FT                   /gene="Lypd4"
FT                   /locus_tag="mCG_7268"
FT                   /product="Ly6/Plaur domain containing 4"
FT                   /note="gene_id=mCG7268.1 transcript_id=mCT3668.2
FT                   protein_id=mCP15734.2"
FT                   /protein_id="EDL24313.1"
FT                   /translation="MILQAWRSLQLLYLLEAISLLPCTEALLCYEATASAFRAVSLHNW
FT                   KWLLLRSMVCNQREGCEETVVFIETGTSKGVLSFKGCSSAFSYPPQISYLVSPPGVSIA
FT                   SYSRVCRSYLCNNLTNLEPFVRLKASQPMSTLPSAKSCPSCVGKHDQECLPSFVTTENC
FT                   PFAASSCYSSTLKFQAGNLNTTFLIMGCARDSHKLLADFQHIGSIRVTEVINVLDKSEA
FT                   VSAGHCSQGISWSVLLCLLILLRD"
FT   gene            <1472023..1479605
FT                   /gene="Dmrtc2"
FT                   /locus_tag="mCG_144024"
FT                   /note="gene_id=mCG144024.0"
FT   mRNA            join(<1472023..1472135,1474436..1474663,1474738..1474892,
FT                   1475880..1475956,1476156..1476336,1476865..1476991,
FT                   1477706..1477766,1477907..1478081,1479111..1479605)
FT                   /gene="Dmrtc2"
FT                   /locus_tag="mCG_144024"
FT                   /product="doublesex and mab-3 related transcription factor
FT                   like family C2"
FT                   /note="gene_id=mCG144024.0 transcript_id=mCT183448.0
FT                   created on 04-JUN-2003"
FT   CDS             join(<1474437..1474663,1474738..1474892,1475880..1475956,
FT                   1476156..1476336,1476865..1476991,1477706..1477766,
FT                   1477907..1478081,1479111..1479223)
FT                   /codon_start=1
FT                   /gene="Dmrtc2"
FT                   /locus_tag="mCG_144024"
FT                   /product="doublesex and mab-3 related transcription factor
FT                   like family C2"
FT                   /note="gene_id=mCG144024.0 transcript_id=mCT183448.0
FT                   protein_id=mCP105732.0"
FT                   /protein_id="EDL24312.1"
FT                   /translation="SMDPSETAALHHCSADSSPADEARVPQSTELIPRRPVSRSPTCAR
FT                   CRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKRHLAQGL
FT                   MKGATPLKAPLRVKKGAIRPGIPSGKENIAPQPQSPHGAVPLVLTPPGKENYGPLLLSR
FT                   PPEALPLPWTPVPPGPWGPGHWLPPGLSMPPPVVCRLLCQEPAVPLHPFPGFDPGTSLR
FT                   LPTHGTLPTCPGSRSVLTAPLSGEPQGPPNLPHTCSTLILQSCGTPDSLLLQPQAPGAS
FT                   CLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWISLLHPCGPPAPPGGR
FT                   GFQPVGPPLRPSPGSSVSLHIGRLGSISLLS"
FT   gene            1486587..1491760
FT                   /locus_tag="mCG_126277"
FT                   /note="gene_id=mCG126277.1"
FT   mRNA            join(1486587..1486624,1487093..1487163,1487409..1487509,
FT                   1490239..1490422,1490864..1491760)
FT                   /locus_tag="mCG_126277"
FT                   /product="mCG126277, transcript variant mCT171730"
FT                   /note="gene_id=mCG126277.1 transcript_id=mCT171730.0
FT                   created on 08-AUG-2002"
FT   mRNA            join(1486589..1486624,1487093..1487163,1487409..1487509,
FT                   1490239..1490422,1490864..1490918,1491697..1491758)
FT                   /locus_tag="mCG_126277"
FT                   /product="mCG126277, transcript variant mCT171729"
FT                   /note="gene_id=mCG126277.1 transcript_id=mCT171729.0
FT                   created on 08-AUG-2002"
FT   mRNA            join(1486671..1486826,1487093..1487163,1487409..1487509,
FT                   1490239..1490422,1490864..1490918,1491697..1491758)
FT                   /locus_tag="mCG_126277"
FT                   /product="mCG126277, transcript variant mCT127544"
FT                   /note="gene_id=mCG126277.1 transcript_id=mCT127544.0
FT                   created on 08-AUG-2002"
FT   CDS             join(1487093..1487163,1487409..1487509,1490239..1490422,
FT                   1490864..1490918,1491697..1491723)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126277"
FT                   /product="mCG126277, isoform CRA_a"
FT                   /note="gene_id=mCG126277.1 transcript_id=mCT127544.0
FT                   protein_id=mCP57459.1 isoform=CRA_a"
FT                   /protein_id="EDL24309.1"
FT                   /translation="MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKEL
FT                   APYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVL
FT                   QALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH"
FT   CDS             join(1487093..1487163,1487409..1487509,1490239..1490422,
FT                   1490864..1490918,1491697..1491723)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126277"
FT                   /product="mCG126277, isoform CRA_a"
FT                   /note="gene_id=mCG126277.1 transcript_id=mCT171729.0
FT                   protein_id=mCP94649.0 isoform=CRA_a"
FT                   /protein_id="EDL24310.1"
FT                   /translation="MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKEL
FT                   APYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVL
FT                   QALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAAANKKH"
FT   CDS             join(1487093..1487163,1487409..1487509,1490239..1490422,
FT                   1490864..1490996)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126277"
FT                   /product="mCG126277, isoform CRA_b"
FT                   /note="gene_id=mCG126277.1 transcript_id=mCT171730.0
FT                   protein_id=mCP94648.0 isoform=CRA_b"
FT                   /protein_id="EDL24311.1"
FT                   /translation="MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKEL
FT                   APYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVL
FT                   QALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVRGARYASVETERGGGGLEATLGRG"
FT   gene            1499466..1503813
FT                   /locus_tag="mCG_7279"
FT                   /note="gene_id=mCG7279.2"
FT   mRNA            join(1499466..1499544,1501051..1501344,1501543..1501661,
FT                   1503189..1503257,1503387..1503813)
FT                   /locus_tag="mCG_7279"
FT                   /product="mCG7279, transcript variant mCT3655"
FT                   /note="gene_id=mCG7279.2 transcript_id=mCT3655.2 created on
FT                   08-AUG-2002"
FT   mRNA            join(1499466..1499544,1501543..1501661,1503189..1503257,
FT                   1503387..1503813)
FT                   /locus_tag="mCG_7279"
FT                   /product="mCG7279, transcript variant mCT171762"
FT                   /note="gene_id=mCG7279.2 transcript_id=mCT171762.0 created
FT                   on 08-AUG-2002"
FT   CDS             join(1499478..1499544,1501051..1501344,1501543..1501661,
FT                   1503189..1503257,1503387..1503500)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7279"
FT                   /product="mCG7279, isoform CRA_b"
FT                   /note="gene_id=mCG7279.2 transcript_id=mCT3655.2
FT                   protein_id=mCP15728.2 isoform=CRA_b"
FT                   /protein_id="EDL24308.1"
FT                   /translation="MPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGEE
FT                   ARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVI
FT                   ENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRW
FT                   QNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP"
FT   CDS             join(1499478..1499544,1501543..1501661,1503189..1503257,
FT                   1503387..1503500)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7279"
FT                   /product="mCG7279, isoform CRA_a"
FT                   /note="gene_id=mCG7279.2 transcript_id=mCT171762.0
FT                   protein_id=mCP94681.0 isoform=CRA_a"
FT                   /protein_id="EDL24307.1"
FT                   /translation="MPGGLEALRALPLLLFLSYACLDPVPRPFLDMGEGTKNRIITAEG
FT                   IILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQG
FT                   TYQDVGNLHIGDAQLEKP"
FT   gene            <1504982..1528684
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /note="gene_id=mCG7261.2"
FT   mRNA            join(<1504982..1505088,1509672..1509713,1509810..1509890,
FT                   1510267..1510380,1514013..1514111,1514266..1514308,
FT                   1514511..1514757,1515096..1515125,1515355..1515454,
FT                   1515576..1515672,1518150..1518185,1518863..1519003,
FT                   1519957..1520062,1521276..1521443,1521723..1521868,
FT                   1523963..1524109,1524417..1524499,1524633..1524758,
FT                   1524899..1525013,1525102..1525202,1525456..1525533,
FT                   1525751..1525826,1525895..1526062,1526888..1526975,
FT                   1527068..1527154,1527344..1527411,1527493..1527579,
FT                   1527876..1528039,1528116..1528215,1528332..1528681)
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   transcript variant mCT191906"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT191906.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1504984..1505088,1509672..1509713,1509810..1509890,
FT                   1510267..1510380,1514013..1514111,1514266..1514308,
FT                   1514511..1514757,1515096..1515125,1515355..1515454,
FT                   1515576..1515672,1518150..1518185,1518863..1519003,
FT                   1519957..1520062,1521276..1521443,1521723..1521868,
FT                   1523963..1524109,1524417..1524499,1524633..1524758,
FT                   1524899..1525013,1525102..1525202,1525456..1525533,
FT                   1525751..1525826,1525895..1526062,1526888..1526975,
FT                   1527068..1527154,1527344..1527411,1527493..1527579,
FT                   1527876..1528039,1528116..1528215,1528332..1528342)
FT                   /codon_start=1
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT191906.0
FT                   protein_id=mCP112861.0 isoform=CRA_b"
FT                   /protein_id="EDL24303.1"
FT                   /translation="LPARQSQEAGVGTPGPGSPSPTSGASPVTSPRGHQPGGVLEMGEV
FT                   AGGAAPGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQSLEQVKRRPAHLMALLQH
FT                   VALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFELDR
FT                   TRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQELSLLEPWIGKDR
FT                   GNYEARERHVAERLLSHLEETQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGR
FT                   NFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEADAEKPGPADR
FT                   KGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVDTPQEPGDTPPQGPTSLEP
FT                   LAPPESTEDNGETERLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPGS
FT                   ATAVLGPTRRATPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVI
FT                   SELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHSLFLDRLMK
FT                   RRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAF
FT                   VQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESTERGKVELAAECCREI
FT                   LHHVNQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWR
FT                   VTKDKAIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTR
FT                   EVATDHKAFYVIFTWDQEAQIYELVAQTSSERKNWCNLITETAGSLKVPAPASRLKPRP
FT                   SPSSIREPLLSSSENGTGGAEMAPADARTERLLNDLLPFCRPGPEGQLAATALQKVLSL
FT                   KQILLSTEEDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLEELEEEFCR
FT                   LRPLLSQLGGTLSPNLAAPERSAQTGLS"
FT   mRNA            join(<1504996..1505088,1509672..1509713,1509810..1509890,
FT                   1510267..1510380,1514013..1514111,1514266..1514308,
FT                   1514511..1514757,1515096..1515125,1515355..1515454,
FT                   1515576..1515672,1518150..1518185,1518863..1519003,
FT                   1519957..1520062,1521723..1521868,1523963..1524109,
FT                   1524417..1524499,1524633..1524758,1524899..1525013,
FT                   1525102..1525202,1525456..1525533,1525751..1525826,
FT                   1525895..1526062,1526888..1526975,1527068..1527154,
FT                   1527344..1527411,1527493..1527579,1527876..1528039,
FT                   1528116..1528215,1528332..1528681)
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   transcript variant mCT191908"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT191908.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1504996..1505088,1509672..1509713,1509810..1509890,
FT                   1510267..1510380,1514013..1514111,1514266..1514308,
FT                   1514511..1514757,1515096..1515125,1515355..1515454,
FT                   1515576..1515672,1518150..1518185,1518863..1519003,
FT                   1519957..1520062,1521723..1521868,1523963..1524109,
FT                   1524417..1524499,1524633..1524758,1524899..1525013,
FT                   1525102..1525202,1525456..1525533,1525751..1525826,
FT                   1525895..1526062,1526888..1526975,1527068..1527154,
FT                   1527344..1527411,1527493..1527579,1527876..1528039,
FT                   1528116..1528215,1528332..1528342)
FT                   /codon_start=1
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT191908.0
FT                   protein_id=mCP112863.0 isoform=CRA_d"
FT                   /protein_id="EDL24305.1"
FT                   /translation="QSQEAGVGTPGPGSPSPTSGASPVTSPRGHQPGGVLEMGEVAGGA
FT                   APGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQSLEQVKRRPAHLMALLQHVALQ
FT                   FEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFELDRTRPD
FT                   LISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQELSLLEPWIGKDRGNYE
FT                   ARERHVAERLLSHLEETQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGRNFFR
FT                   KKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEADAEKPGPADRKGGL
FT                   GMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVDTPQEPGDTPPQGPTSLEPLAPP
FT                   ESTEDNGETESPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVIS
FT                   ELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHSLFLDRLMKR
FT                   RQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFV
FT                   QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESTERGKVELAAECCREIL
FT                   HHVNQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRV
FT                   TKDKAIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTRE
FT                   VATDHKAFYVIFTWDQEAQIYELVAQTSSERKNWCNLITETAGSLKVPAPASRLKPRPS
FT                   PSSIREPLLSSSENGTGGAEMAPADARTERLLNDLLPFCRPGPEGQLAATALQKVLSLK
FT                   QILLSTEEDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLEELEEEFCRL
FT                   RPLLSQLGGTLSPNLAAPERSAQTGLS"
FT   mRNA            join(1505016..1505088,1509672..1509713,1509810..1509890,
FT                   1510267..1510380,1514013..1514111,1514266..1514308,
FT                   1514511..1514757,1515096..1515125,1515355..1515454,
FT                   1515576..1515672,1518150..1518185,1518866..1519003,
FT                   1519957..1520062,1521723..1521868,1523963..1524109,
FT                   1524417..1524499,1524633..1524758,1524899..1525013,
FT                   1525102..1525202,1525456..1525533,1525751..1525826,
FT                   1525895..1526062,1526888..1526975,1527068..1527154,
FT                   1527344..1527411,1527493..1527579,1527876..1528039,
FT                   1528116..1528215,1528332..1528684)
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   transcript variant mCT3678"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT3678.0 created on
FT                   07-AUG-2002"
FT   mRNA            join(1505030..1505323,1509672..1509713,1509810..1509890,
FT                   1510267..1510380,1514013..1514111,1514266..1514308,
FT                   1514511..1514757,1515096..1515125,1515355..1515454,
FT                   1515576..1515672,1518150..1518185,1518863..1519003,
FT                   1519957..1520062,1521723..1521868,1523963..1524109,
FT                   1524417..1524499,1524633..1524758,1524899..1525013,
FT                   1525102..1525202,1525456..1525533,1525751..1525826,
FT                   1525895..1526062,1526888..1526975,1527068..1527154,
FT                   1527344..1527411,1527493..1527579,1527876..1528039,
FT                   1528116..1528215,1528332..1528677)
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   transcript variant mCT171758"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT171758.0 created
FT                   on 07-AUG-2002"
FT   mRNA            join(<1506367..1506457,1509672..1509713,1509810..1509890,
FT                   1510267..1510380,1514013..1514111,1514266..1514308,
FT                   1514511..1514757,1515096..1515125,1515355..1515454,
FT                   1515576..1515672,1518150..1518185,1518863..1519003,
FT                   1519957..1520062,1521723..1521868,1523963..1524109,
FT                   1524417..1524499,1524633..1524758,1524899..1525013,
FT                   1525102..1525202,1525456..1525533,1525751..1525826,
FT                   1525895..1526062,1526888..1526975,1527068..1527154,
FT                   1527344..1527411,1527493..1527579,1527876..1528039,
FT                   1528116..1528215,1528332..1528681)
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   transcript variant mCT191907"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT191907.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1506368..1506457,1509672..1509713,1509810..1509890,
FT                   1510267..1510380,1514013..1514111,1514266..1514308,
FT                   1514511..1514757,1515096..1515125,1515355..1515454,
FT                   1515576..1515672,1518150..1518185,1518863..1519003,
FT                   1519957..1520062,1521723..1521868,1523963..1524109,
FT                   1524417..1524499,1524633..1524758,1524899..1525013,
FT                   1525102..1525202,1525456..1525533,1525751..1525826,
FT                   1525895..1526062,1526888..1526975,1527068..1527154,
FT                   1527344..1527411,1527493..1527579,1527876..1528039,
FT                   1528116..1528215,1528332..1528342)
FT                   /codon_start=1
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT191907.0
FT                   protein_id=mCP112862.0 isoform=CRA_c"
FT                   /protein_id="EDL24304.1"
FT                   /translation="SAARVGEPGARARRLRFLRLQWLASLPIRQPGGVLEMGEVAGGAA
FT                   PGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQSLEQVKRRPAHLMALLQHVALQF
FT                   EPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFELDRTRPDL
FT                   ISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQELSLLEPWIGKDRGNYEA
FT                   RERHVAERLLSHLEETQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGRNFFRK
FT                   KVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEADAEKPGPADRKGGLG
FT                   MSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVDTPQEPGDTPPQGPTSLEPLAPPE
FT                   STEDNGETESPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVISE
FT                   LLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHSLFLDRLMKRR
FT                   QESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQ
FT                   EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESTERGKVELAAECCREILH
FT                   HVNQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVT
FT                   KDKAIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREV
FT                   ATDHKAFYVIFTWDQEAQIYELVAQTSSERKNWCNLITETAGSLKVPAPASRLKPRPSP
FT                   SSIREPLLSSSENGTGGAEMAPADARTERLLNDLLPFCRPGPEGQLAATALQKVLSLKQ
FT                   ILLSTEEDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLEELEEEFCRLR
FT                   PLLSQLGGTLSPNLAAPERSAQTGLS"
FT   CDS             join(1509690..1509713,1509810..1509890,1510267..1510380,
FT                   1514013..1514111,1514266..1514308,1514511..1514757,
FT                   1515096..1515125,1515355..1515454,1515576..1515672,
FT                   1518150..1518185,1518863..1519003,1519957..1520062,
FT                   1521723..1521868,1523963..1524109,1524417..1524499,
FT                   1524633..1524758,1524899..1525013,1525102..1525202,
FT                   1525456..1525533,1525751..1525826,1525895..1526062,
FT                   1526888..1526975,1527068..1527154,1527344..1527411,
FT                   1527493..1527579,1527876..1528039,1528116..1528215,
FT                   1528332..1528342)
FT                   /codon_start=1
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT171758.0
FT                   protein_id=mCP94677.0 isoform=CRA_a"
FT                   /protein_id="EDL24302.1"
FT                   /translation="MGEVAGGAAPGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQ
FT                   SLEQVKRRPAHLMALLQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEK
FT                   TAVLRVPVPPSVAFELDRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGM
FT                   TPWEQELSLLEPWIGKDRGNYEARERHVAERLLSHLEETQHTISTDEEKSAAVVTAISL
FT                   YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPD
FT                   CRHLKVEADAEKPGPADRKGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVD
FT                   TPQEPGDTPPQGPTSLEPLAPPESTEDNGETESPEPGDDGEPGRSGLELEPEEPPGWRE
FT                   LVPPDTLLSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQN
FT                   IFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSR
FT                   QSFALEQLKAKQRKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQ
FT                   NTEESTERGKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLS
FT                   EFKNLDITKKKLVHEGPLTWRVTKDKAIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLT
FT                   PTPDGKTMLRPVLRLTSAMTREVATDHKAFYVIFTWDQEAQIYELVAQTSSERKNWCNL
FT                   ITETAGSLKVPAPASRLKPRPSPSSIREPLLSSSENGTGGAEMAPADARTERLLNDLLP
FT                   FCRPGPEGQLAATALQKVLSLKQILLSTEEDSGAGPPRDGDGVPGGRAPGPVHTQEIEE
FT                   NLLSLEVAIRQLEELEEEFCRLRPLLSQLGGTLSPNLAAPERSAQTGLS"
FT   CDS             join(1509690..1509713,1509810..1509890,1510267..1510380,
FT                   1514013..1514111,1514266..1514308,1514511..1514757,
FT                   1515096..1515125,1515355..1515454,1515576..1515672,
FT                   1518150..1518185,1518866..1519003,1519957..1520062,
FT                   1521723..1521868,1523963..1524109,1524417..1524499,
FT                   1524633..1524758,1524899..1525013,1525102..1525202,
FT                   1525456..1525533,1525751..1525826,1525895..1526062,
FT                   1526888..1526975,1527068..1527154,1527344..1527411,
FT                   1527493..1527579,1527876..1528039,1528116..1528215,
FT                   1528332..1528342)
FT                   /codon_start=1
FT                   /gene="Arhgef1"
FT                   /locus_tag="mCG_7261"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 1,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG7261.2 transcript_id=mCT3678.0
FT                   protein_id=mCP15723.1 isoform=CRA_e"
FT                   /protein_id="EDL24306.1"
FT                   /translation="MGEVAGGAAPGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQ
FT                   SLEQVKRRPAHLMALLQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEK
FT                   TAVLRVPVPPSVAFELDRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGM
FT                   TPWEQELSLLEPWIGKDRGNYEARERHVAERLLSHLEETQHTISTDEEKSAAVVTAISL
FT                   YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPD
FT                   CRHLKVEADEKPGPADRKGGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVDT
FT                   PQEPGDTPPQGPTSLEPLAPPESTEDNGETESPEPGDDGEPGRSGLELEPEEPPGWREL
FT                   VPPDTLLSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNI
FT                   FPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQ
FT                   SFALEQLKAKQRKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQN
FT                   TEESTERGKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLSE
FT                   FKNLDITKKKLVHEGPLTWRVTKDKAIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTP
FT                   TPDGKTMLRPVLRLTSAMTREVATDHKAFYVIFTWDQEAQIYELVAQTSSERKNWCNLI
FT                   TETAGSLKVPAPASRLKPRPSPSSIREPLLSSSENGTGGAEMAPADARTERLLNDLLPF
FT                   CRPGPEGQLAATALQKVLSLKQILLSTEEDSGAGPPRDGDGVPGGRAPGPVHTQEIEEN
FT                   LLSLEVAIRQLEELEEEFCRLRPLLSQLGGTLSPNLAAPERSAQTGLS"
FT   assembly_gap    1516401..1516676
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    1520634..1520653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<1530795..>1531460)
FT                   /locus_tag="mCG_7251"
FT                   /note="gene_id=mCG7251.0"
FT   mRNA            complement(join(<1530795..1530990,1531226..>1531460))
FT                   /locus_tag="mCG_7251"
FT                   /product="mCG7251"
FT                   /note="gene_id=mCG7251.0 transcript_id=mCT3690.0 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(<1530795..1530990,1531226..>1531458))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7251"
FT                   /product="mCG7251"
FT                   /note="gene_id=mCG7251.0 transcript_id=mCT3690.0
FT                   protein_id=mCP15710.0"
FT                   /protein_id="EDL24301.1"
FT                   /translation="FAFPDWAYKPESSPGSRQIQLWHFILELLQKEEYQGVIAWQGDYG
FT                   EFVIKDPDEVARLWGIRKCKPHMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFSKVV
FT                   LVNYPLLDVAAAATGSPLLLTPGPFAGAPGPDAPPLTPE"
FT   assembly_gap    1537726..1537745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1566822..1567191
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   gene            complement(1571445..1574630)
FT                   /gene="Rabac1"
FT                   /locus_tag="mCG_7260"
FT                   /note="gene_id=mCG7260.1"
FT   mRNA            complement(join(1571445..1571465,1571620..1571878,
FT                   1571956..1572057,1573629..1573726,1573970..1574182,
FT                   1574395..1574630))
FT                   /gene="Rabac1"
FT                   /locus_tag="mCG_7260"
FT                   /product="Rab acceptor 1 (prenylated), transcript variant
FT                   mCT3677"
FT                   /note="gene_id=mCG7260.1 transcript_id=mCT3677.1 created on
FT                   12-AUG-2002"
FT   mRNA            complement(join(1571630..1571878,1571956..1572057,
FT                   1573629..1573726,1573970..>1574280))
FT                   /gene="Rabac1"
FT                   /locus_tag="mCG_7260"
FT                   /product="Rab acceptor 1 (prenylated), transcript variant
FT                   mCT191904"
FT                   /note="gene_id=mCG7260.1 transcript_id=mCT191904.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1571790..1571878,1571956..1572057,
FT                   1573629..1573726,1573970..1574182,1574395..1574450))
FT                   /codon_start=1
FT                   /gene="Rabac1"
FT                   /locus_tag="mCG_7260"
FT                   /product="Rab acceptor 1 (prenylated), isoform CRA_b"
FT                   /note="gene_id=mCG7260.1 transcript_id=mCT3677.1
FT                   protein_id=mCP15718.2 isoform=CRA_b"
FT                   /protein_id="EDL24300.1"
FT                   /translation="MAAQKDQQKDAEGEGLSATTLLPKLIPSGAGREWLERRRATIRPW
FT                   GTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFF
FT                   GACYILYLRTLQSKLVLFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLI
FT                   GSHAAFHQMEPADGEELQMEPV"
FT   CDS             complement(join(1571790..1571878,1571956..1572057,
FT                   1573629..1573726,1573970..>1574280))
FT                   /codon_start=1
FT                   /gene="Rabac1"
FT                   /locus_tag="mCG_7260"
FT                   /product="Rab acceptor 1 (prenylated), isoform CRA_a"
FT                   /note="gene_id=mCG7260.1 transcript_id=mCT191904.0
FT                   protein_id=mCP112860.0 isoform=CRA_a"
FT                   /protein_id="EDL24299.1"
FT                   /translation="GSRSCLGPGVLESGVQILPSPSLQLLCSALPIRTLLPKLIPSGAG
FT                   REWLERRRATIRPWGTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNYVFVFLGLILYCV
FT                   VTSPMLLVALAVFFGACYILYLRTLQSKLVLFGREVSPAHQYALAGGVSFPFFWLAGAG
FT                   SAVFWVLGATLVLIGSHAAFHQMEPADGEELQMEPV"
FT   gene            complement(1580037..1607782)
FT                   /gene="Atp1a3"
FT                   /locus_tag="mCG_7257"
FT                   /note="gene_id=mCG7257.1"
FT   mRNA            complement(join(1580037..1580444,1580782..1580873,
FT                   1581163..1581264,1581878..1582008,1582419..1582564,
FT                   1583387..1583510,1583610..1583764,1589303..1589471,
FT                   1589846..1589996,1591436..1591572,1591657..1591832,
FT                   1592231..1592423,1596003..1596137,1596221..1596330,
FT                   1596407..1596605,1599003..1599271,1599384..1599501,
FT                   1600545..1600679,1600771..1600884,1602448..1602651,
FT                   1602791..1602850,1602943..1603068,1607626..1607782))
FT                   /gene="Atp1a3"
FT                   /locus_tag="mCG_7257"
FT                   /product="ATPase, Na+/K+ transporting, alpha 3 polypeptide,
FT                   transcript variant mCT3683"
FT                   /note="gene_id=mCG7257.1 transcript_id=mCT3683.2 created on
FT                   12-AUG-2002"
FT   mRNA            complement(join(1580039..1580873,1581163..1581264,
FT                   1581878..1582008,1582419..1582564,1583387..1583510,
FT                   1583610..1583764,1589303..1589471,1589846..1589996,
FT                   1591436..1591572,1591657..1591832,1592231..1592423,
FT                   1596003..1596137,1596221..1596330,1596407..1596605,
FT                   1599003..1599271,1599384..1599501,1600545..1600679,
FT                   1600771..1600884,1602448..1602651,1602791..1602850,
FT                   1602943..1603029,1607626..1607766))
FT                   /gene="Atp1a3"
FT                   /locus_tag="mCG_7257"
FT                   /product="ATPase, Na+/K+ transporting, alpha 3 polypeptide,
FT                   transcript variant mCT172021"
FT                   /note="gene_id=mCG7257.1 transcript_id=mCT172021.0 created
FT                   on 12-AUG-2002"
FT   mRNA            complement(join(1580039..1580444,1580782..1580873,
FT                   1581163..1581264,1581878..1582008,1582419..1582564,
FT                   1583387..1583510,1583610..1583764,1589303..1589471,
FT                   1589846..1589996,1591436..1591572,1591657..1591832,
FT                   1592231..1592423,1596003..1596137,1596221..1596330,
FT                   1596407..1596605,1599003..1599271,1599384..1599501,
FT                   1600545..1600679,1600771..1600884,1602448..1602651,
FT                   1602791..1602850,1602943..1603029,1607626..>1607764))
FT                   /gene="Atp1a3"
FT                   /locus_tag="mCG_7257"
FT                   /product="ATPase, Na+/K+ transporting, alpha 3 polypeptide,
FT                   transcript variant mCT191947"
FT                   /note="gene_id=mCG7257.1 transcript_id=mCT191947.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1580416..1580444,1580782..1580873,
FT                   1581163..1581264,1581878..1582008,1582419..1582564,
FT                   1583387..1583510,1583610..1583764,1589303..1589471,
FT                   1589846..1589996,1591436..1591572,1591657..1591832,
FT                   1592231..1592423,1596003..1596137,1596221..1596330,
FT                   1596407..1596605,1599003..1599271,1599384..1599501,
FT                   1600545..1600679,1600771..1600884,1602448..1602651,
FT                   1602791..1602850,1602943..1603029,1607626..>1607691))
FT                   /codon_start=1
FT                   /gene="Atp1a3"
FT                   /locus_tag="mCG_7257"
FT                   /product="ATPase, Na+/K+ transporting, alpha 3 polypeptide,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7257.1 transcript_id=mCT191947.0
FT                   protein_id=mCP112859.0 isoform=CRA_a"
FT                   /protein_id="EDL24296.1"
FT                   /translation="AHPAATAHQSERRSSRGAAKMGDKKDDKSSPKKSKAKERRDLDDL
FT                   KKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCR
FT                   QLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAK
FT                   SSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCK
FT                   VDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIA
FT                   TLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVA
FT                   NVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVA
FT                   HMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVA
FT                   GDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVM
FT                   KGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFP
FT                   KGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAK
FT                   AIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQN
FT                   HTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSK
FT                   QAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPL
FT                   GTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQ
FT                   ALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHT
FT                   AFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALR
FT                   MYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY"
FT   CDS             complement(join(1580416..1580444,1580782..1580873,
FT                   1581163..1581264,1581878..1582008,1582419..1582564,
FT                   1583387..1583510,1583610..1583764,1589303..1589471,
FT                   1589846..1589996,1591436..1591572,1591657..1591832,
FT                   1592231..1592423,1596003..1596137,1596221..1596330,
FT                   1596407..1596605,1599003..1599271,1599384..1599501,
FT                   1600545..1600679,1600771..1600884,1602448..1602651,
FT                   1602791..1602850,1602943..1603068,1607626..1607631))
FT                   /codon_start=1
FT                   /gene="Atp1a3"
FT                   /locus_tag="mCG_7257"
FT                   /product="ATPase, Na+/K+ transporting, alpha 3 polypeptide,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7257.1 transcript_id=mCT3683.2
FT                   protein_id=mCP15737.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A0G2JGX4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0G2JGX4"
FT                   /protein_id="EDL24297.1"
FT                   /translation="MGSGGSDSYRVATSQDKKDDKSSPKKSKAKERRDLDDLKKEVAMT
FT                   EHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFS
FT                   ILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMES
FT                   FKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLT
FT                   GESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLE
FT                   VGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLL
FT                   ATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQ
FT                   IHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESA
FT                   LLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERI
FT                   LDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDC
FT                   DDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVG
FT                   IISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFA
FT                   RTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMIL
FT                   LDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILC
FT                   IDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFS
FT                   YFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIV
FT                   VVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPS
FT                   WWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY"
FT   CDS             complement(join(1580633..1580873,1581163..1581264,
FT                   1581878..1582008,1582419..1582564,1583387..1583510,
FT                   1583610..1583764,1589303..1589471,1589846..1589996,
FT                   1591436..1591572,1591657..1591832,1592231..1592423,
FT                   1596003..1596137,1596221..1596330,1596407..1596605,
FT                   1599003..1599271,1599384..1599501,1600545..1600679,
FT                   1600771..1600884,1602448..1602651,1602791..1602850,
FT                   1602943..1603029,1607626..1607631))
FT                   /codon_start=1
FT                   /gene="Atp1a3"
FT                   /locus_tag="mCG_7257"
FT                   /product="ATPase, Na+/K+ transporting, alpha 3 polypeptide,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG7257.1 transcript_id=mCT172021.0
FT                   protein_id=mCP94940.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8VCE0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88107"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VCE0"
FT                   /protein_id="EDL24298.1"
FT                   /translation="MGDKKDDKSSPKKSKAKERRDLDDLKKEVAMTEHKMSVEEVCRKY
FT                   NTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLA
FT                   YGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIR
FT                   EGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCT
FT                   HDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHF
FT                   IQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR
FT                   MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGT
FT                   SFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVK
FT                   LMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKE
FT                   QPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFV
FT                   GLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIA
FT                   ARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEG
FT                   CQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVE
FT                   EGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISL
FT                   AYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPG
FT                   NLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTR
FT                   RNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIF
FT                   VYDEIRKLILRRNPGGEGRMARGKGWEGKQRVSTPCASQMCPFFFLFPLSPPCLSLSFQ
FT                   VRLCV"
FT   gene            complement(1611723..1674330)
FT                   /gene="Grik5"
FT                   /locus_tag="mCG_7246"
FT                   /note="gene_id=mCG7246.2"
FT   mRNA            complement(join(1611723..1612664,1615456..1615577,
FT                   1615660..1615788,1617175..1617400,1617678..1617843,
FT                   1624311..1624484,1624856..1624965,1625153..1625266,
FT                   1648128..1648331,1660316..1660423,1660526..1660630,
FT                   1660973..1661125,1662502..1662663,1662762..1662815,
FT                   1664910..1665088,1667161..1667326,1667405..1667502,
FT                   1670017..1670206,1670476..1670604,1674071..>1674134))
FT                   /gene="Grik5"
FT                   /locus_tag="mCG_7246"
FT                   /product="glutamate receptor, ionotropic, kainate 5 (gamma
FT                   2), transcript variant mCT191910"
FT                   /note="gene_id=mCG7246.2 transcript_id=mCT191910.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1611746..1612664,1615456..1615577,
FT                   1615660..1615788,1617175..1617400,1617678..1617843,
FT                   1624311..1624484,1624856..1624965,1625153..1625266,
FT                   1648128..1648331,1660316..1660423,1660526..1660630,
FT                   1660973..1661125,1662502..1662663,1662762..1662815,
FT                   1664910..1665088,1667161..1667326,1667405..1667502,
FT                   1670042..1670206,1670476..1670604,1674071..1674330))
FT                   /gene="Grik5"
FT                   /locus_tag="mCG_7246"
FT                   /product="glutamate receptor, ionotropic, kainate 5 (gamma
FT                   2), transcript variant mCT3697"
FT                   /note="gene_id=mCG7246.2 transcript_id=mCT3697.1 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(1612239..1612664,1615456..1615577,
FT                   1615660..1615788,1617175..1617400,1617678..1617843,
FT                   1624311..1624484,1624856..1624965,1625153..1625266,
FT                   1648128..1648331,1660316..1660423,1660526..1660630,
FT                   1660973..1661125,1662502..1662663,1662762..1662815,
FT                   1664910..1665088,1667161..1667326,1667405..1667502,
FT                   1670042..1670206,1670476..1670554))
FT                   /codon_start=1
FT                   /gene="Grik5"
FT                   /locus_tag="mCG_7246"
FT                   /product="glutamate receptor, ionotropic, kainate 5 (gamma
FT                   2), isoform CRA_b"
FT                   /note="gene_id=mCG7246.2 transcript_id=mCT3697.1
FT                   protein_id=mCP15712.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q61626"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95818"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61626"
FT                   /protein_id="EDL24295.1"
FT                   /translation="MPAELLLLLIVAFANPSCQVLSSLRMAAILDDQTVCGRGERLALA
FT                   LAREQINGIIEVPAKARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASAS
FT                   TVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASL
FT                   ICAKAECLLRLEELVRGFLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASI
FT                   SHLVLRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFV
FT                   RSLNMSWRENCEASTYPGPALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIW
FT                   PHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAM
FT                   NATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELL
FT                   RFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM
FT                   TLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPH
FT                   PCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSY
FT                   TANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQ
FT                   SKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMP
FT                   LGSPFRDEITLAILQLQENNRLEILKRKWWEGGRCPKEEDHRAKGLGMENIGGIFVVLI
FT                   CGLIIAVFVAVMEFIWSTRRSAESEEVSVCQEMLQELRHAVSCRKTSRSRRRRRPGGPS
FT                   RALLSLRAVREMRLSNGKLYSAGAGGDAGAHGGPQRLLDDPGPPGGPRPQAPTPCTHVR
FT                   VCQECRRIQALRASGAGAPPRGLGTPAEATSPPRPRPGPTGPRELTEHE"
FT   CDS             complement(join(1612239..1612664,1615456..1615577,
FT                   1615660..1615788,1617175..1617400,1617678..1617843,
FT                   1624311..1624484,1624856..1624965,1625153..1625266,
FT                   1648128..1648331,1660316..1660423,1660526..1660630,
FT                   1660973..1661125,1662502..1662663,1662762..1662815,
FT                   1664910..1665088,1667161..1667326,1667405..1667502,
FT                   1670017..>1670089))
FT                   /codon_start=1
FT                   /gene="Grik5"
FT                   /locus_tag="mCG_7246"
FT                   /product="glutamate receptor, ionotropic, kainate 5 (gamma
FT                   2), isoform CRA_a"
FT                   /note="gene_id=mCG7246.2 transcript_id=mCT191910.0
FT                   protein_id=mCP112857.0 isoform=CRA_a"
FT                   /protein_id="EDL24294.1"
FT                   /translation="TSLSCSGTASTRPRTPVSGASGAWVCQILPKGVVSVLGPSSSPAS
FT                   ASTVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSA
FT                   SLICAKAECLLRLEELVRGFLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANA
FT                   SISHLVLRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPE
FT                   FVRSLNMSWRENCEASTYPGPALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSAN
FT                   IWPHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTL
FT                   AMNATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALSGNERFEGFCVDMLRELAE
FT                   LLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKP
FT                   FMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYN
FT                   PHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIIS
FT                   SYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNY
FT                   MQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIG
FT                   MPLGSPFRDEITLAILQLQENNRLEILKRKWWEGGRCPKEEDHRAKGLGMENIGGIFVV
FT                   LICGLIIAVFVAVMEFIWSTRRSAESEEVSVCQEMLQELRHAVSCRKTSRSRRRRRPGG
FT                   PSRALLSLRAVREMRLSNGKLYSAGAGGDAGAHGGPQRLLDDPGPPGGPRPQAPTPCTH
FT                   VRVCQECRRIQALRASGAGAPPRGLGTPAEATSPPRPRPGPTGPRELTEHE"
FT   assembly_gap    1644239..1644354
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    1647222..1647249
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    1653918..1654106
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    1674446..1674546
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    1677497..1677642
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            1679294..1684583
FT                   /gene="Zfp574"
FT                   /locus_tag="mCG_7274"
FT                   /note="gene_id=mCG7274.2"
FT   mRNA            join(1679294..1679438,1681491..1684583)
FT                   /gene="Zfp574"
FT                   /locus_tag="mCG_7274"
FT                   /product="zinc finger protein 574"
FT                   /note="gene_id=mCG7274.2 transcript_id=mCT3667.2 created on
FT                   12-AUG-2002"
FT   CDS             1681511..1684261
FT                   /codon_start=1
FT                   /gene="Zfp574"
FT                   /locus_tag="mCG_7274"
FT                   /product="zinc finger protein 574"
FT                   /note="gene_id=mCG7274.2 transcript_id=mCT3667.2
FT                   protein_id=mCP15749.2 partial"
FT                   /protein_id="EDL24293.1"
FT                   /translation="MTEESEETVLYIEHRYVCSECNQLYGSLEEVLVHQNSHVPQQHFE
FT                   LVGVADPGVTVATEAASGTGLYQTLIQESQYQCLECGQLLLSPSQLLEHQELHLKMMAP
FT                   QEAVPAKPPPKVPPLGSSAIHYECVDCKALFASQEMWLSHRQTHLRATPNKAPAPVVLG
FT                   SPVVLGPPVGQARVAVEHSYRKAEEGGEGAAVXXXXXXXEEGGEGAAVPSVAATTEMVT
FT                   EVELLLYKCSECSQLFQMPADFLEHQATHFPAPVPEAAEPATQQETQVPSPTEAAVSQP
FT                   EPLPASDHSYELRNELRNGEAIGRDRRGRKPRRNNSGESGGAATQELFCSACDQLFLSP
FT                   HQLQQHLRSHREGVFKCPLCSRVFPSPSSLDQHLGDHSSESHFLCVDCGLAFGTEALLL
FT                   AHRRAHTPNPLHSCPCGKTFVNLTKFLYHRRTHGAGGVPLPTTPVPPEEPAISFPEPAP
FT                   AETGELEAPELPVCEESSAEPAAPGSYRCLLCSREFGKALQLTRHQRFVHRLERRHKCS
FT                   ICGKMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTGERPYRCGDCG
FT                   KAFTQSSTLRQHRLVHAQHFPYRCQECGVRFHRPYRLLMHRYHHTGEYPYKCRECPRSF
FT                   LLRRLLEVHQLVIHAGRQPYRCSSCGAAFPSSLRLREHRCAAAAAQAPRRFECGTCGKK
FT                   VGSAARLQAHEAAHAAAGPGEVLAKEPPAPRASRATRTPVAPSPTALSGTTSAAPAAPA
FT                   RRRGPECSECKKLFSTETSLQVHRRIHTGERPYPCPDCGKAFRQSTHLKDHRRLHTGER
FT                   PFACEVCGKAFAISMRLAEHRRIHTGERPYSCPDCGKSYRSFSNLWKHRKTHQQQHQAA
FT                   VRQQLAEAEAAVGLAVMETAVEALPLVEAIEIYPLAEADGVQISG"
FT   assembly_gap    1682095..1682114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1691126..1691329
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    1692409..1692514
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(1694524..>1734069)
FT                   /gene="Pou2f2"
FT                   /locus_tag="mCG_7242"
FT                   /note="gene_id=mCG7242.1"
FT   mRNA            complement(join(1694524..1694876,1695359..1695468,
FT                   1695663..1695723,1696827..1696893,1698908..1699084,
FT                   1699160..1699308,1699411..1699552,1699672..1699785,
FT                   1701970..1702061,1702156..1702261,1723037..1723093,
FT                   1723220..1723254,1723352..1723417,1734034..1734069))
FT                   /gene="Pou2f2"
FT                   /locus_tag="mCG_7242"
FT                   /product="POU domain, class 2, transcription factor 2,
FT                   transcript variant mCT171755"
FT                   /note="gene_id=mCG7242.1 transcript_id=mCT171755.0 created
FT                   on 07-AUG-2002"
FT   mRNA            complement(join(1694524..1694876,1695359..1695424,
FT                   1696827..1696893,1698908..1699084,1699160..1699308,
FT                   1699411..1699552,1699672..1699785,1701970..1702061,
FT                   1702156..1702261,1718172..1718288,1723037..1723093,
FT                   1723220..1723254,1723352..1723417,1734034..>1734069))
FT                   /gene="Pou2f2"
FT                   /locus_tag="mCG_7242"
FT                   /product="POU domain, class 2, transcription factor 2,
FT                   transcript variant mCT191900"
FT                   /note="gene_id=mCG7242.1 transcript_id=mCT191900.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1694524..1694876,1695359..1695468,
FT                   1695663..1695723,1696827..1696893,1698908..1699084,
FT                   1699160..1699308,1699411..1699552,1699672..1699785,
FT                   1701970..1702061,1702156..1702261,1718172..1718288,
FT                   1723037..1723093,1723220..1723254,1723352..1723417,
FT                   1734034..1734069))
FT                   /gene="Pou2f2"
FT                   /locus_tag="mCG_7242"
FT                   /product="POU domain, class 2, transcription factor 2,
FT                   transcript variant mCT3694"
FT                   /note="gene_id=mCG7242.1 transcript_id=mCT3694.2 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(1695372..1695424,1696827..1696893,
FT                   1698908..1699084,1699160..1699308,1699411..1699552,
FT                   1699672..1699785,1701970..1702061,1702156..1702261,
FT                   1718172..1718288,1723037..1723093,1723220..1723254,
FT                   1723352..1723417,1734034..>1734067))
FT                   /codon_start=1
FT                   /gene="Pou2f2"
FT                   /locus_tag="mCG_7242"
FT                   /product="POU domain, class 2, transcription factor 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG7242.1 transcript_id=mCT191900.0
FT                   protein_id=mCP112856.0 isoform=CRA_a"
FT                   /protein_id="EDL24290.1"
FT                   /translation="GSMVHSSMGAPEIRMSKPLEAEKQSLDSPSEHTDTERNGPDINHQ
FT                   NPQNKASPFSVSPTGPSTKIKAEDPSGDSAPAAPPPPQPAQPHLPQAQLMLTGSQLAGD
FT                   IQQLLQLQQLVLVPGHHLQPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPR
FT                   AGLPTQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDF
FT                   SQTTISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPG
FT                   RRRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKR
FT                   INPCSAAPMLPSPGKPTSYSPHLVTPQGGAGTLPLSQASSSLSTTAQTRALKAATRLLA
FT                   CRA"
FT   CDS             complement(join(1695372..1695468,1695663..1695723,
FT                   1696827..1696893,1698908..1699084,1699160..1699308,
FT                   1699411..1699552,1699672..1699785,1701970..1702061,
FT                   1702156..1702261,1723037..1723093,1723220..1723254,
FT                   1723352..1723417,1734034..1734061))
FT                   /codon_start=1
FT                   /gene="Pou2f2"
FT                   /locus_tag="mCG_7242"
FT                   /product="POU domain, class 2, transcription factor 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG7242.1 transcript_id=mCT171755.0
FT                   protein_id=mCP94674.0 isoform=CRA_b"
FT                   /protein_id="EDL24291.1"
FT                   /translation="MVHSSMGAPEIRMSKPLEAEKQSLDSPSEHTDTERNGPDINHQNP
FT                   QNKASPFSVSPTGPSTKDIQQLLQLQQLVLVPGHHLQPPAQFLLPQAQQSQPGLLPTPN
FT                   LFQLPQQTQGALLTSQPRAGLPTQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLG
FT                   FTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSL
FT                   PSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHM
FT                   EKEVIRVWFCNRRQKEKRINPCSAAPMLPSPGKPTSYSPHLVTPQGGAGTLPLSQASSS
FT                   LSTTVTTLSSAVGTLHPSRTAGGGGHPLCHSPHPRPPPTAQTRALKAATRLLACRA"
FT   CDS             complement(join(1695372..1695468,1695663..1695723,
FT                   1696827..1696893,1698908..1699084,1699160..1699308,
FT                   1699411..1699552,1699672..1699785,1701970..1702061,
FT                   1702156..1702261,1718172..1718288,1723037..1723093,
FT                   1723220..1723254,1723352..1723417,1734034..1734061))
FT                   /codon_start=1
FT                   /gene="Pou2f2"
FT                   /locus_tag="mCG_7242"
FT                   /product="POU domain, class 2, transcription factor 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG7242.1 transcript_id=mCT3694.2
FT                   protein_id=mCP15748.2 isoform=CRA_c"
FT                   /protein_id="EDL24292.1"
FT                   /translation="MVHSSMGAPEIRMSKPLEAEKQSLDSPSEHTDTERNGPDINHQNP
FT                   QNKASPFSVSPTGPSTKIKAEDPSGDSAPAAPPPPQPAQPHLPQAQLMLTGSQLAGDIQ
FT                   QLLQLQQLVLVPGHHLQPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAG
FT                   LPTQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQ
FT                   TTISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRR
FT                   RKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRIN
FT                   PCSAAPMLPSPGKPTSYSPHLVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRT
FT                   AGGGGHPLCHSPHPRPPPTAQTRALKAATRLLACRA"
FT   assembly_gap    1695469..1695662
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    1708212..1708231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1717968..1718070
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    1722639..1722703
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    1724915..1724934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1726295..1726670
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    1730966..1730985
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1734917..1735016
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    1740911..1741262
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    1751922..1752203
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    1767312..1767423
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    1792822..1792841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798430..1798534
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            complement(1804185..1821291)
FT                   /locus_tag="mCG_7275"
FT                   /note="gene_id=mCG7275.1"
FT   mRNA            complement(join(1804185..1805278,1812496..1812645,
FT                   1818909..1819031,1820165..1820531,1821151..1821291))
FT                   /locus_tag="mCG_7275"
FT                   /product="mCG7275, transcript variant mCT3669"
FT                   /note="gene_id=mCG7275.1 transcript_id=mCT3669.2 created on
FT                   12-AUG-2002"
FT   mRNA            complement(join(1804187..1805278,1812496..1812645,
FT                   1818909..1819031,1820165..1820395,1821151..>1821197))
FT                   /locus_tag="mCG_7275"
FT                   /product="mCG7275, transcript variant mCT191948"
FT                   /note="gene_id=mCG7275.1 transcript_id=mCT191948.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1804512..1805278,1807155..1807236,
FT                   1812496..1812645,1818909..1819031,1820165..1820531,
FT                   1821151..1821257))
FT                   /locus_tag="mCG_7275"
FT                   /product="mCG7275, transcript variant mCT173540"
FT                   /note="gene_id=mCG7275.1 transcript_id=mCT173540.0 created
FT                   on 12-AUG-2002"
FT   CDS             complement(join(1804887..1805278,1812496..1812645,
FT                   1818909..1819031,1820165..1820395,1821151..>1821196))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7275"
FT                   /product="mCG7275, isoform CRA_b"
FT                   /note="gene_id=mCG7275.1 transcript_id=mCT191948.0
FT                   protein_id=mCP112864.0 isoform=CRA_b"
FT                   /protein_id="EDL24288.1"
FT                   /translation="KWLRPSPRSHRTLESVGGQLTECELELLAFLLDEAPGAPGGLARA
FT                   RSGLELLLELERRGQCDESNLRLLSQLLRVLARHDLLPHLARKRRRPVSPERYSYGNPS
FT                   SSSKRTEDSCRRRRQASSSSDSPQSQWDTGSPPTKRQRRSRGRPSSGARQRRRAGLAAS
FT                   QQHQQHQELGRPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQA
FT                   TAVLRSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVR
FT                   LLVSVDEADYEAGRRRLLLMEEEGGRRGTEAS"
FT   CDS             complement(join(1804887..1805278,1812496..1812645,
FT                   1818909..1819031,1820165..1820492))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7275"
FT                   /product="mCG7275, isoform CRA_c"
FT                   /note="gene_id=mCG7275.1 transcript_id=mCT3669.2
FT                   protein_id=mCP15746.2 isoform=CRA_c"
FT                   /protein_id="EDL24289.1"
FT                   /translation="MALSGSTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELL
FT                   AFLLDEAPGAPGGLARARSGLELLLELERRGQCDESNLRLLSQLLRVLARHDLLPHLAR
FT                   KRRRPVSPERYSYGNPSSSSKRTEDSCRRRRQASSSSDSPQSQWDTGSPPTKRQRRSRG
FT                   RPSSGARQRRRAGLAASQQHQQHQELGRPSSEGKVTCDIRLRVRAEYCEHGPALEQGVA
FT                   SRRPQALARQLDVFGQATAVLRSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRG
FT                   VFLTEALREAVGREAVRLLVSVDEADYEAGRRRLLLMEEEGGRRGTEAS"
FT   CDS             complement(join(1807211..1807236,1812496..1812645,
FT                   1818909..1819031,1820165..1820492))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7275"
FT                   /product="mCG7275, isoform CRA_a"
FT                   /note="gene_id=mCG7275.1 transcript_id=mCT173540.0
FT                   protein_id=mCP96459.0 isoform=CRA_a"
FT                   /protein_id="EDL24287.1"
FT                   /translation="MALSGSTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELL
FT                   AFLLDEAPGAPGGLARARSGLELLLELERRGQCDESNLRLLSQLLRVLARHDLLPHLAR
FT                   KRRRPVSPERYSYGNPSSSSKRTEDSCRRRRQASSSSDSPQSQWDTGSPPTKRQRRSRG
FT                   RPSSGARQRRRAGLAASQQHQQHQELGRPSSEGKVTCDGETGSER"
FT   gene            1822817..1826383
FT                   /gene="Zfp526"
FT                   /locus_tag="mCG_49282"
FT                   /note="gene_id=mCG49282.2"
FT   mRNA            join(1822817..1822868,1825479..1825571,1825665..1826383)
FT                   /gene="Zfp526"
FT                   /locus_tag="mCG_49282"
FT                   /product="zinc finger protein 526"
FT                   /note="gene_id=mCG49282.2 transcript_id=mCT49465.2 created
FT                   on 12-AUG-2002"
FT   CDS             1825682..1826293
FT                   /codon_start=1
FT                   /gene="Zfp526"
FT                   /locus_tag="mCG_49282"
FT                   /product="zinc finger protein 526"
FT                   /note="gene_id=mCG49282.2 transcript_id=mCT49465.2
FT                   protein_id=mCP36598.2"
FT                   /protein_id="EDL24286.1"
FT                   /translation="MAEMVAEAAEIPTQSSGAVEISTAVSGELAEMATAVTEMTSGEAL
FT                   ASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHLLTMSEEETLTTQDAGLEPELVPSTG
FT                   EGPFQCGECSQLILSPSELLAHQDAHLQESASQIQYQCGDCQELFPSPELWVAHRKTQH
FT                   LSSAADEPPSPFASPNTPTTTTTTTTTTTTRSQDGTLRVP"
FT   gene            complement(1829632..1839682)
FT                   /gene="Gsk3a"
FT                   /locus_tag="mCG_147829"
FT                   /note="gene_id=mCG147829.0"
FT   mRNA            complement(join(1829632..1829939,1830439..1830794,
FT                   1831329..1831436,1831715..1831904,1832469..1832564,
FT                   1832649..1832746,1833499..1833605,1833698..1833828,
FT                   1835439..1835549,1835693..1835776,1837418..1837605,
FT                   1839435..1839682))
FT                   /gene="Gsk3a"
FT                   /locus_tag="mCG_147829"
FT                   /product="glycogen synthase kinase 3 alpha"
FT                   /note="gene_id=mCG147829.0 transcript_id=mCT188092.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    1829944..1829963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(1830718..1830794,1831329..1831436,
FT                   1831715..1831904,1832469..1832564,1832649..1832746,
FT                   1833499..1833605,1833698..1833828,1835439..1835549,
FT                   1835693..1835776,1837418..1837605,1839435..1839525))
FT                   /codon_start=1
FT                   /gene="Gsk3a"
FT                   /locus_tag="mCG_147829"
FT                   /product="glycogen synthase kinase 3 alpha"
FT                   /note="gene_id=mCG147829.0 transcript_id=mCT188092.0
FT                   protein_id=mCP108448.0"
FT                   /protein_id="EDL24285.1"
FT                   /translation="MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGDSGKVTTVVATVGQ
FT                   GPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLD
FT                   HCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLITPIIYIKVYMYQ
FT                   LFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYR
FT                   APELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIR
FT                   EMNPNYTEFKFPQIKAHPWTKVFKSSKTPPEAIALCSSLLEYTPSSRLSPLEACAHSFF
FT                   DELRRLGAQLPNDRPLPPLFNFSPGELSIQPSLNAILIPPHLRSPAGPASPLTTSYNPS
FT                   SQALTEAQTGQDWQPSDATTATLASSS"
FT   gene            complement(1846032..1852688)
FT                   /gene="Erf"
FT                   /locus_tag="mCG_7415"
FT                   /note="gene_id=mCG7415.1"
FT   mRNA            complement(join(1846032..1847395,1847498..1847613,
FT                   1847952..1848186,1852521..1852688))
FT                   /gene="Erf"
FT                   /locus_tag="mCG_7415"
FT                   /product="Ets2 repressor factor"
FT                   /note="gene_id=mCG7415.1 transcript_id=mCT3700.1 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(1846113..1847395,1847498..1847613,
FT                   1847952..1848186,1852521..1852542))
FT                   /codon_start=1
FT                   /gene="Erf"
FT                   /locus_tag="mCG_7415"
FT                   /product="Ets2 repressor factor"
FT                   /note="gene_id=mCG7415.1 transcript_id=mCT3700.1
FT                   protein_id=mCP15742.2"
FT                   /db_xref="GOA:P70459"
FT                   /db_xref="InterPro:IPR000418"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR032925"
FT                   /db_xref="MGI:MGI:109637"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70459"
FT                   /protein_id="EDL24284.1"
FT                   /translation="MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGV
FT                   IAWQGDYGEFVIKDPDEVARLWGVRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTY
FT                   KFNFNKLVLVNYPFIDMGLAGGAVPQSAPPVPSGGSHFRFPPSTPSEVLSPTEDPRSPP
FT                   ACSSSSSSLFSAVVARRLGRGSVSDCSDGTSELEEPLGEDPRARPPGPPELGAFRGPPL
FT                   ARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSP
FT                   TLSPMYPSGGGGPSGSGGGSHFSFSPEDMKRYLQAHTQSVYNYHLSPRAFLHYPGLVVP
FT                   QPQRPDKCPLPPMAPETPPVPSSASSSSSSSSSPFKFKLQPPPLGRRQRAAGEKALGGT
FT                   DKSSGGSGSGGLAEGAGAVAPPPPPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKT
FT                   PRAPPAPPKPEPGEAPGVAQCMPLKLRFKRRWSEDCRLEGGGCLSGGPEDEGEDKKVRG
FT                   DVGPGESGGPLTPRRVSSDLQHATAQLSLEHRDS"
FT   assembly_gap    1851644..1851663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1860115..1860134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1861587..1861606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1863488..1863876
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   gene            <1869541..>1872364
FT                   /locus_tag="mCG_1031252"
FT                   /note="gene_id=mCG1031252.1"
FT   mRNA            join(<1869541..1869682,1871973..>1872364)
FT                   /locus_tag="mCG_1031252"
FT                   /product="mCG1031252"
FT                   /note="gene_id=mCG1031252.1 transcript_id=mCT148956.1
FT                   created on 29-JAN-2003"
FT   CDS             join(<1869541..1869682,1871973..>1872364)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031252"
FT                   /product="mCG1031252"
FT                   /note="gene_id=mCG1031252.1 transcript_id=mCT148956.1
FT                   protein_id=mCP57441.1"
FT                   /protein_id="EDL24283.1"
FT                   /translation="AGPFTILCVGVKKKGRIERESRRGGGEGPDRTEPGPRPPAPKPRG
FT                   ARGGQTMKPMKKACPGLAGSASGSKSPPATRAKALRRRGAGEGDKPEEEEEAQPQEQAG
FT                   PEEAEEGEEEEAERDPGAEGTHPELQPNDPTPGLTEDPKGDGEAGRWEPSLSRKTATFK
FT                   SRAPKKKYVEEHGTG"
FT   assembly_gap    1883705..1883822
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   gene            1883916..1895250
FT                   /gene="Cic"
FT                   /locus_tag="mCG_141064"
FT                   /note="gene_id=mCG141064.1"
FT   mRNA            join(1883916..1884022,1885955..1886104,1886185..1886419,
FT                   1886516..1886645,1886740..1886922,1887004..1887169,
FT                   1887913..1888115,1888207..1888432,1888856..1888959,
FT                   1889180..1890407,1890494..1890681,1891677..1891798,
FT                   1891905..1892071,1892158..1892452,1892556..1892875,
FT                   1893170..1893420,1893520..1893674,1893756..1893887,
FT                   1894062..1894193,1894274..1895250)
FT                   /gene="Cic"
FT                   /locus_tag="mCG_141064"
FT                   /product="capicua homolog (Drosophila), transcript variant
FT                   mCT191905"
FT                   /note="gene_id=mCG141064.1 transcript_id=mCT191905.1
FT                   created on 29-SEP-2004"
FT   mRNA            join(1883916..1884022,1885955..1886104,1886185..1886419,
FT                   1886516..1886645,1886740..1886922,1887004..1887169,
FT                   1887913..1888115,1888207..1888432,1888856..1888959,
FT                   1889180..1890407,1890494..1890681,1891677..1891798,
FT                   1891905..1892071,1892161..1892448,1892556..1892875,
FT                   1893170..1893420,1893520..1893674,1893756..1893887,
FT                   1894062..1894193,1894274..1895250)
FT                   /gene="Cic"
FT                   /locus_tag="mCG_141064"
FT                   /product="capicua homolog (Drosophila), transcript variant
FT                   mCT194533"
FT                   /note="gene_id=mCG141064.1 transcript_id=mCT194533.0
FT                   created on 29-SEP-2004"
FT   mRNA            join(1883916..1884022,1885955..1886104,1886185..1886419,
FT                   1886516..1886645,1886740..1886922,1887004..1887169,
FT                   1887913..1888115,1888207..1888432,1888856..1888959,
FT                   1889180..1890407,1890494..1890681,1891677..1891798,
FT                   1891905..1892071,1892161..1892448,1892556..1892875,
FT                   1893170..1893420,1893523..1893674,1893756..1893887,
FT                   1894062..1894193,1894274..1895250)
FT                   /gene="Cic"
FT                   /locus_tag="mCG_141064"
FT                   /product="capicua homolog (Drosophila), transcript variant
FT                   mCT172901"
FT                   /note="gene_id=mCG141064.1 transcript_id=mCT172901.1
FT                   created on 29-SEP-2004"
FT   CDS             join(1883956..1884022,1885955..1886104,1886185..1886419,
FT                   1886516..1886645,1886740..1886922,1887004..1887169,
FT                   1887913..1888115,1888207..1888432,1888856..1888959,
FT                   1889180..1890407,1890494..1890681,1891677..1891798,
FT                   1891905..1892071,1892161..1892448,1892556..1892875,
FT                   1893170..1893420,1893520..1893674,1893756..1893887,
FT                   1894062..1894193,1894274..1894641)
FT                   /codon_start=1
FT                   /gene="Cic"
FT                   /locus_tag="mCG_141064"
FT                   /product="capicua homolog (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG141064.1 transcript_id=mCT194533.0
FT                   protein_id=mCP115562.0 isoform=CRA_c"
FT                   /protein_id="EDL24282.1"
FT                   /translation="MYSAHRPLIPASGAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLA
FT                   PSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHEQPPGGTGGADPGRPPGAVCPE
FT                   SPGPGPPLTLGGVDPGKSLPPTTEEEAPGPPGEPRLDSETESDHDDAFLSIMSPEIQLP
FT                   LPPGKRRTQSLSALPKERDSSSEKDGRSPNKREKDHIRRPMNAFMIFSKRHRALVHQRH
FT                   PNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSEA
FT                   KPASLGLAGGHKETRERSMSETGTAAAPGVSSELLSVAAQTLLSSDTKVPGSGPCGAER
FT                   LHAVGAPGSARPRAFSHSGVHSLDGGEVDSQALQELTQMVSGPASYSGPKPSPQYGAPG
FT                   SFAAPGEGGTLATSGRPPLLPSRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDSF
FT                   GTTDIDLKCKERVTDSESGDSSGEDPEGNKGFGRKVFSPVIRSSFTHCRPTLDPEPPGP
FT                   PDPPAAFSKGYGPTPSSSSSPASTSVSVSTSFSLGSGTFKTQESGQGSTAVPLRPPPPG
FT                   AGGPATPSKATRFPPTDSATFRRKRPESVGSLEAPGPSVIAAPPSGGGNLLQTLVLPPS
FT                   KEDREGTRVPSAPAPPLAYGAPAAPLCRPAATMVTNVVRPVSSTPVPIASKPFPTSGRA
FT                   EASSNDIAGARTEMGTGSRVPGGSPMGVSLVYSDKKSAAAATSPAPHLVAGPLLGTVGK
FT                   APATVTNLLVGTPGYGAPASPAVQFIAQGAPGSATPAGSGASTGSGPNGPVPLGILQPG
FT                   ALGKAGGITQVQYILPTLPQQLQVAPAPAPAPGTKAAAPSGPAPTTSIRFTLPPGTSTN
FT                   GKVLAATAPTAGIPILQSVPSAPPPKAQSVSPVQATPSGGSAQLLPGKVLVPLAAPSMS
FT                   VRGGGAGQPLPLVSSPFSVPVQNGAQQPSKIIQLTPVPVSTPSGLVPPLSPATMPGPTS
FT                   QPQKVLLPSSTRITYVQSAGGHTLPLGTSSACSQTGTVTSYGPTSSVALGFTSLGPSGP
FT                   AFVQPLLSGQAPLLAPGQVGVSPVPSPQLPPACTASGGPVITAFYPGSPAPTSAPLGPP
FT                   SQAPPSLVYTVATSTTPPAATILPKGPPASATATPAPTSPFPSATGSMTYSLVAPKAQR
FT                   PSPKAPQKVKAAIASIPVGSFESGTTGRPGSTPRQSSDSGVAREPAAPESELEGQPTPP
FT                   APPPPTETWPPTARSSPPPPLPAEERPGTKGPETASKFPSSSSDWRVPGLGLESRGEPP
FT                   TPPSPAPATGPSGSSSGSSEGSSGRAAGDTPERKEVTSSGKKMKVRPPPLKKTFDSVDN
FT                   RVLSEVDFEERFAELPEFRPEEVLPSPTLQSLATSPRAILGSYRKKRKNSTDLDSAPED
FT                   PTSPKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTGTETEDVLGELEYEKVPYSSLRR
FT                   TLDQRRALVMQLFQDHGFFPSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQAATP
FT                   TEQPPGAEAPLPGPPPTGMAATPVPTPSPAGGPDPTSPGSDSGTAQVAPPLPPPPEPGP
FT                   GQPGWEGAPQPSPPPSGPSTAATGR"
FT   CDS             join(1883956..1884022,1885955..1886104,1886185..1886419,
FT                   1886516..1886645,1886740..1886922,1887004..1887169,
FT                   1887913..1888115,1888207..1888432,1888856..1888959,
FT                   1889180..1890407,1890494..1890681,1891677..1891798,
FT                   1891905..1892071,1892161..1892448,1892556..1892875,
FT                   1893170..1893420,1893523..1893674,1893756..1893887,
FT                   1894062..1894193,1894274..1894641)
FT                   /codon_start=1
FT                   /gene="Cic"
FT                   /locus_tag="mCG_141064"
FT                   /product="capicua homolog (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG141064.1 transcript_id=mCT172901.1
FT                   protein_id=mCP95820.1 isoform=CRA_a"
FT                   /protein_id="EDL24280.1"
FT                   /translation="MYSAHRPLIPASGAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLA
FT                   PSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHEQPPGGTGGADPGRPPGAVCPE
FT                   SPGPGPPLTLGGVDPGKSLPPTTEEEAPGPPGEPRLDSETESDHDDAFLSIMSPEIQLP
FT                   LPPGKRRTQSLSALPKERDSSSEKDGRSPNKREKDHIRRPMNAFMIFSKRHRALVHQRH
FT                   PNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSEA
FT                   KPASLGLAGGHKETRERSMSETGTAAAPGVSSELLSVAAQTLLSSDTKVPGSGPCGAER
FT                   LHAVGAPGSARPRAFSHSGVHSLDGGEVDSQALQELTQMVSGPASYSGPKPSPQYGAPG
FT                   SFAAPGEGGTLATSGRPPLLPSRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDSF
FT                   GTTDIDLKCKERVTDSESGDSSGEDPEGNKGFGRKVFSPVIRSSFTHCRPTLDPEPPGP
FT                   PDPPAAFSKGYGPTPSSSSSPASTSVSVSTSFSLGSGTFKTQESGQGSTAVPLRPPPPG
FT                   AGGPATPSKATRFPPTDSATFRRKRPESVGSLEAPGPSVIAAPPSGGGNLLQTLVLPPS
FT                   KEDREGTRVPSAPAPPLAYGAPAAPLCRPAATMVTNVVRPVSSTPVPIASKPFPTSGRA
FT                   EASSNDIAGARTEMGTGSRVPGGSPMGVSLVYSDKKSAAAATSPAPHLVAGPLLGTVGK
FT                   APATVTNLLVGTPGYGAPASPAVQFIAQGAPGSATPAGSGASTGSGPNGPVPLGILQPG
FT                   ALGKAGGITQVQYILPTLPQQLQVAPAPAPAPGTKAAAPSGPAPTTSIRFTLPPGTSTN
FT                   GKVLAATAPTAGIPILQSVPSAPPPKAQSVSPVQATPSGGSAQLLPGKVLVPLAAPSMS
FT                   VRGGGAGQPLPLVSSPFSVPVQNGAQQPSKIIQLTPVPVSTPSGLVPPLSPATMPGPTS
FT                   QPQKVLLPSSTRITYVQSAGGHTLPLGTSSACSQTGTVTSYGPTSSVALGFTSLGPSGP
FT                   AFVQPLLSGQAPLLAPGQVGVSPVPSPQLPPACTASGGPVITAFYPGSPAPTSAPLGPP
FT                   SQAPPSLVYTVATSTTPPAATILPKGPPASATATPAPTSPFPSATGSMTYSLVAPKAQR
FT                   PSPKAPQKVKAAIASIPVGSFESGTTGRPGSTPRQSSDSGVAREPAAPESELEGQPTPP
FT                   APPPPTETWPPTARSSPPPPLPAEERPGTKGPETASKFPSSSSDWRVPGLGLESRGEPP
FT                   TPPSPAPATGPSGSSSGSSEGSSGRAAGDTPERKEVTSSGKKMKVRPPPLKKTFDSVDK
FT                   VLSEVDFEERFAELPEFRPEEVLPSPTLQSLATSPRAILGSYRKKRKNSTDLDSAPEDP
FT                   TSPKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTGTETEDVLGELEYEKVPYSSLRRT
FT                   LDQRRALVMQLFQDHGFFPSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQAATPT
FT                   EQPPGAEAPLPGPPPTGMAATPVPTPSPAGGPDPTSPGSDSGTAQVAPPLPPPPEPGPG
FT                   QPGWEGAPQPSPPPSGPSTAATGR"
FT   CDS             join(1883956..1884022,1885955..1886104,1886185..1886419,
FT                   1886516..1886645,1886740..1886922,1887004..1887169,
FT                   1887913..1888115,1888207..1888432,1888856..1888959,
FT                   1889180..1890407,1890494..1890681,1891677..1891798,
FT                   1891905..1892071,1892158..1892452,1892556..1892661)
FT                   /codon_start=1
FT                   /gene="Cic"
FT                   /locus_tag="mCG_141064"
FT                   /product="capicua homolog (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG141064.1 transcript_id=mCT191905.1
FT                   protein_id=mCP112875.1 isoform=CRA_b"
FT                   /protein_id="EDL24281.1"
FT                   /translation="MYSAHRPLIPASGAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLA
FT                   PSQPDPSVQPSEAQQPASHPVASNQSKEPAESAAVAHEQPPGGTGGADPGRPPGAVCPE
FT                   SPGPGPPLTLGGVDPGKSLPPTTEEEAPGPPGEPRLDSETESDHDDAFLSIMSPEIQLP
FT                   LPPGKRRTQSLSALPKERDSSSEKDGRSPNKREKDHIRRPMNAFMIFSKRHRALVHQRH
FT                   PNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSEA
FT                   KPASLGLAGGHKETRERSMSETGTAAAPGVSSELLSVAAQTLLSSDTKVPGSGPCGAER
FT                   LHAVGAPGSARPRAFSHSGVHSLDGGEVDSQALQELTQMVSGPASYSGPKPSPQYGAPG
FT                   SFAAPGEGGTLATSGRPPLLPSRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDSF
FT                   GTTDIDLKCKERVTDSESGDSSGEDPEGNKGFGRKVFSPVIRSSFTHCRPTLDPEPPGP
FT                   PDPPAAFSKGYGPTPSSSSSPASTSVSVSTSFSLGSGTFKTQESGQGSTAVPLRPPPPG
FT                   AGGPATPSKATRFPPTDSATFRRKRPESVGSLEAPGPSVIAAPPSGGGNLLQTLVLPPS
FT                   KEDREGTRVPSAPAPPLAYGAPAAPLCRPAATMVTNVVRPVSSTPVPIASKPFPTSGRA
FT                   EASSNDIAGARTEMGTGSRVPGGSPMGVSLVYSDKKSAAAATSPAPHLVAGPLLGTVGK
FT                   APATVTNLLVGTPGYGAPASPAVQFIAQGAPGSATPAGSGASTGSGPNGPVPLGILQPG
FT                   ALGKAGGITQVQYILPTLPQQLQVAPAPAPAPGTKAAAPSGPAPTTSIRFTLPPGTSTN
FT                   GKVLAATAPTAGIPILQSVPSAPPPKAQSVSPVQATPSGGSAQLLPGKVLVPLAAPSMS
FT                   VRGGGAGQPLPLVSSPFSVPVQNGAQQPSKIIQLTPVPVSTPSGLVPPLSPATMPGPTS
FT                   QPQKVLLPSSTRITYVQSAGGHTLPLGTSSACSQTGTVTSYGPTSSVALGFTSLGPSGP
FT                   AFVQPLLSAGQAPLLAPGQVGVSPVPSPQLPPACTASGGPVITAFYPGSPAPTSAPLGP
FT                   PSQAPPSLVYTVATSTTPPAATILPKGPPASATATPAPTSPFPSATGRLHDLQLSGSQS
FT                   SATQPKSSPESKGSHCQHSCGVF"
FT   gene            complement(1896154..1899060)
FT                   /gene="Pafah1b3"
FT                   /locus_tag="mCG_7263"
FT                   /note="gene_id=mCG7263.0"
FT   mRNA            complement(join(1896154..1896481,1897226..1897348,
FT                   1897426..1897542,1898191..1898280,1898477..1898575,
FT                   1898948..1899060))
FT                   /gene="Pafah1b3"
FT                   /locus_tag="mCG_7263"
FT                   /product="platelet-activating factor acetylhydrolase,
FT                   isoform 1b, alpha1 subunit, transcript variant mCT3681"
FT                   /note="gene_id=mCG7263.0 transcript_id=mCT3681.0 created on
FT                   29-SEP-2004"
FT   CDS             complement(join(1896194..1896481,1897226..1897348,
FT                   1897426..1897542,1898191..1898280,1898477..1898557))
FT                   /codon_start=1
FT                   /gene="Pafah1b3"
FT                   /locus_tag="mCG_7263"
FT                   /product="platelet-activating factor acetylhydrolase,
FT                   isoform 1b, alpha1 subunit, isoform CRA_a"
FT                   /note="gene_id=mCG7263.0 transcript_id=mCT3681.0
FT                   protein_id=mCP15740.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TJC2"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="MGI:MGI:108414"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJC2"
FT                   /protein_id="EDL24278.1"
FT                   /translation="MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFI
FT                   GDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGT
FT                   NNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAA
FT                   LAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQG
FT                   QGIPLPETAS"
FT   mRNA            complement(join(1897071..1897348,1897426..1897542,
FT                   1898191..1898280,1898477..1898575,1898948..1899060))
FT                   /gene="Pafah1b3"
FT                   /locus_tag="mCG_7263"
FT                   /product="platelet-activating factor acetylhydrolase,
FT                   isoform 1b, alpha1 subunit, transcript variant mCT171759"
FT                   /note="gene_id=mCG7263.0 transcript_id=mCT171759.1 created
FT                   on 29-SEP-2004"
FT   CDS             complement(join(1897163..1897348,1897426..1897542,
FT                   1898191..1898280,1898477..1898557))
FT                   /codon_start=1
FT                   /gene="Pafah1b3"
FT                   /locus_tag="mCG_7263"
FT                   /product="platelet-activating factor acetylhydrolase,
FT                   isoform 1b, alpha1 subunit, isoform CRA_b"
FT                   /note="gene_id=mCG7263.0 transcript_id=mCT171759.1
FT                   protein_id=mCP94678.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8CA83"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="MGI:MGI:108414"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CA83"
FT                   /protein_id="EDL24279.1"
FT                   /translation="MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFI
FT                   GDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGT
FT                   NNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLVRALEEWQRKRGSGCGGTCL"
FT   gene            <1907211..1917537
FT                   /gene="Tmem145"
FT                   /locus_tag="mCG_141065"
FT                   /note="gene_id=mCG141065.1"
FT   mRNA            join(<1907211..1907388,1908194..1908268,1908383..1908460,
FT                   1908553..1908639,1908722..1908823,1908926..1909010,
FT                   1909108..1909179,1909294..1909362,1909684..1909764,
FT                   1909868..1909946,1910084..1910177,1910712..1910884,
FT                   1912691..1912811,1916041..1916247,1916739..1917537)
FT                   /gene="Tmem145"
FT                   /locus_tag="mCG_141065"
FT                   /product="transmembrane protein 145, transcript variant
FT                   mCT191909"
FT                   /note="gene_id=mCG141065.1 transcript_id=mCT191909.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1907212..1907388,1908194..1908268,1908383..1908460,
FT                   1908553..1908639,1908722..1908823,1908926..1909010,
FT                   1909108..1909179,1909294..1909362,1909684..1909764,
FT                   1909868..1909946,1910084..1910177,1910712..1910884,
FT                   1912691..1912811,1916041..1916247,1916739..1916987)
FT                   /codon_start=1
FT                   /gene="Tmem145"
FT                   /locus_tag="mCG_141065"
FT                   /product="transmembrane protein 145, isoform CRA_b"
FT                   /note="gene_id=mCG141065.1 transcript_id=mCT191909.0
FT                   protein_id=mCP112876.0 isoform=CRA_b"
FT                   /protein_id="EDL24277.1"
FT                   /translation="PPSPGRSGSRSRAEARAGGMEPSRAPVLRRLLPPLLLLLLPLYPR
FT                   TRAKYVRGNLSSKEDWVFLTRFCFLSDYGRLDFRFRYPEAKCCQNILLYFDDPSQWPAV
FT                   YKARDKDCLAKESVIRPENNQVINLTTQYAWSGCQVVSEEGTRYLSCSSGRSFRSVRER
FT                   WWYIALSKCGGDGLQLEYEMVLTNGKSFWTRHFSADEFGILETDVTFLLIFTLIFVLSC
FT                   YFGYLLKGRQLLHTTYKMFMAAAGVEVLSLLFFCIYWGQYATDGIGNGSVKILAKLLFS
FT                   SSFLIFLLTLILLGKGFTVTRGRISHSGSVKLSVYMTLYTLTHVVLLIYEAEFFDPGQV
FT                   LYTYESPAGYGLIGLQVAAYVWFCYAVLVSLRHYPEKQPFYVPFFAAYTLWFFAVPVMA
FT                   LIANFGIPKWAREKIVNGIQLGIHLYAHGVFLIMTRPSAANKNFPYHVRTSQIASAGVP
FT                   GPGGSQSADKAFPQHVYGNVTFISDSVPNFTELFSIPPPTSSAGKQVEETAVAAAVAPR
FT                   GRVVTMAEPGAASPPPPARFSKAVDSGWDGPTPSYQPLVPQTAAPHTGFTEYFSMHTAG
FT                   GPAPPV"
FT   mRNA            join(<1908194..1908268,1908383..1908460,1908553..1908639,
FT                   1908722..1908823,1908926..1909010,1909108..1909179,
FT                   1909294..1909362,1909684..1909764,1909868..1909946,
FT                   1910084..1910177,1910712..1910884,1912691..1912811,
FT                   1916041..1916436,1916739..>1916987)
FT                   /gene="Tmem145"
FT                   /locus_tag="mCG_141065"
FT                   /product="transmembrane protein 145, transcript variant
FT                   mCT172900"
FT                   /note="gene_id=mCG141065.1 transcript_id=mCT172900.0
FT                   created on 03-SEP-2002"
FT   CDS             join(<1908194..1908268,1908383..1908460,1908553..1908639,
FT                   1908722..1908823,1908926..1909010,1909108..1909179,
FT                   1909294..1909362,1909684..1909764,1909868..1909946,
FT                   1910084..1910177,1910712..1910884,1912691..1912811,
FT                   1916041..1916436,1916739..1916987)
FT                   /codon_start=1
FT                   /gene="Tmem145"
FT                   /locus_tag="mCG_141065"
FT                   /product="transmembrane protein 145, isoform CRA_a"
FT                   /note="gene_id=mCG141065.1 transcript_id=mCT172900.0
FT                   protein_id=mCP95819.0 isoform=CRA_a"
FT                   /protein_id="EDL24276.1"
FT                   /translation="DWVFLTRFCFLSDYGRLDFRFRYPEAKCCQNILLYFDDPSQWPAV
FT                   YKARDKDCLAKESVIRPENNQVINLTTQYAWSGCQVVSEEGTRYLSCSSGRSFRSVRER
FT                   WWYIALSKCGGDGLQLEYEMVLTNGKSFWTRHFSADEFGILETDVTFLLIFTLIFVLSC
FT                   YFGYLLKGRQLLHTTYKMFMAAAGVEVLSLLFFCIYWGQYATDGIGNGSVKILAKLLFS
FT                   SSFLIFLLTLILLGKGFTVTRGRISHSGSVKLSVYMTLYTLTHVVLLIYEAEFFDPGQV
FT                   LYTYESPAGYGLIGLQVAAYVWFCYAVLVSLRHYPEKQPFYVPFFAAYTLWFFAVPVMA
FT                   LIANFGIPKWAREKIVNGIQLGIHLYAHGVFLIMTRPSAANKNFPYHVRTSQIASAGVP
FT                   GPGGSQSADKAFPQHVYGNVTFISDSVPNFTELFSIPPPTSSVSSAAPAPEELLAPPLE
FT                   YLTPLPAPPPPPAHWRLSPPLAFRTPHAPTPRLDRPPAPAPTLPDWAGKQVEETAVAAA
FT                   VAPRGRVVTMAEPGAASPPPPARFSKAVDSGWDGPTPSYQPLVPQTAAPHTGFTEYFSM
FT                   HTAGGPAPPV"
FT   assembly_gap    1911810..1911829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1931642..1967300
FT                   /locus_tag="mCG_145770"
FT                   /note="gene_id=mCG145770.0"
FT   mRNA            join(1931642..1931663,1932073..1932218,1932401..1932523,
FT                   1935145..1935299,1935516..1935635,1935953..1936094,
FT                   1936179..1936342,1939161..1939361,1939746..1939946,
FT                   1940852..1941088,1941606..1941724,1941804..1941935,
FT                   1942020..1942133,1942359..1942607,1943085..1943284,
FT                   1943600..1943810,1943907..1944156,1945053..1945185,
FT                   1947487..1947734,1947813..1947923,1948063..1948181,
FT                   1948703..1948910,1949611..1949791,1950302..1950465,
FT                   1951042..1951186,1955113..1955344,1956400..1956523,
FT                   1956689..1956902,1957121..1957335,1959632..1959839,
FT                   1960003..1960162,1960441..1960633,1961130..1961300,
FT                   1961496..1961626,1962041..1962173,1964709..1967300)
FT                   /locus_tag="mCG_145770"
FT                   /product="mCG145770"
FT                   /note="gene_id=mCG145770.0 transcript_id=mCT185850.0
FT                   created on 17-JUN-2003"
FT   CDS             join(1932206..1932218,1932401..1932523,1935145..1935299,
FT                   1935516..1935635,1935953..1936094,1936179..1936342,
FT                   1939161..1939361,1939746..1939946,1940852..1941088,
FT                   1941606..1941724,1941804..1941935,1942020..1942133,
FT                   1942359..1942607,1943085..1943284,1943600..1943810,
FT                   1943907..1944156,1945053..1945185,1947487..1947734,
FT                   1947813..1947923,1948063..1948181,1948703..1948910,
FT                   1949611..1949791,1950302..1950465,1951042..1951186,
FT                   1955113..1955344,1956400..1956523,1956689..1956902,
FT                   1957121..1957335,1959632..1959839,1960003..1960162,
FT                   1960441..1960633,1961130..1961300,1961496..1961626,
FT                   1962041..1962173,1964709..1965977)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145770"
FT                   /product="mCG145770"
FT                   /note="gene_id=mCG145770.0 transcript_id=mCT185850.0
FT                   protein_id=mCP107108.0"
FT                   /protein_id="EDL24275.1"
FT                   /translation="MVVYGGNVHTHYQEEKCYEDGIFFYHLGCHQWVSGAELAPPGTPE
FT                   GRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDLMAYKVPPFVFQAPALDYHLDYCS
FT                   MYTDHSVCSRDPECSWCQGACQAAPPPGTPSGACPAASCLGLGRLLSDCQACLAFSSPT
FT                   APPRGPGALGWCVHNESCLPRQQARCRGEQISGTVGWWGPAPVFVTSLEACVTQSFLPG
FT                   LHLLTFQQPPNASQPDKVSIVRSTTITLTPSPETDVSLVYRGFIHPLLPGGPGGPGAED
FT                   VAVWARAQRLHVLARMARGPDTENMEEVGRWVAQQEKETRRLQRPGSDRLFPLPGRGNK
FT                   YAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFLEPYRSSACTSYSSCLGCLA
FT                   DQGCGWCLNSATCHLRQGRAHCEDDGSGESLLVLVPALCPLCEEHRDCHACTQDPFCEW
FT                   HQSTNRKGDAACSRRGRGRGALKNPEECPPLCSQRLTCEDCLANSSQCAWCQSTHTCFL
FT                   FAAYLARYPHGGCRGWDDSVHSEPRCRSCGGFLTCHECLQSHECGWCGNEDNPTLGRCL
FT                   QGDFSGPLGGGNCSLWVGEGLGLPVALPARWAYARCPDVDECRLGLARCHPRATCLNTP
FT                   LSYECHCQRGYQGDGITHCNRTCLEDCGHGVCSGPPDFTCVCDLGWTSDLPPPTPAPGP
FT                   PAPRCSRDCGCSFHSHCRRRGPGYCDECQDWTWGEHCERCRPGSFGNATGSGGCRPCQC
FT                   NGHGDPRRGHCDNLTGLCFCQDHTEGAHCQICSPGYYGDPRAGGSCFRECGGRALLTNV
FT                   SSVALGSRRFGGLLPPGGGAARAGPGLSYCVWVVSATEALQPCVPGTLCPPLTLTFSPD
FT                   SSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLHWEA
FT                   NGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWAGPHCRMALC
FT                   PENCNAHTGAGICNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLSADTASRFL
FT                   HRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGGPGPSPRS
FT                   FHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWRQEKPPQNMELPAVAGHTLT
FT                   ARRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYHEATDS
FT                   LYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKPRPRLFHASALLGDTMVVL
FT                   GGRSDPDEFSSDVLLYQVNCNTWLLPALTRPAFVGSPMEESVAHAVAAVGSRLYISGGF
FT                   GGVALGRLLALTLPPDPCRLLPSPEACNQSGACTWCHGACLSGDQAHRLGCGVPPCSPM
FT                   PRSPEECRRLRTCSECLARHPRTLQPGDGEASIPRCKWCTNCPEGACIGRNGSCTSEND
FT                   CRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTC
FT                   FSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLASKGADGGWQHCVWSSSLQQCLSP
FT                   SYLPLRCMAGGCGRLLRGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGGGHCMEGG
FT                   LSGPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCKTGYTMD
FT                   NVTGVCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGAQDHCLL
FT                   CRNHTKGSHCEQCLPLFVGSALGGGTCRPCHAFCRGNSHVCVSRKELEMARKEPEKYSL
FT                   DPEEIETWVAEGPSEDEAVCVNCQNNSYGDRCESCLHGYFLLDGKCTKCQCNGHADTCN
FT                   EQDGTGCPCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQ
FT                   ECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSY
FT                   DTFVVRVAPDTGVHTVHIQPPPPPPPPPPPADGVPRVAADLGGLGTGSGSGSPVEPRVR
FT                   EVWPRGLITYVTVTEPSAVLVVRSVRDRLVITYPHEHHALKSSRFYLLLLGVGDPNGPG
FT                   ANGSADSQGLLFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRH
FT                   LQEMTKMASRPFAKVTVCFPPDPAGPAPAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPW
FT                   GPMGGGCCPPALPATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSAL
FT                   VTLRHRLHEYCGGSGGAGGSGHGGGGGRKGLLSQDNLTSMSL"
FT   gene            complement(1969003..1971141)
FT                   /locus_tag="mCG_7267"
FT                   /note="gene_id=mCG7267.2"
FT   mRNA            complement(join(1969003..1969224,1969353..1969489,
FT                   1969753..1969863,1971052..1971141))
FT                   /locus_tag="mCG_7267"
FT                   /product="mCG7267, transcript variant mCT172022"
FT                   /note="gene_id=mCG7267.2 transcript_id=mCT172022.0 created
FT                   on 12-AUG-2002"
FT   mRNA            complement(join(1969004..1969224,1969353..1969489,
FT                   1969753..1969863,1970302..1970494,1971052..1971113))
FT                   /locus_tag="mCG_7267"
FT                   /product="mCG7267, transcript variant mCT3675"
FT                   /note="gene_id=mCG7267.2 transcript_id=mCT3675.1 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(1969135..1969224,1969353..1969489,
FT                   1969753..1969863,1970302..1970338))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7267"
FT                   /product="mCG7267, isoform CRA_b"
FT                   /note="gene_id=mCG7267.2 transcript_id=mCT3675.1
FT                   protein_id=mCP15717.1 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWC9"
FT                   /db_xref="InterPro:IPR006461"
FT                   /db_xref="MGI:MGI:1919633"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWC9"
FT                   /protein_id="EDL24274.1"
FT                   /translation="MQFEMHDHVKGKAMSYPVTSQPQCANTCYQTQLSDWHTGLTDCCN
FT                   DMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSLRTGMRERYHIQGSVGHDWAA
FT                   LTFCLPCALCQMARELKIRE"
FT   CDS             complement(join(1969135..1969224,1969353..1969489,
FT                   1969753..1969861))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7267"
FT                   /product="mCG7267, isoform CRA_a"
FT                   /note="gene_id=mCG7267.2 transcript_id=mCT172022.0
FT                   protein_id=mCP94941.0 isoform=CRA_a"
FT                   /protein_id="EDL24273.1"
FT                   /translation="MSYPVTSQPQCANTCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPL
FT                   CLACRISDDFGECCCAPYLPGGLHSLRTGMRERYHIQGSVGHDWAALTFCLPCALCQMA
FT                   RELKIRE"
FT   gene            <1978206..2041069
FT                   /locus_tag="mCG_145386"
FT                   /note="gene_id=mCG145386.0"
FT   mRNA            join(<1978206..1978257,1996100..1997340,1997714..1997949,
FT                   1998076..1998292,2018932..2019040,2040495..2041069)
FT                   /locus_tag="mCG_145386"
FT                   /product="mCG145386"
FT                   /note="gene_id=mCG145386.0 transcript_id=mCT184810.0
FT                   created on 05-JUN-2003"
FT   gene            complement(1981037..1991496)
FT                   /gene="Lipe"
FT                   /locus_tag="mCG_7262"
FT                   /note="gene_id=mCG7262.2"
FT   mRNA            complement(join(1981037..1981560,1981913..1982343,
FT                   1984538..1984714,1984840..1985067,1985760..1986051,
FT                   1986167..1986352,1986567..1986712,1986824..1986914,
FT                   1989505..1990040,1991449..1991496))
FT                   /gene="Lipe"
FT                   /locus_tag="mCG_7262"
FT                   /product="lipase, hormone sensitive"
FT                   /note="gene_id=mCG7262.2 transcript_id=mCT3676.1 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(1981348..1981560,1981913..1982343,
FT                   1984538..1984714,1984840..1985067,1985760..1986051,
FT                   1986167..1986352,1986567..1986712,1986824..1986914,
FT                   1989505..1990020))
FT                   /codon_start=1
FT                   /gene="Lipe"
FT                   /locus_tag="mCG_7262"
FT                   /product="lipase, hormone sensitive"
FT                   /note="gene_id=mCG7262.2 transcript_id=mCT3676.1
FT                   protein_id=mCP15733.0"
FT                   /protein_id="EDL24272.1"
FT                   /translation="MDLRTMTQSLVTLAEDNMAFFSSQGPGETARRLSNVFAGVREQAL
FT                   GLEPTLGQLLGVAHHFDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRKSIFFRA
FT                   SHNLAELEAYLAALTQLRAMAYYAQRLLTINRPGVLFFEGDEGLTADFLQEYVTLHKGC
FT                   FYGRCLGFQFTPAIRPFLQTLSIGLVSFGEHYKRNETGLSVTASSLFTGGRFAIDPELR
FT                   GAEFERIIQNLDVHFWKAFWNITEIEVLSSLANMASTTVRVSRLLSLPPEAFEMPLTSD
FT                   PRLTVTISPPLAHTGPAPVLARLISYDLREGQDSKVLNSLAKSEGPRLELRPRPHQAPR
FT                   SRALVVHIHGGGFVAQTSKSHEPYLKNWAQELGVPIFSIDYSLAPEAPFPRALEECFFA
FT                   YCWAVKHCDLLGSTGERICLAGDSAGGNLCITVSLRAAAYGVRVPDGIMAAYPVTTLQS
FT                   SASPSRLLSLMDPLLPLSVLSKCVSAYSGTEAEDHFDSDQKALGVMGLVQRDTSLFLRD
FT                   LRLGASSWLNSFLELSGRKPQKTTSPTAESVRPTESMRRSVSEAALAQPEGLLGTDTLK
FT                   KLTIKDLSNSEPSDSPEMSQSMETLGPSTPSDVNFFLRPGNSQEEAEAKDEVRPMDGVP
FT                   RVRAAFPEGFHPRRSSQGVLHMPLYTSPIVKNPFMSPLLAPDSMLKTLPPVHLVACALD
FT                   PMLDDSVMFARRLRDLGQPVTLKVVEDLPHGFLSLAALCRETRQATEFCVQRIRLILTP
FT                   PAAPLN"
FT   CDS             <1996580..1997053
FT                   /codon_start=1
FT                   /locus_tag="mCG_145386"
FT                   /product="mCG145386"
FT                   /note="gene_id=mCG145386.0 transcript_id=mCT184810.0
FT                   protein_id=mCP105747.0"
FT                   /protein_id="EDL24268.1"
FT                   /translation="KPLEPKQKTLKAQLLATQKKEPEREPYSDRRAFRTLPQRPHWDRR
FT                   SPYVSVGHSTLTSPPPPRAGRQWISPRVSSPSWKWVSSPSPQSPAGCAGFLLSCYRLTF
FT                   DLAFSPPPATAVLRSFFALLGGLGPHGRRFHGRLHQFFPVLARGPIPAIKFLS"
FT   gene            complement(1998845..2000096)
FT                   /locus_tag="mCG_147818"
FT                   /note="gene_id=mCG147818.0"
FT   mRNA            complement(1998845..2000096)
FT                   /locus_tag="mCG_147818"
FT                   /product="mCG147818"
FT                   /note="gene_id=mCG147818.0 transcript_id=mCT188081.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(1998898..1999902)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147818"
FT                   /product="mCG147818"
FT                   /note="gene_id=mCG147818.0 transcript_id=mCT188081.0
FT                   protein_id=mCP108437.0"
FT                   /db_xref="GOA:Q9D4C4"
FT                   /db_xref="MGI:MGI:96790"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4C4"
FT                   /protein_id="EDL24271.1"
FT                   /translation="MKPRRPISFPGEITTMDPSSPSVSRPEWKPETQERPIIKPDPGPE
FT                   TTLTDHPGSKMLQESGTPQKQSLPNEPTAQQEAEFQQEQGIQQSALLQKFLTPFAFPAP
FT                   QQSSPSQKVHLDQQEAISPNGPGAGKVYTTPQEPQLGEEHMGMTKSGPAEPPPATEAET
FT                   TSTAQAVSGPDKKPSTQTNLVSQEGPEQSDPTAQQTPLVQGAKSKQGSLTESGFLTRLH
FT                   DLSIQQTSPEWKSFFDCVTVSDIEKCLSSSSKSNSPKPSYGTAIPEMALLSKKKPEFEK
FT                   LSGYGGKLPHGKKTSIQKHKHYWDTGESEPGRLDRAFPGQSFSCAKYFLYLRS"
FT   gene            complement(2001365..2014456)
FT                   /gene="BC024561"
FT                   /locus_tag="mCG_140898"
FT                   /note="gene_id=mCG140898.0"
FT   mRNA            complement(join(2001365..2001830,2003535..2003636,
FT                   2004243..2004323,2014218..2014456))
FT                   /gene="BC024561"
FT                   /locus_tag="mCG_140898"
FT                   /product="cDNA sequence BC024561"
FT                   /note="gene_id=mCG140898.0 transcript_id=mCT172019.0
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(2001733..2001830,2003535..2003636,
FT                   2004243..2004323,2014218..2014296))
FT                   /codon_start=1
FT                   /gene="BC024561"
FT                   /locus_tag="mCG_140898"
FT                   /product="cDNA sequence BC024561"
FT                   /note="gene_id=mCG140898.0 transcript_id=mCT172019.0
FT                   protein_id=mCP94938.0"
FT                   /protein_id="EDL24270.1"
FT                   /translation="MKLLASPFLLLLPVMLMSMVFSSPNPGVARSHGDQHLAPRRWLLE
FT                   GGQECECKDWFLQAPKRKATAVLGPPRKQCPCDHVKGREKKNRHQKHHRKSQRPSRACQ
FT                   QFLKRCHLASFALPL"
FT   assembly_gap    2011443..2011579
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            complement(2020686..2021351)
FT                   /pseudo
FT                   /locus_tag="mCG_1031251"
FT                   /note="gene_id=mCG1031251.1"
FT   mRNA            complement(2020686..2021351)
FT                   /pseudo
FT                   /locus_tag="mCG_1031251"
FT                   /note="gene_id=mCG1031251.1 transcript_id=mCT148955.1
FT                   created on 29-JAN-2003"
FT   gene            complement(2022055..2024594)
FT                   /locus_tag="mCG_62734"
FT                   /note="gene_id=mCG62734.1"
FT   mRNA            complement(join(2022055..2024327,2024493..2024594))
FT                   /locus_tag="mCG_62734"
FT                   /product="mCG62734"
FT                   /note="gene_id=mCG62734.1 transcript_id=mCT62917.1 created
FT                   on 12-AUG-2002"
FT   CDS             complement(2023256..2024323)
FT                   /codon_start=1
FT                   /locus_tag="mCG_62734"
FT                   /product="mCG62734"
FT                   /note="gene_id=mCG62734.1 transcript_id=mCT62917.1
FT                   protein_id=mCP36605.2"
FT                   /protein_id="EDL24269.1"
FT                   /translation="MSRQGLMMKRTLLCWPLSCLFVLLPWPLATPTPITPWLCPPGKEP
FT                   DPDPGQGTLCRTCPPGTFSASGDSYPCQPHYRCSLQKRLEAQAGTATRDTMCGDCQRGW
FT                   FGPQGVPHVPCQPCPKAPPSTGGCDESGRQGEPRQPGNGTRASGPEETAAQYVVIAIVP
FT                   VFCLMGLLGILVCNLLKRQSYHCTAQKEVRPSPGGGGSGINPAYRTEDANEDTIGVLVC
FT                   LITEKKENAAALEELLKEYHSKQLVQTSHRLVPRLLLASLSMPHICPHHHHLHTVQGLA
FT                   SLSGPCCSRCSQKWPEVLLSPEAAAATTGGGTICPTEEASCGTAREQIKSPPYPCSPGH
FT                   FHAGCCNPVPALNTS"
FT   gene            complement(2044022..2044985)
FT                   /pseudo
FT                   /locus_tag="mCG_1031265"
FT                   /note="gene_id=mCG1031265.1"
FT   mRNA            complement(2044022..2044985)
FT                   /pseudo
FT                   /locus_tag="mCG_1031265"
FT                   /note="gene_id=mCG1031265.1 transcript_id=mCT148969.1
FT                   created on 07-FEB-2003"
FT   gene            complement(2064252..2079135)
FT                   /locus_tag="mCG_126985"
FT                   /note="gene_id=mCG126985.1"
FT   mRNA            complement(join(2064252..2065431,2066380..2066411,
FT                   2067848..2067968,2073330..2073605,2075330..2075584,
FT                   2076052..2076336,2077876..2078235,2079003..2079135))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT171732"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT171732.0
FT                   created on 07-AUG-2002"
FT   mRNA            complement(join(2064305..2065431,2066380..2066411,
FT                   2066999..2067051,2067848..2067968,2073330..2073605,
FT                   2075330..2075584,2076052..2076336,2077876..2078016,
FT                   2078087..2078235,2079003..2079120))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT128268"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT128268.1
FT                   created on 07-AUG-2002"
FT   mRNA            complement(join(2064307..2065431,2066380..2066411,
FT                   2067848..2067968,2073330..2073605,2077876..2078235,
FT                   2079003..2079107))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT171733"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT171733.0
FT                   created on 07-AUG-2002"
FT   mRNA            complement(join(2064897..2065431,2066380..2067968,
FT                   2073330..2073605,2075330..2075584,2076052..2076336,
FT                   2077876..2078235,2079003..>2079109))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT191921"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT191921.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(2064897..2065431,2066380..2066411,
FT                   2066999..2067051,2067848..2067968,2073330..2073605,
FT                   2077876..2078235,2079003..>2079107))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT191923"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT191923.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(2064999..2065431,2066380..2066411,
FT                   2066999..2067051,2067848..2067968,2073330..2073605,
FT                   2075330..2075584,2076052..2076336,2077876..2078235,
FT                   2079003..2079107))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT171731"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT171731.0
FT                   created on 07-AUG-2002"
FT   mRNA            complement(join(2064999..2065431,2066380..2066411,
FT                   2066999..2067051,2067848..2067968,2073330..2073605,
FT                   2077876..2078016,2078087..2078235,2079003..2079086))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT171734"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT171734.0
FT                   created on 07-AUG-2002"
FT   CDS             complement(join(2065312..2065431,2066380..2066411,
FT                   2066999..2067051,2067848..2067968,2073330..2073605,
FT                   2077876..2078235,2079003..>2079084))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_h"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT191923.0
FT                   protein_id=mCP112872.0 isoform=CRA_h"
FT                   /protein_id="EDL24266.1"
FT                   /translation="QAGSRDMELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIE
FT                   AVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGR
FT                   EIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHQPVTQPFLQVTNTTVK
FT                   ELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEI
FT                   SNPVSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGG
FT                   SDQRDLTEHKPSASNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETV
FT                   YSEVKKK"
FT   CDS             complement(join(2065312..2065431,2066380..2066411,
FT                   2066999..2067051,2067848..2067968,2073330..2073605,
FT                   2075330..2075584,2076052..2076336,2077876..2078235,
FT                   2079003..2079066))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_a"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT171731.0
FT                   protein_id=mCP94651.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q925P3"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1347245"
FT                   /db_xref="UniProtKB/TrEMBL:Q925P3"
FT                   /protein_id="EDL24259.1"
FT                   /translation="MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQV
FT                   AEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSN
FT                   GSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHPILLKPNITSNNSNPVEGDDSV
FT                   SLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNP
FT                   VSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHA
FT                   SSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNTTVKELD
FT                   SVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNP
FT                   VSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGGSDQ
FT                   RDLTEHKPSASNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSE
FT                   VKKK"
FT   CDS             complement(join(2065312..2065431,2066380..2066411,
FT                   2066999..2067051,2067848..2067968,2073330..2073605,
FT                   2077876..2077969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_d"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT171734.0
FT                   protein_id=mCP94650.0 isoform=CRA_d"
FT                   /protein_id="EDL24262.1"
FT                   /translation="MITMKDMGVYTLDMTDENYRRTQATVRFHVHQPVTQPFLQVTNTT
FT                   VKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQC
FT                   EISNPVSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSG
FT                   GGSDQRDLTEHKPSASNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATE
FT                   TVYSEVKKK"
FT   CDS             complement(join(2065312..2065431,2066380..2066411,
FT                   2066999..2067051,2067848..2067968,2073330..2073605,
FT                   2075330..2075584,2076052..2076336,2077876..2077969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_i"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT128268.1
FT                   protein_id=mCP57566.1 isoform=CRA_i"
FT                   /protein_id="EDL24267.1"
FT                   /translation="MITMKDMGVYTLDMTDENYRRTQATVRFHVHPILLKPNITSNNSN
FT                   PVEGDDSVSLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGP
FT                   YVCETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFW
FT                   LINEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVT
FT                   NTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGE
FT                   YQCEISNPVSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSR
FT                   KSGGGSDQRDLTEHKPSASNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPR
FT                   ATETVYSEVKKK"
FT   mRNA            complement(join(2065991..2066280,2066380..2066411,
FT                   2067848..2067968,2073330..2073605,2075330..2075584,
FT                   2076052..2076336,2077876..2078235,2079003..>2079107))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT191920"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT191920.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(2066391..2066411,2067848..2067968,
FT                   2073330..2073578,2077872..2078235,2079003..>2079083))
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, transcript variant mCT191922"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT191922.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(2066396..2066411,2067848..2067968,
FT                   2073330..2073605,2075330..2075584,2076052..2076336,
FT                   2077876..2078235,2079003..>2079084))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_e"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT191920.0
FT                   protein_id=mCP112869.0 isoform=CRA_e"
FT                   /protein_id="EDL24263.1"
FT                   /translation="QAGSRDMELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIE
FT                   AVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGR
FT                   EIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHPILLKPNITSNNSNPV
FT                   EGDDSVSLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYV
FT                   CETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLI
FT                   NEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNT
FT                   TVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQ
FT                   CEISNPVSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKS
FT                   GGSGSF"
FT   CDS             complement(join(2066396..2066411,2067848..2067968,
FT                   2073330..2073605,2077876..2078235,2079003..2079066))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_c"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT171733.0
FT                   protein_id=mCP94653.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3LFS8"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1347245"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LFS8"
FT                   /protein_id="EDL24261.1"
FT                   /translation="MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQV
FT                   AEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSN
FT                   GSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHQPVTQPFLQVTNTTVKELDSVT
FT                   LTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSV
FT                   RRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGSGSF"
FT   CDS             complement(join(2066396..2066411,2067848..2067968,
FT                   2073330..2073605,2075330..2075584,2076052..2076336,
FT                   2077876..2078235,2079003..2079066))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_b"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT171732.0
FT                   protein_id=mCP94652.0 isoform=CRA_b"
FT                   /protein_id="EDL24260.1"
FT                   /translation="MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQV
FT                   AEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSN
FT                   GSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHPILLKPNITSNNSNPVEGDDSV
FT                   SLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNP
FT                   VSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHA
FT                   SSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNTTVKELD
FT                   SVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNP
FT                   VSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKSGGSGSF
FT                   "
FT   CDS             complement(join(2067844..2067968,2073330..2073605,
FT                   2075330..2075584,2076052..2076336,2077876..2078235,
FT                   2079003..>2079084))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_f"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT191921.0
FT                   protein_id=mCP112870.0 isoform=CRA_f"
FT                   /protein_id="EDL24264.1"
FT                   /translation="QAGSRDMELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIE
FT                   AVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGR
FT                   EIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHPILLKPNITSNNSNPV
FT                   EGDDSVSLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYV
FT                   CETRNPVSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLI
FT                   NEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPFLQVTNT
FT                   TVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQ
FT                   CEISNPVSVRRSNSIKLDIIFDPTQGGLSDGAIAGIVIGVVAGVALIAGLAYFLYSRKS
FT                   GG"
FT   CDS             complement(join(2073521..2073578,2077872..2078235,
FT                   2079003..>2079081))
FT                   /codon_start=1
FT                   /locus_tag="mCG_126985"
FT                   /product="mCG126985, isoform CRA_g"
FT                   /note="gene_id=mCG126985.1 transcript_id=mCT191922.0
FT                   protein_id=mCP112871.0 isoform=CRA_g"
FT                   /protein_id="EDL24265.1"
FT                   /translation="AGSRDMELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEA
FT                   VPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGRE
FT                   IIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHRNHQHHSQRTRLCDPDL
FT                   LVE"
FT   assembly_gap    2097861..2102358
FT                   /estimated_length=4498
FT                   /gap_type="unknown"
FT   gene            complement(2116798..2140599)
FT                   /locus_tag="mCG_1622"
FT                   /note="gene_id=mCG1622.2"
FT   mRNA            complement(join(2116798..2118942,2119916..2119947,
FT                   2121570..2121687,2128495..2128770,2139312..2139671,
FT                   2140439..2140599))
FT                   /locus_tag="mCG_1622"
FT                   /product="mCG1622, transcript variant mCT191954"
FT                   /note="gene_id=mCG1622.2 transcript_id=mCT191954.1 created
FT                   on 23-NOV-2004"
FT   mRNA            complement(join(2116798..2118942,2119916..2119947,
FT                   2120719..2120771,2121570..2121687,2128495..2128770,
FT                   2139312..2139671,2140439..2140599))
FT                   /locus_tag="mCG_1622"
FT                   /product="mCG1622, transcript variant mCT1067"
FT                   /note="gene_id=mCG1622.2 transcript_id=mCT1067.3 created on
FT                   23-NOV-2004"
FT   mRNA            complement(join(2116798..2118942,2119916..2119947,
FT                   2120719..2120771,2121570..2121687,2128495..2128770,
FT                   2130488..2130742,2131209..2131493,2139312..2139671,
FT                   2140439..2140599))
FT                   /locus_tag="mCG_1622"
FT                   /product="mCG1622, transcript variant mCT171738"
FT                   /note="gene_id=mCG1622.2 transcript_id=mCT171738.1 created
FT                   on 23-NOV-2004"
FT   CDS             complement(join(2118823..2118942,2119916..2119947,
FT                   2120719..2120771,2121570..2121687,2128495..2128770,
FT                   2139312..2139671,2140439..2140502))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1622"
FT                   /product="mCG1622, isoform CRA_a"
FT                   /note="gene_id=mCG1622.2 transcript_id=mCT1067.3
FT                   protein_id=mCP13814.3 isoform=CRA_a"
FT                   /protein_id="EDL24256.1"
FT                   /translation="MELASAHLHKGQVPWFGLLLTASLLASWSPPTTAQVTVMAFPLHA
FT                   AEGNNVILVVYNMMKGVSAFSWHKGSTTSTNAEIVRFVTGTNKTIKGPVHSGRETLYSN
FT                   GSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHVHKPVTQPSLQVTNTTVKELDSVT
FT                   LTCLSKDSQAHIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNPVSV
FT                   KRSNSIKLEVIFDSTYDISDVPIAVIITGAVAGVILIAGLAYRLCSRKSRWGSDQRDLT
FT                   EHKPSASNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEVKKK
FT                   "
FT   CDS             complement(join(2118823..2118942,2119916..2119947,
FT                   2120719..2120771,2121570..2121687,2128495..2128770,
FT                   2130488..2130742,2131209..2131493,2139312..2139671,
FT                   2140439..2140502))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1622"
FT                   /product="mCG1622, isoform CRA_b"
FT                   /note="gene_id=mCG1622.2 transcript_id=mCT171738.1
FT                   protein_id=mCP94657.1 isoform=CRA_b"
FT                   /protein_id="EDL24257.1"
FT                   /translation="MELASAHLHKGQVPWFGLLLTASLLASWSPPTTAQVTVMAFPLHA
FT                   AEGNNVILVVYNMMKGVSAFSWHKGSTTSTNAEIVRFVTGTNKTIKGPVHSGRETLYSN
FT                   GSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHVHTLLLKSNITSNNSNPVEGDDSV
FT                   SLTCDSYTDPDNITYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNP
FT                   VSVNRSDPFSLNIIYGPDTPIISPSDIYLHPGSNLNLSCHAASNPPAQYFWLINEKPHA
FT                   SSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPSLQVTNTTVKELD
FT                   SVTLTCLSKDSQAHIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNP
FT                   VSVKRSNSIKLEVIFDSTYDISDVPIAVIITGAVAGVILIAGLAYRLCSRKSRWGSDQR
FT                   DLTEHKPSASNHNLAPSDNSPNKVDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEV
FT                   KKK"
FT   CDS             complement(join(2119947,2121570..2121687,2128495..2128770,
FT                   2139312..2139671,2140439..2140502))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1622"
FT                   /product="mCG1622, isoform CRA_c"
FT                   /note="gene_id=mCG1622.2 transcript_id=mCT191954.1
FT                   protein_id=mCP112908.1 isoform=CRA_c"
FT                   /protein_id="EDL24258.1"
FT                   /translation="MELASAHLHKGQVPWFGLLLTASLLASWSPPTTAQVTVMAFPLHA
FT                   AEGNNVILVVYNMMKGVSAFSWHKGSTTSTNAEIVRFVTGTNKTIKGPVHSGRETLYSN
FT                   GSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHVHKPVTQPSLQVTNTTVKELDSVT
FT                   LTCLSKDSQAHIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNPVSV
FT                   KRSNSIKLEVIFDSTYDISDVPIAVIITGAVAGVILIAGLAYRLCSRKSR"
FT   assembly_gap    2144280..2144299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2145402..2146664
FT                   /estimated_length=1263
FT                   /gap_type="unknown"
FT   assembly_gap    2161903..2162016
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            complement(<2171952..>2172732)
FT                   /locus_tag="mCG_64976"
FT                   /note="gene_id=mCG64976.1"
FT   mRNA            complement(join(<2171952..2172068,2172535..2172582,
FT                   2172702..>2172732))
FT                   /locus_tag="mCG_64976"
FT                   /product="mCG64976"
FT                   /note="gene_id=mCG64976.1 transcript_id=mCT65159.1 created
FT                   on 12-AUG-2002"
FT   CDS             complement(join(<2171952..2172068,2172535..2172582,
FT                   2172702..>2172731))
FT                   /codon_start=1
FT                   /locus_tag="mCG_64976"
FT                   /product="mCG64976"
FT                   /note="gene_id=mCG64976.1 transcript_id=mCT65159.1
FT                   protein_id=mCP26875.1"
FT                   /protein_id="EDL24255.1"
FT                   /translation="SEDSQHCPPRPSVAGGPHLFPATGDQVTGPTTTLLECEASIATHT
FT                   SCFLSEGSVGTGDSEPQLCC"
FT   gene            2179176..2189731
FT                   /locus_tag="mCG_147819"
FT                   /note="gene_id=mCG147819.0"
FT   mRNA            join(2179176..2179673,2188001..2189731)
FT                   /locus_tag="mCG_147819"
FT                   /product="mCG147819"
FT                   /note="gene_id=mCG147819.0 transcript_id=mCT188082.0
FT                   created on 13-JAN-2004"
FT   CDS             2189222..2189485
FT                   /codon_start=1
FT                   /locus_tag="mCG_147819"
FT                   /product="mCG147819"
FT                   /note="gene_id=mCG147819.0 transcript_id=mCT188082.0
FT                   protein_id=mCP108440.0"
FT                   /protein_id="EDL24254.1"
FT                   /translation="MSLEKPMNLFDYLVLILSSVMAGDLFYSLMICSNRRRRLTDAFHL
FT                   LKHRAKKLSLADNVYTAHSMHVLIQKCPYNVTYKSLCAFRAN"
FT   assembly_gap    2194244..2194308
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            2196408..2197022
FT                   /pseudo
FT                   /locus_tag="mCG_49892"
FT                   /note="gene_id=mCG49892.2"
FT   mRNA            join(2196408..2196451,2196469..2197022)
FT                   /pseudo
FT                   /locus_tag="mCG_49892"
FT                   /note="gene_id=mCG49892.2 transcript_id=mCT50075.2 created
FT                   on 07-FEB-2003"
FT   gene            complement(2209704..2210973)
FT                   /locus_tag="mCG_62821"
FT                   /note="gene_id=mCG62821.1"
FT   mRNA            complement(join(2209704..2210382,2210745..2210973))
FT                   /locus_tag="mCG_62821"
FT                   /product="mCG62821"
FT                   /note="gene_id=mCG62821.1 transcript_id=mCT63004.1 created
FT                   on 12-AUG-2002"
FT   CDS             complement(join(2210146..2210382,2210745..2210930))
FT                   /codon_start=1
FT                   /locus_tag="mCG_62821"
FT                   /product="mCG62821"
FT                   /note="gene_id=mCG62821.1 transcript_id=mCT63004.1
FT                   protein_id=mCP26872.2"
FT                   /db_xref="InterPro:IPR029202"
FT                   /db_xref="MGI:MGI:3646269"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8M5"
FT                   /protein_id="EDL24253.1"
FT                   /translation="MVRTMEPWVQLKQAGLEPSGLGPLPKALRVPPPEGNPGQALMSSG
FT                   AELGGARELILWIWEELGNLRRVDVQLLGQLCDLGLEMGTFREELVTILEEEEEEEEQE
FT                   EKSCVEENKGPEEKQDEERSRSSYPAQRLPDFEMTI"
FT   gene            <2214496..2220632
FT                   /gene="2310004L02Rik"
FT                   /locus_tag="mCG_7653"
FT                   /note="gene_id=mCG7653.2"
FT   mRNA            join(<2214496..2214542,2215978..2216174,2216506..2216594,
FT                   2217426..2217506,2218881..2219020,2219109..2219271,
FT                   2219797..2220632)
FT                   /gene="2310004L02Rik"
FT                   /locus_tag="mCG_7653"
FT                   /product="RIKEN cDNA 2310004L02, transcript variant
FT                   mCT171763"
FT                   /note="gene_id=mCG7653.2 transcript_id=mCT171763.0 created
FT                   on 07-AUG-2002"
FT   mRNA            join(2214500..2214542,2215978..2216174,2217426..2217506,
FT                   2218881..2219020,2219109..2219271,2219797..2220632)
FT                   /gene="2310004L02Rik"
FT                   /locus_tag="mCG_7653"
FT                   /product="RIKEN cDNA 2310004L02, transcript variant
FT                   mCT6634"
FT                   /note="gene_id=mCG7653.2 transcript_id=mCT6634.2 created on
FT                   07-AUG-2002"
FT   CDS             join(2214525..2214542,2215978..2216174,2217426..2217506,
FT                   2218881..2219020,2219109..2219271,2219797..2219974)
FT                   /codon_start=1
FT                   /gene="2310004L02Rik"
FT                   /locus_tag="mCG_7653"
FT                   /product="RIKEN cDNA 2310004L02, isoform CRA_b"
FT                   /note="gene_id=mCG7653.2 transcript_id=mCT6634.2
FT                   protein_id=mCP3796.2 isoform=CRA_b"
FT                   /protein_id="EDL24251.1"
FT                   /translation="MAAPRAVLHLGAREWNGRARRIHGMSELVTPDSSREKKRTLLQFL
FT                   SDHFQDIQTLREYLLQKQISKVNRENRSFTNIQEKYGPYVAGAVFILKQGGAVKFQDKE
FT                   EWIRPNNRSHFLAEIQKFQNVPVEAVDASGCAINYQGLSNLLPLKELRSLSLQRCPNLD
FT                   DWCLSRLYLLAGSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSHPGLTQIL
FT                   VEEMLPHCEVLGADWAQNLKLEPDKQPPDTSTPLSS"
FT   mRNA            join(2214574..2215546,2215978..2216174,2217426..2217506,
FT                   2218881..2219020,2219109..2219271,2219797..2220631)
FT                   /gene="2310004L02Rik"
FT                   /locus_tag="mCG_7653"
FT                   /product="RIKEN cDNA 2310004L02, transcript variant
FT                   mCT191953"
FT                   /note="gene_id=mCG7653.2 transcript_id=mCT191953.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(2215532..2215546,2215978..2216174,2217426..2217506,
FT                   2218881..2219020,2219109..2219271,2219797..2219974)
FT                   /codon_start=1
FT                   /gene="2310004L02Rik"
FT                   /locus_tag="mCG_7653"
FT                   /product="RIKEN cDNA 2310004L02, isoform CRA_a"
FT                   /note="gene_id=mCG7653.2 transcript_id=mCT191953.0
FT                   protein_id=mCP112914.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8CA44"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1913599"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CA44"
FT                   /protein_id="EDL24250.1"
FT                   /translation="MHTMHVLHLGAREWNGRARRIHGMSELVTPDSSREKKRTLLQFLS
FT                   DHFQDIQTLREYLLQKQISKVNRENRSFTNIQEKYGPYVAGAVFILKQGGAVKFQDKEE
FT                   WIRPNNRSHFLAEIQKFQNVPVEAVDASGCAINYQGLSNLLPLKELRSLSLQRCPNLDD
FT                   WCLSRLYLLAGSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSHPGLTQILV
FT                   EEMLPHCEVLGADWAQNLKLEPDKQPPDTSTPLSS"
FT   CDS             join(<2216040..2216174,2216506..2216594,2217426..2217506,
FT                   2218881..2219020,2219109..2219271,2219797..2219974)
FT                   /codon_start=1
FT                   /gene="2310004L02Rik"
FT                   /locus_tag="mCG_7653"
FT                   /product="RIKEN cDNA 2310004L02, isoform CRA_c"
FT                   /note="gene_id=mCG7653.2 transcript_id=mCT171763.0
FT                   protein_id=mCP94682.0 isoform=CRA_c"
FT                   /protein_id="EDL24252.1"
FT                   /translation="VGDPGQQSGEEKNAVAVPLRSFPGHPDSERVLAPETDLKSQQGES
FT                   FVNARGFPGSAPRFPTLHCVACLLIPFILRSFTNIQEKYGPYVAGAVFILKQGGAVKFQ
FT                   DKEEWIRPNNRSHFLAEIQKFQNVPVEAVDASGCAINYQGLSNLLPLKELRSLSLQRCP
FT                   NLDDWCLSRLYLLAGSLQELSLAGCPRISERGLACLHHLQNLRRLDISDLPAVSHPGLT
FT                   QILVEEMLPHCEVLGADWAQNLKLEPDKQPPDTSTPLSS"
FT   gene            2222720..2224568
FT                   /gene="B3gnt8"
FT                   /locus_tag="mCG_7650"
FT                   /note="gene_id=mCG7650.1"
FT   mRNA            join(2222720..2222804,2223197..2224568)
FT                   /gene="B3gnt8"
FT                   /locus_tag="mCG_7650"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 8"
FT                   /note="gene_id=mCG7650.1 transcript_id=mCT6640.1 created on
FT                   12-AUG-2002"
FT   CDS             2223229..2224398
FT                   /codon_start=1
FT                   /gene="B3gnt8"
FT                   /locus_tag="mCG_7650"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 8"
FT                   /note="gene_id=mCG7650.1 transcript_id=mCT6640.1
FT                   protein_id=mCP3793.2"
FT                   /protein_id="EDL24249.1"
FT                   /translation="MRCRKCQLCLSALLTLLGLKVYIEWTSESWLKKAEPRGALPSPTP
FT                   PNAEPTLPTNLSARLGQTGPLSSAYWNQQQRQLGVLPSTDCQTWGTVAASEILDFILYP
FT                   QELRRFLLSAACRSFPLWLPAGEGSPVASCSDKDVPYLLLAVKSEPGHFAARQAVRETW
FT                   GSPVAGTRLLFLLGSPLGMGGPDLRSLVTWESRRYGDLLLWDFLDVPYNRTLKDLLLLT
FT                   WLSHHCPDVNFVLQVQDDAFVHIPALLEHLQTLPPTWARSLYLGEIFTQAKPLRKPGGP
FT                   FYVPKTFFEGDYPAYASGGGYVISGRLAPWLLQAAARVAPFPFDDVYTGFCFRALGLAP
FT                   RAHPGFLTAWPAERTRDPCAVRGLLLVHPVSPQDTIWLWRHLWVPELQC"
FT   gene            complement(2225028..2253715)
FT                   /gene="Bckdha"
FT                   /locus_tag="mCG_7651"
FT                   /note="gene_id=mCG7651.1"
FT   mRNA            complement(join(2225028..2225515,2226082..2226253,
FT                   2226424..2226565,2226720..2226926,2228322..2228483,
FT                   2233244..2233352,2236539..2236625,2236726..2236908,
FT                   2253607..2253715))
FT                   /gene="Bckdha"
FT                   /locus_tag="mCG_7651"
FT                   /product="branched chain ketoacid dehydrogenase E1, alpha
FT                   polypeptide"
FT                   /note="gene_id=mCG7651.1 transcript_id=mCT6632.0 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(2225345..2225515,2226082..2226253,
FT                   2226424..2226565,2226720..2226926,2228322..2228483,
FT                   2233244..2233352,2236539..2236625,2236726..2236908,
FT                   2253607..2253714))
FT                   /codon_start=1
FT                   /gene="Bckdha"
FT                   /locus_tag="mCG_7651"
FT                   /product="branched chain ketoacid dehydrogenase E1, alpha
FT                   polypeptide"
FT                   /note="gene_id=mCG7651.1 transcript_id=mCT6632.0
FT                   protein_id=mCP3781.0"
FT                   /db_xref="GOA:Q3U3J1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR034616"
FT                   /db_xref="MGI:MGI:107701"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3J1"
FT                   /protein_id="EDL24248.1"
FT                   /translation="MAIVMSAAKIWRPSRGLRQAALLLLGRSGVRGLARSHPSRQQQQQ
FT                   FPSLDDKPQFPGASAEFVDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPQEEVL
FT                   KFYRSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALERTDLVFGQYREAG
FT                   VLMYRDYPLELFMSQCYGNVNDPGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAY
FT                   AAKRANANRIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYR
FT                   GDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTS
FT                   DDSSAYRSVDEVNYWDKQDHPISRLRQYLLNQGWWDEEQEKAWRKQSRKKVMEAFEQAE
FT                   RKLKPNPSLLFSDVYQEMPAQLRRQQESLARHLQTYGEHYPLDHFDK"
FT   gene            2254138..2263103
FT                   /gene="Exosc5"
FT                   /locus_tag="mCG_7655"
FT                   /note="gene_id=mCG7655.2"
FT   mRNA            join(2254138..2254357,2258111..2258224,2259301..2259422,
FT                   2260395..2260535,2261227..2261316,2262674..2263012)
FT                   /gene="Exosc5"
FT                   /locus_tag="mCG_7655"
FT                   /product="exosome component 5, transcript variant mCT6636"
FT                   /note="gene_id=mCG7655.2 transcript_id=mCT6636.2 created on
FT                   07-AUG-2002"
FT   mRNA            join(2254152..2254357,2258111..2258224,2259222..2259422,
FT                   2260395..2260535,2261227..2261316,2262674..2263103)
FT                   /gene="Exosc5"
FT                   /locus_tag="mCG_7655"
FT                   /product="exosome component 5, transcript variant
FT                   mCT171764"
FT                   /note="gene_id=mCG7655.2 transcript_id=mCT171764.0 created
FT                   on 07-AUG-2002"
FT   CDS             join(2254210..2254357,2258111..2258224,2259301..2259422,
FT                   2260395..2260535,2261227..2261316,2262674..2262766)
FT                   /codon_start=1
FT                   /gene="Exosc5"
FT                   /locus_tag="mCG_7655"
FT                   /product="exosome component 5, isoform CRA_b"
FT                   /note="gene_id=mCG7655.2 transcript_id=mCT6636.2
FT                   protein_id=mCP3782.1 isoform=CRA_b"
FT                   /protein_id="EDL24247.1"
FT                   /translation="MEGAKRADANLLTDTGTESSPRSPVCSLRHFACEQNLLSRPDGSA
FT                   SFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLVRNTCEA
FT                   VVLGALHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVTCALDSDG
FT                   NLVLDPTTKQEKEARAILTFALDSAEQKLLMSTTKGLYSDAELQQCLAAAQAASQHIFR
FT                   FYRESLQRRYSKS"
FT   CDS             join(2254210..2254357,2258111..2258224,2259222..2259346)
FT                   /codon_start=1
FT                   /gene="Exosc5"
FT                   /locus_tag="mCG_7655"
FT                   /product="exosome component 5, isoform CRA_a"
FT                   /note="gene_id=mCG7655.2 transcript_id=mCT171764.0
FT                   protein_id=mCP94683.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="MGI:MGI:107889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RPC2"
FT                   /protein_id="EDL24246.1"
FT                   /translation="MEGAKRADANLLTDTGTESSPRSPVCSLRHFACEQNLLSRPDGSA
FT                   SFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPVSLQRLDQAEQDDGVEG
FT                   KSLTASRLPRRGREEPRAAGQEYL"
FT   gene            complement(2264116..>2270141)
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /note="gene_id=mCG7652.3"
FT   mRNA            complement(join(2264116..2264472,2265460..2265609,
FT                   2268399..2268634,2270010..>2270141))
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /product="RIKEN cDNA A830041P22, transcript variant
FT                   mCT191952"
FT                   /note="gene_id=mCG7652.3 transcript_id=mCT191952.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2264117..2264324,2265460..2265609,
FT                   2268399..2268634,2270010..2270141))
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /product="RIKEN cDNA A830041P22, transcript variant
FT                   mCT6633"
FT                   /note="gene_id=mCG7652.3 transcript_id=mCT6633.3 created on
FT                   15-APR-2003"
FT   CDS             complement(join(2264259..2264324,2265460..2265609,
FT                   2268399..2268608))
FT                   /codon_start=1
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /product="RIKEN cDNA A830041P22, isoform CRA_d"
FT                   /note="gene_id=mCG7652.3 transcript_id=mCT6633.3
FT                   protein_id=mCP3795.3 isoform=CRA_d"
FT                   /db_xref="GOA:D3Z7E7"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="MGI:MGI:2443589"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z7E7"
FT                   /protein_id="EDL24245.1"
FT                   /translation="MDNSSIQELQQPLLPSITCDLLAPRSEKPELGTPFPETAFAESPR
FT                   GWQLLLPPLPSVSAGLGEPETPDFEDTLSSDSDSDDDGGDRLSPLLPHDHLGLAVFSVL
FT                   CCFWPVGIAAFCLAHKTRPSCPSAPTVNAEARGPSNP"
FT   CDS             complement(join(2264314..2264472,2265460..2265609,
FT                   2268399..2268634,2270010..>2270064))
FT                   /codon_start=1
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /product="RIKEN cDNA A830041P22, isoform CRA_c"
FT                   /note="gene_id=mCG7652.3 transcript_id=mCT191952.0
FT                   protein_id=mCP112913.0 isoform=CRA_c"
FT                   /protein_id="EDL24244.1"
FT                   /translation="PGRPISGFRFAHLWAAGQGPSTTASTTMDNSSIQELQQPLLPSIT
FT                   CDLLAPRSEKPELGTPFPETAFAESPRGWQLLLPPLPSVSAGLGEPETPDFEDTLSSDS
FT                   DSDDDGGDRLSPLLPHDHLGLAVFSVLCCFWPVGIAAFCLAHKTNKAWAKGDVQGAGAA
FT                   SRRAFLLGVLAVGLGLCTYAAALVTLAAYLASRDPP"
FT   mRNA            complement(join(2265018..2265609,2268399..2268634,
FT                   2270010..2270093))
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /product="RIKEN cDNA A830041P22, transcript variant
FT                   mCT182018"
FT                   /note="gene_id=mCG7652.3 transcript_id=mCT182018.0 created
FT                   on 15-APR-2003"
FT   CDS             complement(join(2265361..2265609,2268399..2268608))
FT                   /codon_start=1
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /product="RIKEN cDNA A830041P22, isoform CRA_a"
FT                   /note="gene_id=mCG7652.3 transcript_id=mCT182018.0
FT                   protein_id=mCP104941.0 isoform=CRA_a"
FT                   /protein_id="EDL24242.1"
FT                   /translation="MDNSSIQELQQPLLPSITCDLLAPRSEKPELGTPFPETAFAESPR
FT                   GWQLLLPPLPSVSAGLGEPETPDFEDTLSSDSDSDDDGGDRLSPLLPHDHLGLAVFSVL
FT                   CCFWPVGIAAFCLAHKVSLCLGLGGCWLKTKKKKKKKKKKACEEPCYA"
FT   mRNA            complement(join(2266171..2268634,2270010..2270092))
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /product="RIKEN cDNA A830041P22, transcript variant
FT                   mCT182019"
FT                   /note="gene_id=mCG7652.3 transcript_id=mCT182019.0 created
FT                   on 15-APR-2003"
FT   CDS             complement(2268381..2268608)
FT                   /codon_start=1
FT                   /gene="A830041P22Rik"
FT                   /locus_tag="mCG_7652"
FT                   /product="RIKEN cDNA A830041P22, isoform CRA_b"
FT                   /note="gene_id=mCG7652.3 transcript_id=mCT182019.0
FT                   protein_id=mCP104940.0 isoform=CRA_b"
FT                   /protein_id="EDL24243.1"
FT                   /translation="MDNSSIQELQQPLLPSITCDLLAPRSEKPELGTPFPETAFAESPR
FT                   GWQLLLPPLPSVSAGLGEPETPDFEVGASG"
FT   gene            2275813..2281534
FT                   /gene="BC028440"
FT                   /locus_tag="mCG_7658"
FT                   /note="gene_id=mCG7658.2"
FT   mRNA            join(2275813..2275952,2276357..2276448,2278264..2278389,
FT                   2280954..2281534)
FT                   /gene="BC028440"
FT                   /locus_tag="mCG_7658"
FT                   /product="cDNA sequence BC028440, transcript variant
FT                   mCT6628"
FT                   /note="gene_id=mCG7658.2 transcript_id=mCT6628.2 created on
FT                   12-AUG-2002"
FT   mRNA            join(2276132..2276448,2278264..2278389,2280954..2281531)
FT                   /gene="BC028440"
FT                   /locus_tag="mCG_7658"
FT                   /product="cDNA sequence BC028440, transcript variant
FT                   mCT172024"
FT                   /note="gene_id=mCG7658.2 transcript_id=mCT172024.0 created
FT                   on 12-AUG-2002"
FT   CDS             join(2276361..2276448,2278264..2278389,2280954..2281267)
FT                   /codon_start=1
FT                   /gene="BC028440"
FT                   /locus_tag="mCG_7658"
FT                   /product="cDNA sequence BC028440, isoform CRA_a"
FT                   /note="gene_id=mCG7658.2 transcript_id=mCT172024.0
FT                   protein_id=mCP94943.0 isoform=CRA_a"
FT                   /protein_id="EDL24240.1"
FT                   /translation="MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQ
FT                   VDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPG
FT                   THQLDCPTWRPLGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGL
FT                   LLRHFDRYGVEC"
FT   CDS             join(2276361..2276448,2278264..2278389,2280954..2281267)
FT                   /codon_start=1
FT                   /gene="BC028440"
FT                   /locus_tag="mCG_7658"
FT                   /product="cDNA sequence BC028440, isoform CRA_a"
FT                   /note="gene_id=mCG7658.2 transcript_id=mCT6628.2
FT                   protein_id=mCP3784.2 isoform=CRA_a"
FT                   /protein_id="EDL24241.1"
FT                   /translation="MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQ
FT                   VDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPG
FT                   THQLDCPTWRPLGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGL
FT                   LLRHFDRYGVEC"
FT   gene            2281975..2299969
FT                   /gene="Tgfb1"
FT                   /locus_tag="mCG_7649"
FT                   /note="gene_id=mCG7649.1"
FT   mRNA            join(2281975..2283196,2287350..2287510,2289196..2289313,
FT                   2291891..2291968,2292098..2292245,2299098..2299251,
FT                   2299757..2299969)
FT                   /gene="Tgfb1"
FT                   /locus_tag="mCG_7649"
FT                   /product="transforming growth factor, beta 1"
FT                   /note="gene_id=mCG7649.1 transcript_id=mCT6637.0 created on
FT                   07-AUG-2002"
FT   CDS             join(2282842..2283196,2287350..2287510,2289196..2289313,
FT                   2291891..2291968,2292098..2292245,2299098..2299251,
FT                   2299757..2299915)
FT                   /codon_start=1
FT                   /gene="Tgfb1"
FT                   /locus_tag="mCG_7649"
FT                   /product="transforming growth factor, beta 1"
FT                   /note="gene_id=mCG7649.1 transcript_id=mCT6637.0
FT                   protein_id=mCP3794.1"
FT                   /db_xref="GOA:Q3UNK5"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR003939"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR016319"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:98725"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UNK5"
FT                   /protein_id="EDL24239.1"
FT                   /translation="MPPSGLRLLPLLLPLPWLLVLTPGRPAAGLSTCKTIDMELVKRKR
FT                   IEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYY
FT                   AKEVTRVLMVDRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQRLKSS
FT                   VEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAH
FT                   CSCDSKDNKLHVEINGISPKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALD
FT                   TNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVL
FT                   ALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS"
FT   gene            complement(2306090..2314093)
FT                   /gene="Ccdc97"
FT                   /locus_tag="mCG_7663"
FT                   /note="gene_id=mCG7663.1"
FT   mRNA            complement(join(2306090..2308086,2309326..2309455,
FT                   2309724..2309993,2310708..2311160,2313891..2314093))
FT                   /gene="Ccdc97"
FT                   /locus_tag="mCG_7663"
FT                   /product="coiled-coil domain containing 97"
FT                   /note="gene_id=mCG7663.1 transcript_id=mCT6623.2 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(2307966..2308086,2309326..2309455,
FT                   2309724..2309993,2310708..2311160,2313891..2313939))
FT                   /codon_start=1
FT                   /gene="Ccdc97"
FT                   /locus_tag="mCG_7663"
FT                   /product="coiled-coil domain containing 97"
FT                   /note="gene_id=mCG7663.1 transcript_id=mCT6623.2
FT                   protein_id=mCP3792.2"
FT                   /protein_id="EDL24238.1"
FT                   /translation="MEAVAAAEVTERKPDNDGVEPRVVHWGELSQTPIPSGPQEKETAE
FT                   RTPDIPNSGSSQAESPAVSAMLHAIAASHLPVCSQQQGEPDLTEPEKVAILGQLYHKKP
FT                   LVFLERFRTGLREEHLACFGHLRGDHRADFYCAEVARQGTARPRTLRTRLRNRRYAALR
FT                   ELIQGGEYFSDEQMRFRAPLLYEQYIGQYLTQEELNARTAAPQAPRSGSPGTPAYPLSD
FT                   LLFQSYQERELQQKLLQQQEEEEACFEEEEDSDEEDQRSDKDSEAWVPDSEERLILREE
FT                   FTSRMHQRFLDGKDGGFDYSTVDDNPDFDNLDIVARDEEDRYFDEEEPEDVSSAELGGD
FT                   "
FT   gene            complement(2316116..2349695)
FT                   /gene="Hnrpul1"
FT                   /locus_tag="mCG_7662"
FT                   /note="gene_id=mCG7662.1"
FT   mRNA            complement(join(2316116..2317336,2317779..2317970,
FT                   2319528..2319817,2320897..2321187,2321708..2321876,
FT                   2327989..2328117,2328217..2328339,2329532..2329798,
FT                   2335801..2335913,2337900..2337999,2340066..2340205,
FT                   2341321..2341394,2343296..2343449,2345838..2345963,
FT                   2349314..2349695))
FT                   /gene="Hnrpul1"
FT                   /locus_tag="mCG_7662"
FT                   /product="heterogeneous nuclear ribonucleoprotein U-like 1"
FT                   /note="gene_id=mCG7662.1 transcript_id=mCT6622.2 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(2317220..2317336,2317779..2317970,
FT                   2319528..2319817,2320897..2321187,2321708..2321876,
FT                   2327989..2328117,2328217..2328339,2329532..2329798,
FT                   2335801..2335913,2337900..2337999,2340066..2340205,
FT                   2341321..2341394,2343296..2343449,2345838..2345963,
FT                   2349314..2349608))
FT                   /codon_start=1
FT                   /gene="Hnrpul1"
FT                   /locus_tag="mCG_7662"
FT                   /product="heterogeneous nuclear ribonucleoprotein U-like 1"
FT                   /note="gene_id=mCG7662.1 transcript_id=mCT6622.2
FT                   protein_id=mCP3789.2"
FT                   /protein_id="EDL24237.1"
FT                   /translation="MDVRRLKVNELREELQRRGLDTRGLKAELAERLLAALEAEEPEDE
FT                   RELEADDDPGLPGHNNEEVETEGGSELEGTAQPPPPGLQPHPEPGGYSGPDGHYVMDNI
FT                   TRQNQFYETPVIKQENESSYDRRPLDMEPQQQVYHPELKTEMKQEAPPSFLPPEASQLK
FT                   TDRPQFQNRKRPFEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLH
FT                   FKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPH
FT                   VVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGN
FT                   DVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFT
FT                   FIQHLPLSERIRGTIGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNA
FT                   IMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRR
FT                   KMRPFEGFQRKAIVICPTDEDLKDRTVKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLD
FT                   EVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDSRGGGFRGRGGGGGFQRYDNRGPP
FT                   GGNRGGFQNRGGGGGSGGGGGNYRGGFNRSGGGGYNQNRWGNNNRDNNNSNNRGNYNRA
FT                   PQQQPPPQQPPPPQPPPQQPPPPPSYSPARNPPGASSYNKNSNIPGSSANTSTPTVSSY
FT                   TPPQPSYSQPPYNQGGYTQGYTAPPPPPPPPPAYNYGSYGPYNPAPYTPPPPPTAQTYP
FT                   QPSYNQYQQYAQQWSQYYQNQSQWPPYYGNYDYGGYSGSTQGGTSTQ"
FT   gene            complement(2352189..>2383510)
FT                   /gene="Axl"
FT                   /locus_tag="mCG_126976"
FT                   /note="gene_id=mCG126976.1"
FT   mRNA            complement(join(2352189..2353986,2355724..2355860,
FT                   2356378..2356537,2358257..2358366,2358916..2359037,
FT                   2359395..2359487,2361491..2361568,2361766..2361861,
FT                   2365193..2365284,2365608..2365740,2368069..2368095,
FT                   2368313..2368463,2369054..2369193,2369485..2369695,
FT                   2373379..2373494,2373633..2373713,2380841..2381017,
FT                   2381894..2381994,2382298..2382523,2383447..>2383510))
FT                   /gene="Axl"
FT                   /locus_tag="mCG_126976"
FT                   /product="AXL receptor tyrosine kinase"
FT                   /note="gene_id=mCG126976.1 transcript_id=mCT128262.1
FT                   created on 07-AUG-2002"
FT   CDS             complement(join(2353635..2353986,2355724..2355860,
FT                   2356378..2356537,2358257..2358366,2358916..2359037,
FT                   2359395..2359487,2361491..2361568,2361766..2361861,
FT                   2365193..2365284,2365608..2365740,2368069..2368095,
FT                   2368313..2368463,2369054..2369193,2369485..2369695,
FT                   2373379..2373494,2373633..2373713,2380841..2381017,
FT                   2381894..2381994,2382298..2382523,2383447..2383510))
FT                   /codon_start=1
FT                   /gene="Axl"
FT                   /locus_tag="mCG_126976"
FT                   /product="AXL receptor tyrosine kinase"
FT                   /note="gene_id=mCG126976.1 transcript_id=mCT128262.1
FT                   protein_id=mCP57729.0"
FT                   /db_xref="GOA:Q00993"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:1347244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00993"
FT                   /protein_id="EDL24236.1"
FT                   /translation="MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLT
FT                   GTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLS
FT                   DAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPV
FT                   TLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRP
FT                   HHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQV
FT                   SVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNG
FT                   SQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVS
FT                   VTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGALVAAACV
FT                   LILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK
FT                   EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDF
FT                   LSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQP
FT                   VFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
FT                   DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIY
FT                   DYLRQGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDE
FT                   ILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCLTAADVHSAGRYVLCPSTAPGPT
FT                   LSADRGCPAPPGQEDGA"
FT   assembly_gap    2369782..2369801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2382940..2382959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2386896..2387881)
FT                   /pseudo
FT                   /locus_tag="mCG_126995"
FT                   /note="gene_id=mCG126995.1"
FT   mRNA            complement(2386896..2387881)
FT                   /pseudo
FT                   /locus_tag="mCG_126995"
FT                   /note="gene_id=mCG126995.1 transcript_id=mCT128274.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    2390971..2391182
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   gene            complement(2397635..2411721)
FT                   /gene="Cyp2s1"
FT                   /locus_tag="mCG_7657"
FT                   /note="gene_id=mCG7657.1"
FT   mRNA            complement(join(2397635..2398920,2399077..2399218,
FT                   2401032..2401219,2403205..2403346,2404340..2404519,
FT                   2404599..2404759,2406763..2406912,2410046..2410211,
FT                   2411484..2411721))
FT                   /gene="Cyp2s1"
FT                   /locus_tag="mCG_7657"
FT                   /product="cytochrome P450, family 2, subfamily s,
FT                   polypeptide 1, transcript variant mCT6627"
FT                   /note="gene_id=mCG7657.1 transcript_id=mCT6627.1 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(2398724..2398920,2399077..2399218,
FT                   2401032..2401219,2403205..2403346,2404340..2404519,
FT                   2404599..2404759,2406763..2406912,2410046..2410211,
FT                   2411484..2411663))
FT                   /codon_start=1
FT                   /gene="Cyp2s1"
FT                   /locus_tag="mCG_7657"
FT                   /product="cytochrome P450, family 2, subfamily s,
FT                   polypeptide 1, isoform CRA_b"
FT                   /note="gene_id=mCG7657.1 transcript_id=mCT6627.1
FT                   protein_id=mCP3783.2 isoform=CRA_b"
FT                   /protein_id="EDL24235.1"
FT                   /translation="MEAASTWALLLALLLLLLLLSLTLFRTPARGYLPPGPTPLPLLGN
FT                   LLQLRPGALYSGLLRLSKKYGPVFTVYLGPWRRVVVLVGHDAVREALGGQAEEFSGRGT
FT                   LATLDKTFDGHGVFFANGERWKQLRKFTLLALRDLGMGKREGEELIQAEVQSLVEAFQK
FT                   TEGRPFNPSMLLAQATSNVVCSLVFGIRLPYDDKEFQAVIQAASGTLLGISSPWGQAYE
FT                   MFSWLLQPLPGPHTQLQHHLGTLAAFTIQQVQKHQGRFQTSGPARDVVDAFLLKMAQEK
FT                   QDPGTEFTEKNLLMTVTYLLFAGTMTIGATIRYALLLLLRYPQVQQRVREELIQELGPG
FT                   RAPSLSDRVRLPYTDAVLHEAQRLLALVPMGMPHTITRTTCFRGYTLPKGTEVFPLIGS
FT                   ILHDPAVFQNPGEFHPGRFLDEDGRLRKHEAFLPYSLGKRVCLGEGLARAELWLFFTSI
FT                   LQAFSLETPCPPGDLSLKPAISGLFNIPPDFQLRVWPTGDQSR"
FT   mRNA            complement(join(2399309..2401219,2403205..2403346,
FT                   2404340..2404519,2404599..2404759,2406763..2406912,
FT                   2410046..2410211,2411689..>2411720))
FT                   /gene="Cyp2s1"
FT                   /locus_tag="mCG_7657"
FT                   /product="cytochrome P450, family 2, subfamily s,
FT                   polypeptide 1, transcript variant mCT191956"
FT                   /note="gene_id=mCG7657.1 transcript_id=mCT191956.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2400855..2401219,2403205..2403346,
FT                   2404340..2404519,2404599..2404759,2406763..2406912,
FT                   2410046..2410211,2411689..>2411691))
FT                   /codon_start=1
FT                   /gene="Cyp2s1"
FT                   /locus_tag="mCG_7657"
FT                   /product="cytochrome P450, family 2, subfamily s,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=mCG7657.1 transcript_id=mCT191956.0
FT                   protein_id=mCP112915.0 isoform=CRA_a"
FT                   /protein_id="EDL24234.1"
FT                   /translation="ELSKKYGPVFTVYLGPWRRVVVLVGHDAVREALGGQAEEFSGRGT
FT                   LATLDKTFDGHGVFFANGERWKQLRKFTLLALRDLGMGKREGEELIQAEVQSLVEAFQK
FT                   TEGRPFNPSMLLAQATSNVVCSLVFGIRLPYDDKEFQAVIQAASGTLLGISSPWGQAYE
FT                   MFSWLLQPLPGPHTQLQHHLGTLAAFTIQQVQKHQGRFQTSGPARDVVDAFLLKMAQEK
FT                   QDPGTEFTEKNLLMTVTYLLFAGTMTIGATIRYALLLLLRYPQVQQRVREELIQELGPG
FT                   RAPSLSDRVRLPYTDAVLHEAQRLLALVPMGMPHTITRTTCFRGYTLPKVGVWHSQSSY
FT                   LCPGTCVLISLSLEDPHPQPPSTSFSPASTEKQFRIEPPGGDIFPILR"
FT   gene            <2417276..4391784
FT                   /locus_tag="mCG_145387"
FT                   /note="gene_id=mCG145387.0"
FT   mRNA            join(<2417276..2417315,4379136..4379160,4390759..4391784)
FT                   /locus_tag="mCG_145387"
FT                   /product="mCG145387"
FT                   /note="gene_id=mCG145387.0 transcript_id=mCT184811.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2417276..2417315,4379136..4379160,4390759..4390852)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145387"
FT                   /product="mCG145387"
FT                   /note="gene_id=mCG145387.0 transcript_id=mCT184811.0
FT                   protein_id=mCP105748.0"
FT                   /protein_id="EDL24166.1"
FT                   /translation="FFFFLFFSFFLSFFFLRFIYFIKYTVAVFKHSRRGGQISLRMVVS
FT                   HHVVAGI"
FT   gene            complement(2423708..2424056)
FT                   /locus_tag="mCG_7661"
FT                   /note="gene_id=mCG7661.0"
FT   mRNA            complement(2423708..2424056)
FT                   /locus_tag="mCG_7661"
FT                   /product="mCG7661"
FT                   /note="gene_id=mCG7661.0 transcript_id=mCT6626.0 created on
FT                   12-AUG-2002"
FT   CDS             complement(2423733..2424038)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7661"
FT                   /product="mCG7661"
FT                   /note="gene_id=mCG7661.0 transcript_id=mCT6626.0
FT                   protein_id=mCP3790.1"
FT                   /protein_id="EDL24233.1"
FT                   /translation="MAERTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKT
FT                   KMKRRAVGIWHCGSCIKTVAGGAWTYNTTSAITVKSAVRRLKELKDQQKPCCLRLA"
FT   gene            complement(2449750..2450040)
FT                   /pseudo
FT                   /locus_tag="mCG_67819"
FT                   /note="gene_id=mCG67819.1"
FT   mRNA            complement(2449750..2450040)
FT                   /pseudo
FT                   /locus_tag="mCG_67819"
FT                   /note="gene_id=mCG67819.1 transcript_id=mCT68002.1 created
FT                   on 12-AUG-2002"
FT   gene            <2455295..2465027
FT                   /locus_tag="mCG_144736"
FT                   /note="gene_id=mCG144736.0"
FT   mRNA            join(<2455295..2455381,2463947..2464022,2464586..2465027)
FT                   /locus_tag="mCG_144736"
FT                   /product="mCG144736"
FT                   /note="gene_id=mCG144736.0 transcript_id=mCT184160.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2455320..2455381,2463947..2464022,2464586..2464783)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144736"
FT                   /product="mCG144736"
FT                   /note="gene_id=mCG144736.0 transcript_id=mCT184160.0
FT                   protein_id=mCP105735.0"
FT                   /protein_id="EDL24232.1"
FT                   /translation="GRSRKGDGYQARKGVEATPERTTSRKPSVQICEPMDGRHFSLKSP
FT                   QGPIILGLLHGCWGSNSDLHAYSARMLLPEMSPQPFLRMLLPEMSPQPFLRMLLPEMSP
FT                   QPFLSIF"
FT   gene            complement(2477025..2477539)
FT                   /pseudo
FT                   /locus_tag="mCG_56193"
FT                   /note="gene_id=mCG56193.1"
FT   mRNA            complement(2477025..2477539)
FT                   /pseudo
FT                   /locus_tag="mCG_56193"
FT                   /note="gene_id=mCG56193.1 transcript_id=mCT56376.1 created
FT                   on 12-AUG-2002"
FT   gene            2492821..2522201
FT                   /locus_tag="mCG_7659"
FT                   /note="gene_id=mCG7659.2"
FT   mRNA            join(2492821..2493000,2506879..2507041,2507195..2507344,
FT                   2509506..2509666,2510389..2510565,2511033..2511174,
FT                   2512575..2512762,2512929..2513070,2521710..2522201)
FT                   /locus_tag="mCG_7659"
FT                   /product="mCG7659, transcript variant mCT171765"
FT                   /note="gene_id=mCG7659.2 transcript_id=mCT171765.0 created
FT                   on 07-AUG-2002"
FT   mRNA            join(2492821..2493000,2506879..2507041,2507195..2507344,
FT                   2509506..2509666,2510389..2510565,2511033..2511174,
FT                   2512575..2512762,2512929..2513070,2521015..2521041,
FT                   2521710..2522098)
FT                   /locus_tag="mCG_7659"
FT                   /product="mCG7659, transcript variant mCT6629"
FT                   /note="gene_id=mCG7659.2 transcript_id=mCT6629.0 created on
FT                   07-AUG-2002"
FT   CDS             join(2492830..2493000,2506879..2507041,2507195..2507344,
FT                   2509506..2509666,2510389..2510565,2511033..2511174,
FT                   2512575..2512762,2512929..2513070,2521015..2521041,
FT                   2521710..2521891)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7659"
FT                   /product="mCG7659, isoform CRA_a"
FT                   /note="gene_id=mCG7659.2 transcript_id=mCT6629.0
FT                   protein_id=mCP3788.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8Q9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008068"
FT                   /db_xref="MGI:MGI:88598"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Q9"
FT                   /protein_id="EDL24230.1"
FT                   /translation="MEPSVLLLLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLLQ
FT                   MDRGGLLKSFIQLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVV
FT                   EPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGA
FT                   PLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQMFELFSG
FT                   FLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYLLRMEKEKSNQHT
FT                   EFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTL
FT                   DDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDP
FT                   QYFEQPDSFNPDHFLDANGALKKSEAFLPFSTGQIFDQKSVGKRICLGESIARNELFLF
FT                   FTSILQNFSVASHVAPKDIDLTPKESGIGKIPPTYQICFLAR"
FT   CDS             join(2492830..2493000,2506879..2507041,2507195..2507344,
FT                   2509506..2509666,2510389..2510565,2511033..2511174,
FT                   2512575..2512762,2512929..2513070,2521710..2521891)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7659"
FT                   /product="mCG7659, isoform CRA_b"
FT                   /note="gene_id=mCG7659.2 transcript_id=mCT171765.0
FT                   protein_id=mCP94684.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9WUD0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008068"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:88598"
FT                   /db_xref="UniProtKB/TrEMBL:Q9WUD0"
FT                   /protein_id="EDL24231.1"
FT                   /translation="MEPSVLLLLALLVGFLLLLARGHPKSRGNFPPGPRPLPLLGNLLQ
FT                   MDRGGLLKSFIQLREKYGDVFTVHLGPRPVVMLCGTDTIREALVGQAEAFSGRGTVAVV
FT                   EPTFKEYGVIFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKSQGA
FT                   PLDPTFLFQCITANIICSIVFGERFEYTDRQFLRLLELFYQTFSLISSFSSQMFELFSG
FT                   FLKYFPGAHRQISKNLQELLDYIGHSVEKHRATLDPSVPRDFIDIYLLRMEKEKSNQHT
FT                   EFHHQNLMMSVLSLFFAGTETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRLPTL
FT                   DDRTKMPYTDAVIHEIQRFSDLIPIGVPHRVTKDTMFRGYLLPKNTEVYPILSSALHDP
FT                   QYFEQPDSFNPDHFLDANGALKKSEAFLPFSTGKRICLGESIARNELFLFFTSILQNFS
FT                   VASHVAPKDIDLTPKESGIGKIPPTYQICFLAR"
FT   assembly_gap    2494848..2494867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2499236..2499255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2532809..2532828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2567375..2568951
FT                   /estimated_length=1577
FT                   /gap_type="unknown"
FT   gene            2578606..2585541
FT                   /pseudo
FT                   /locus_tag="mCG_118147"
FT                   /note="gene_id=mCG118147.1"
FT   mRNA            join(2578606..2578751,2578927..2579060,2579664..2579786,
FT                   2582638..2582814,2583266..2583407,2585044..2585231,
FT                   2585400..2585541)
FT                   /pseudo
FT                   /locus_tag="mCG_118147"
FT                   /note="gene_id=mCG118147.1 transcript_id=mCT119298.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    2586001..2586020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2601612..>2612159)
FT                   /locus_tag="mCG_7654"
FT                   /note="gene_id=mCG7654.1"
FT   mRNA            complement(join(<2601612..2601793,2612073..>2612159))
FT                   /locus_tag="mCG_7654"
FT                   /product="mCG7654"
FT                   /note="gene_id=mCG7654.1 transcript_id=mCT6635.1 created on
FT                   12-AUG-2002"
FT   CDS             complement(join(2601612..2601793,2612073..>2612157))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7654"
FT                   /product="mCG7654"
FT                   /note="gene_id=mCG7654.1 transcript_id=mCT6635.1
FT                   protein_id=mCP3785.1"
FT                   /protein_id="EDL24229.1"
FT                   /translation="HLDTFNPEHFLDASGAPKKNEAFMPFSTGNHICLGEGIAHNELFL
FT                   FFTTILQNFSVSSPVAPKDIDITPKESGITKIPTVYQICLLSD"
FT   assembly_gap    2612180..2640170
FT                   /estimated_length=27991
FT                   /gap_type="unknown"
FT   assembly_gap    2645320..2647697
FT                   /estimated_length=2378
FT                   /gap_type="unknown"
FT   gene            2649668..2684760
FT                   /locus_tag="mCG_8726"
FT                   /note="gene_id=mCG8726.4"
FT   mRNA            join(2649668..2649889,2668648..2668810,2668940..2669089,
FT                   2674267..2674443,2674896..2675039,2676660..2676845,
FT                   2677014..2677155,2684204..2684760)
FT                   /locus_tag="mCG_8726"
FT                   /product="mCG8726"
FT                   /note="gene_id=mCG8726.4 transcript_id=mCT179831.2 created
FT                   on 23-NOV-2004"
FT   CDS             join(2649719..2649889,2668648..2668810,2668940..2669089,
FT                   2674267..2674274)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8726"
FT                   /product="mCG8726"
FT                   /note="gene_id=mCG8726.4 transcript_id=mCT179831.2
FT                   protein_id=mCP102753.1"
FT                   /protein_id="EDL24227.1"
FT                   /translation="MDPSVLLLLAVLLSLFLLLVRGHAKIHGHLPPGPRPLPLLGNLLQ
FT                   MDRGGLLKCFIHLQEKHGDVFTVHLGPRPVVVLCGTQTIREALVNNAEAFSGRGTIAAA
FT                   QLVMQDYGIFFSSGERWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQDV
FT                   "
FT   assembly_gap    2654291..2655191
FT                   /estimated_length=901
FT                   /gap_type="unknown"
FT   gene            2659861..2662557
FT                   /locus_tag="mCG_1050561"
FT                   /note="gene_id=mCG1050561.0"
FT   mRNA            2659861..2662557
FT                   /locus_tag="mCG_1050561"
FT                   /product="mCG1050561"
FT                   /note="gene_id=mCG1050561.0 transcript_id=mCT171766.2
FT                   created on 23-NOV-2004"
FT   CDS             2660123..2660983
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050561"
FT                   /product="mCG1050561"
FT                   /note="gene_id=mCG1050561.0 transcript_id=mCT171766.2
FT                   protein_id=mCP94685.2"
FT                   /protein_id="EDL24228.1"
FT                   /translation="MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDS
FT                   FIEGVSDQVLVAVVVSFALIATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAP
FT                   ARQQFYTEMYCPICLHQASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTL
FT                   LLTVFGEDDQSQDVIRLRQDVNDYNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGL
FT                   FWMFRIRIMLCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVIT
FT                   QRLTR"
FT   assembly_gap    2669106..2670731
FT                   /estimated_length=1626
FT                   /gap_type="unknown"
FT   assembly_gap    2677642..2677852
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   gene            complement(2688191..2688799)
FT                   /pseudo
FT                   /locus_tag="mCG_51202"
FT                   /note="gene_id=mCG51202.1"
FT   mRNA            complement(2688191..2688799)
FT                   /pseudo
FT                   /locus_tag="mCG_51202"
FT                   /note="gene_id=mCG51202.1 transcript_id=mCT51385.1 created
FT                   on 12-AUG-2002"
FT   assembly_gap    2716674..2730462
FT                   /estimated_length=13789
FT                   /gap_type="unknown"
FT   assembly_gap    2731546..2731565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2737871..2737950
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    2745904..2746024
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    2749705..2749933
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    2751198..2753491
FT                   /estimated_length=2294
FT                   /gap_type="unknown"
FT   gene            <2765298..2789511
FT                   /locus_tag="mCG_1050560"
FT                   /note="gene_id=mCG1050560.0"
FT   mRNA            join(<2765298..2765460,2765603..2765752,2766369..2766529,
FT                   2777241..2777417,2777867..2778008,2779560..2779747,
FT                   2779918..2780059,2788954..2789511)
FT                   /locus_tag="mCG_1050560"
FT                   /product="mCG1050560"
FT                   /note="gene_id=mCG1050560.0 transcript_id=mCT7341.4 created
FT                   on 23-NOV-2004"
FT   CDS             join(<2765298..2765460,2765603..2765752,2766369..2766529,
FT                   2777241..2777417,2777867..2778008,2779560..2779747,
FT                   2779918..2780059,2788954..2789135)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050560"
FT                   /product="mCG1050560"
FT                   /note="gene_id=mCG1050560.0 transcript_id=mCT7341.4
FT                   protein_id=mCP3344.3"
FT                   /protein_id="EDL24226.1"
FT                   /translation="LQEKHGDVFTVHLGPRPVVVLCGTQTIREALVDHAEAFSGRGTIA
FT                   AAQLVMQDYGIFFASGQRWKTLRRFSLATMKEFGMGKRSVEERIKEEAQCLVEELKKYQ
FT                   GVPLDPTFLFQCITANIICSIVFGERFDYTDDQFLHLLNLMYKIFSLLSSFSGQMFELF
FT                   SGFLKYFPGVHRQIVKKQQELLDYIAHSVEKHKATLDPSAPRDYIDTYLLRMEKEKSNH
FT                   NTEFHHQNLMMSVLSLFFAGTETTSATLHYGVLLMLKYPHVTEKVQKEIDQVIGSHRLP
FT                   TLDDRTKMPYTDAVIHEIQRFSDLVPIGLPHKVIKDTLFRGYLLPKNTEVYPVLSSALH
FT                   DPQYFEQPDKFNPEHFLDANGALKKCEAFLPFSTGKRICLGESIARNELFIFFTTILQN
FT                   FSVASPVAPKDIDLTPKESGIGKIPPAHQIYFLAR"
FT   assembly_gap    2767471..2767501
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            2824760..2826757
FT                   /pseudo
FT                   /locus_tag="mCG_8727"
FT                   /note="gene_id=mCG8727.1"
FT   mRNA            join(2824760..2825042,2826360..2826757)
FT                   /pseudo
FT                   /locus_tag="mCG_8727"
FT                   /note="gene_id=mCG8727.1 transcript_id=mCT7342.1 created on
FT                   12-AUG-2002"
FT   assembly_gap    2856257..2860119
FT                   /estimated_length=3863
FT                   /gap_type="unknown"
FT   assembly_gap    2861725..2869297
FT                   /estimated_length=7573
FT                   /gap_type="unknown"
FT   assembly_gap    2871865..2878721
FT                   /estimated_length=6857
FT                   /gap_type="unknown"
FT   assembly_gap    2879523..2879967
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   assembly_gap    2881719..2882630
FT                   /estimated_length=912
FT                   /gap_type="unknown"
FT   gene            <2882740..2888916
FT                   /locus_tag="mCG_118137"
FT                   /note="gene_id=mCG118137.0"
FT   mRNA            join(<2882740..2882901,2884534..2884710,2886015..2886156,
FT                   2886595..2886782,2887383..2887524,2888531..2888916)
FT                   /locus_tag="mCG_118137"
FT                   /product="mCG118137"
FT                   /note="gene_id=mCG118137.0 transcript_id=mCT119288.0
FT                   created on 12-AUG-2002"
FT   CDS             join(<2882740..2882901,2884534..2884710,2886015..2886156,
FT                   2886595..2886782,2887383..2887524,2888531..2888712)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118137"
FT                   /product="mCG118137"
FT                   /note="gene_id=mCG118137.0 transcript_id=mCT119288.0
FT                   protein_id=mCP57558.0"
FT                   /protein_id="EDL24225.1"
FT                   /translation="GAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSL
FT                   QFTATSMGQVYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFI
FT                   DSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKYPDIEAKV
FT                   HEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADLIPMGLARRVTKDTKFRDFLLP
FT                   KGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKSDAFVPFSIGKRYCFGEGLA
FT                   RMELFLFLTNIMQNFHFKSTQEPQDIDVSPRLVGFVTIPPTYTMSFLSR"
FT   assembly_gap    2900177..2900196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2906909..2906928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2911992..2912011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2912614..>2924899
FT                   /locus_tag="mCG_1031249"
FT                   /note="gene_id=mCG1031249.0"
FT   mRNA            join(<2912614..2912706,2917475..2917991,2924736..>2924899)
FT                   /locus_tag="mCG_1031249"
FT                   /product="mCG1031249"
FT                   /note="gene_id=mCG1031249.0 transcript_id=mCT148953.0
FT                   created on 13-AUG-2002"
FT   CDS             join(2912614..2912706,2917475..2917991,2924736..2924899)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031249"
FT                   /product="mCG1031249"
FT                   /note="gene_id=mCG1031249.0 transcript_id=mCT148953.0
FT                   protein_id=mCP57768.0"
FT                   /protein_id="EDL24224.1"
FT                   /translation="MADVIPKSLFRRTKLMIGNFSGSASTGTETKDVALDFSLEEWECL
FT                   SFAQRSLYMDVMLENYNNLLFVENHCIHGKYEKVMDQDSQYIVLEHMNIQEKSSKWNKL
FT                   SNVILESSHYTPHKCTEWDKCFSQKSHLNFHQKIHAGEKSYKCSECDKCFTEKGSLRIH
FT                   QRIHTGEKPYKCSECDKCFTGKGNLRIHQRIHIGEKPYKCSRGGGGAIALPPTGPYISS
FT                   SYLAAASSKSSSSPPDSFESSELDNSNNSKSLRGG"
FT   assembly_gap    2913045..2913550
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    2915212..2915231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2916290..2916309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2918008..2921391
FT                   /estimated_length=3384
FT                   /gap_type="unknown"
FT   gene            complement(2944997..>2962710)
FT                   /gene="Nalp9c"
FT                   /locus_tag="mCG_118144"
FT                   /note="gene_id=mCG118144.0"
FT   mRNA            complement(join(2944997..2945340,2948230..2948400,
FT                   2948928..2949098,2952187..2952357,2954941..2955108,
FT                   2957351..2957515,2959185..2959349,2961203..>2962710))
FT                   /gene="Nalp9c"
FT                   /locus_tag="mCG_118144"
FT                   /product="NACHT, LRR and PYD containing protein 9c"
FT                   /note="gene_id=mCG118144.0 transcript_id=mCT119295.1
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(2945190..2945340,2948230..2948400,
FT                   2948928..2949098,2952187..2952357,2954941..2955108,
FT                   2957351..2957515,2959185..2959349,2961203..2962710))
FT                   /codon_start=1
FT                   /gene="Nalp9c"
FT                   /locus_tag="mCG_118144"
FT                   /product="NACHT, LRR and PYD containing protein 9c"
FT                   /note="gene_id=mCG118144.0 transcript_id=mCT119295.1
FT                   protein_id=mCP57590.1"
FT                   /protein_id="EDL24223.1"
FT                   /translation="MPDRSYNTIIDRQYKALLDIFDSESDPATAVVLGTRGKGKTVFLR
FT                   KAMLDWASGVLLQNRFQYVFFFSVFSLNNTTELSLAELISSKLPECSETLDDILSNPKR
FT                   ILFVLDGFDYLKFDLELRTNLCNDWRKRLPTQNVLSSLLQKIMLPECSLLLELGESSCS
FT                   KIIPLLQNPREIIMSGLSEQSIYFYCVSFFKIQLGVEVFKDLKKNEPLFTLCSNPSMLW
FT                   MICSSLMWGHYSREEVISSSESTSAIHTIFIMSAFKSIFGLGSSKYKRFKLKTLCTLAV
FT                   EGMWKQVYVFDSEDLRRNKISESDKTVWLKMKFLQIQGNNIMFYHSTLQWYFATLFYFL
FT                   KQDKDTYHPVIGSLPQLLGEIYAHKQNQWTHAQTFFFGIATKHVITLLKPCFGNISFKT
FT                   IRQEIIRYLKSLSQPECNEKLVHPKKLFFCLIENQEERFVSQVMNLFEEITVDISDSDD
FT                   LGAAEYSLLRASKLKNLHLHIQKKVFSEIHDPEYGSLENFKLDQKFSAINWTMLSILFC
FT                   NLHVLDLGSCHFNKKVIEVLCNSLSPTPNMPLTVFKLQRLLCSFMTNFGDGSLFCTFLQ
FT                   IPQLKYLNLYGTDLSNDVVEMLCSALKCSTCRVEELLLGKCDISSEACGIMATFLINSK
FT                   VKHLSLVENPLKNKGVMFLCKMLKDPSCVLESLMLSYCCLTFIACGHLYEALLSNKHLS
FT                   LLDLGSNFLEDIGVNLLCEALKYPNCTLKELWLPGCYLTSECCEEISAVLTCNKNLKTL
FT                   KLGNNNIQDTGVKRLCEALCHPKCKVQCLGLDMCELSNDCCEDLALALITCNTLKSLNL
FT                   DWNALHHSGLVMLCEALNHKKCKLNMLGLDKSSFSEESQTFLQAVEKKNNNLNVLHFPW
FT                   VEDELKKRGVRLVWNSKN"
FT   assembly_gap    2945395..2946305
FT                   /estimated_length=911
FT                   /gap_type="unknown"
FT   assembly_gap    2958950..2959066
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            complement(2969171..>2980624)
FT                   /locus_tag="mCG_144739"
FT                   /note="gene_id=mCG144739.0"
FT   mRNA            complement(join(2969171..2970295,2970407..2971163,
FT                   2980579..>2980624))
FT                   /locus_tag="mCG_144739"
FT                   /product="mCG144739"
FT                   /note="gene_id=mCG144739.0 transcript_id=mCT184163.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(2970863..>2971156)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144739"
FT                   /product="mCG144739"
FT                   /note="gene_id=mCG144739.0 transcript_id=mCT184163.0
FT                   protein_id=mCP105740.0"
FT                   /protein_id="EDL24222.1"
FT                   /translation="DHFPKMVDSSSYGLLQYFQKLSDEEFQRFKELLQKEQEKFKLKPL
FT                   SWTKIKNTSKEDLVTQLYTHYPRQVWDMVLNLFLQVNRKDLSTMAQIERRGK"
FT   assembly_gap    2993168..2993187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3012087..3053387
FT                   /gene="Nalp4a"
FT                   /locus_tag="mCG_3569"
FT                   /note="gene_id=mCG3569.2"
FT   mRNA            join(3012087..3012232,3012861..3012960,3021455..3021731,
FT                   3026490..3028062,3030600..3030758,3031280..3031444,
FT                   3034271..3034438,3036884..3037054,3039687..3039857,
FT                   3041339..3041509,3052289..3053387)
FT                   /gene="Nalp4a"
FT                   /locus_tag="mCG_3569"
FT                   /product="NACHT, leucine rich repeat and PYD containing 4A,
FT                   transcript variant mCT3373"
FT                   /note="gene_id=mCG3569.2 transcript_id=mCT3373.2 created on
FT                   12-AUG-2002"
FT   mRNA            join(<3012087..3012232,3012861..3012960,3021393..3021731,
FT                   3026490..3028062,3030600..3030758,3031280..3031444,
FT                   3034271..3034438,3036884..3037054,3039687..3039857,
FT                   3041339..3041509,3052289..3052701)
FT                   /gene="Nalp4a"
FT                   /locus_tag="mCG_3569"
FT                   /product="NACHT, leucine rich repeat and PYD containing 4A,
FT                   transcript variant mCT191941"
FT                   /note="gene_id=mCG3569.2 transcript_id=mCT191941.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<3012587..3012621,3012861..3012960,3021393..3021731,
FT                   3026490..3028062,3030600..3030758,3031280..3031444,
FT                   3034271..3034438,3036884..3037054,3039687..3039857,
FT                   3041339..3041509,3052289..3052453)
FT                   /gene="Nalp4a"
FT                   /locus_tag="mCG_3569"
FT                   /product="NACHT, leucine rich repeat and PYD containing 4A,
FT                   transcript variant mCT191942"
FT                   /note="gene_id=mCG3569.2 transcript_id=mCT191942.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    3017618..3018425
FT                   /estimated_length=808
FT                   /gap_type="unknown"
FT   CDS             join(<3021449..3021731,3026490..3028062,3030600..3030758,
FT                   3031280..3031444,3034271..3034438,3036884..3037054,
FT                   3039687..3039857,3041339..3041509,3052289..3052382)
FT                   /codon_start=1
FT                   /gene="Nalp4a"
FT                   /locus_tag="mCG_3569"
FT                   /product="NACHT, leucine rich repeat and PYD containing 4A,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3569.2 transcript_id=mCT191941.0
FT                   protein_id=mCP112853.0 isoform=CRA_a"
FT                   /protein_id="EDL24219.1"
FT                   /translation="DTMASFFSDFGLMWYLEELNKKEFVKFKEFLKQEVLQLGLKQVSW
FT                   TEVKKASRQDLASLLLKHYEEKPAWDMTFRFFQKINRKDLIERAKREIDGCPKLYRAHM
FT                   KTKMTHDSSRAFTISIQNFLKEKFTEDDYDCFENLFQSKGTESKPQVVFLSGGAGVGKT
FT                   LMLKRLMLAWIESPVFLHKFSYIFYFCCREVKQLKTASLAELISREWPGPSAPIEEILS
FT                   KPEKLLFIIDSLEGMECDLFKWESELCDNCTEKQPVNVLLSSLLRRKMLPESSLLISAT
FT                   PESFEKMENRIEYTHVKIIKGLKERNIKMSFHRLFQDRNRAHEAFSLVRENEQLFTVCQ
FT                   VPVLCWMVATCLKEEIEKGRDPVSICRCTTSLYTTHIFNLFIPQNAHSPSKKSQDQLQG
FT                   LCSLAAEGMWTDTFVFGEEALRRNGIMDSDIPILLDIGMLINIRESEKSYIFLHPSVQE
FT                   VCAAIFYLLKSHVDHPSQEVKSIEKLMFAFLKKVKVQWIFFGSFIFGLLHESEQKKLEA
FT                   FFGHQLSQEIKRQLYQCLETISGNEELQEQIDGMKLFYCLFEMDDDTFLVEAMNCMEQI
FT                   NFVAKDYSDVIVAAHCLKHCFTLKKLSFSTQNVLSGAQEHSYMERLLTAWNHICSVFII
FT                   SKDIQELRMKDTNLSESAFSVLYNNLKYHNYTLNVLVANNVFFVCEKYLFFELIQNCNL
FT                   QHLNLSLTILSHSDVKLLCDVLSQAECNIEELVVAACSISSDDCKVFASVLISNKTLKH
FT                   LNLASNTLDKGIASLCKSLCHPDCILEHLVLANCSLNEKCWDYLSEVLRRNKTLSHLDI
FT                   SSNDLKDEGLKVLCRALTLPDSVLKSLSLRHCLITISGCQDLAEVLRNNQNLVSLQVSN
FT                   NKLEDTGVKLLCDAIKHPNCHLEDLGLEACELTGACCEDLASTFTQCKTLWAMNLLKNA
FT                   LDYNGLVVLCEALKQQTCATYVLGLQITDFDTETQAFLVAEQEKNPCLRILSSL"
FT   CDS             join(<3021449..3021731,3026490..3028062,3030600..3030758,
FT                   3031280..3031444,3034271..3034438,3036884..3037054,
FT                   3039687..3039857,3041339..3041509,3052289..3052382)
FT                   /codon_start=1
FT                   /gene="Nalp4a"
FT                   /locus_tag="mCG_3569"
FT                   /product="NACHT, leucine rich repeat and PYD containing 4A,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3569.2 transcript_id=mCT191942.0
FT                   protein_id=mCP112854.0 isoform=CRA_a"
FT                   /protein_id="EDL24220.1"
FT                   /translation="DTMASFFSDFGLMWYLEELNKKEFVKFKEFLKQEVLQLGLKQVSW
FT                   TEVKKASRQDLASLLLKHYEEKPAWDMTFRFFQKINRKDLIERAKREIDGCPKLYRAHM
FT                   KTKMTHDSSRAFTISIQNFLKEKFTEDDYDCFENLFQSKGTESKPQVVFLSGGAGVGKT
FT                   LMLKRLMLAWIESPVFLHKFSYIFYFCCREVKQLKTASLAELISREWPGPSAPIEEILS
FT                   KPEKLLFIIDSLEGMECDLFKWESELCDNCTEKQPVNVLLSSLLRRKMLPESSLLISAT
FT                   PESFEKMENRIEYTHVKIIKGLKERNIKMSFHRLFQDRNRAHEAFSLVRENEQLFTVCQ
FT                   VPVLCWMVATCLKEEIEKGRDPVSICRCTTSLYTTHIFNLFIPQNAHSPSKKSQDQLQG
FT                   LCSLAAEGMWTDTFVFGEEALRRNGIMDSDIPILLDIGMLINIRESEKSYIFLHPSVQE
FT                   VCAAIFYLLKSHVDHPSQEVKSIEKLMFAFLKKVKVQWIFFGSFIFGLLHESEQKKLEA
FT                   FFGHQLSQEIKRQLYQCLETISGNEELQEQIDGMKLFYCLFEMDDDTFLVEAMNCMEQI
FT                   NFVAKDYSDVIVAAHCLKHCFTLKKLSFSTQNVLSGAQEHSYMERLLTAWNHICSVFII
FT                   SKDIQELRMKDTNLSESAFSVLYNNLKYHNYTLNVLVANNVFFVCEKYLFFELIQNCNL
FT                   QHLNLSLTILSHSDVKLLCDVLSQAECNIEELVVAACSISSDDCKVFASVLISNKTLKH
FT                   LNLASNTLDKGIASLCKSLCHPDCILEHLVLANCSLNEKCWDYLSEVLRRNKTLSHLDI
FT                   SSNDLKDEGLKVLCRALTLPDSVLKSLSLRHCLITISGCQDLAEVLRNNQNLVSLQVSN
FT                   NKLEDTGVKLLCDAIKHPNCHLEDLGLEACELTGACCEDLASTFTQCKTLWAMNLLKNA
FT                   LDYNGLVVLCEALKQQTCATYVLGLQITDFDTETQAFLVAEQEKNPCLRILSSL"
FT   CDS             join(3021455..3021731,3026490..3028062,3030600..3030758,
FT                   3031280..3031444,3034271..3034438,3036884..3037054,
FT                   3039687..3039857,3041339..3041509,3052289..3052382)
FT                   /codon_start=1
FT                   /gene="Nalp4a"
FT                   /locus_tag="mCG_3569"
FT                   /product="NACHT, leucine rich repeat and PYD containing 4A,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3569.2 transcript_id=mCT3373.2
FT                   protein_id=mCP8668.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR004020"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="MGI:MGI:2443697"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUQ7"
FT                   /protein_id="EDL24221.1"
FT                   /translation="MASFFSDFGLMWYLEELNKKEFVKFKEFLKQEVLQLGLKQVSWTE
FT                   VKKASRQDLASLLLKHYEEKPAWDMTFRFFQKINRKDLIERAKREIDGCPKLYRAHMKT
FT                   KMTHDSSRAFTISIQNFLKEKFTEDDYDCFENLFQSKGTESKPQVVFLSGGAGVGKTLM
FT                   LKRLMLAWIESPVFLHKFSYIFYFCCREVKQLKTASLAELISREWPGPSAPIEEILSKP
FT                   EKLLFIIDSLEGMECDLFKWESELCDNCTEKQPVNVLLSSLLRRKMLPESSLLISATPE
FT                   SFEKMENRIEYTHVKIIKGLKERNIKMSFHRLFQDRNRAHEAFSLVRENEQLFTVCQVP
FT                   VLCWMVATCLKEEIEKGRDPVSICRCTTSLYTTHIFNLFIPQNAHSPSKKSQDQLQGLC
FT                   SLAAEGMWTDTFVFGEEALRRNGIMDSDIPILLDIGMLINIRESEKSYIFLHPSVQEVC
FT                   AAIFYLLKSHVDHPSQEVKSIEKLMFAFLKKVKVQWIFFGSFIFGLLHESEQKKLEAFF
FT                   GHQLSQEIKRQLYQCLETISGNEELQEQIDGMKLFYCLFEMDDDTFLVEAMNCMEQINF
FT                   VAKDYSDVIVAAHCLKHCFTLKKLSFSTQNVLSGAQEHSYMERLLTAWNHICSVFIISK
FT                   DIQELRMKDTNLSESAFSVLYNNLKYHNYTLNVLVANNVFFVCEKYLFFELIQNCNLQH
FT                   LNLSLTILSHSDVKLLCDVLSQAECNIEELVVAACSISSDDCKVFASVLISNKTLKHLN
FT                   LASNTLDKGIASLCKSLCHPDCILEHLVLANCSLNEKCWDYLSEVLRRNKTLSHLDISS
FT                   NDLKDEGLKVLCRALTLPDSVLKSLSLRHCLITISGCQDLAEVLRNNQNLVSLQVSNNK
FT                   LEDTGVKLLCDAIKHPNCHLEDLGLEACELTGACCEDLASTFTQCKTLWAMNLLKNALD
FT                   YNGLVVLCEALKQQTCATYVLGLQITDFDTETQAFLVAEQEKNPCLRILSSL"
FT   gene            3081663..4449349
FT                   /locus_tag="mCG_1051036"
FT                   /note="gene_id=mCG1051036.0"
FT   mRNA            join(3081663..3082372,3082533..3082649,4426427..4427387,
FT                   4428197..4428241,4431408..4431460,4432260..4432386,
FT                   4434441..4434539,4446636..4449349)
FT                   /locus_tag="mCG_1051036"
FT                   /product="mCG1051036"
FT                   /note="gene_id=mCG1051036.0 transcript_id=mCT194825.0
FT                   created on 27-JAN-2005"
FT   gene            <3134525..3149725
FT                   /gene="Nalp9a"
FT                   /locus_tag="mCG_58472"
FT                   /note="gene_id=mCG58472.2"
FT   mRNA            join(<3134525..3136060,3142079..3142246,3146085..3146255,
FT                   3146818..3146988,3149381..3149725)
FT                   /gene="Nalp9a"
FT                   /locus_tag="mCG_58472"
FT                   /product="NACHT, LRR and PYD containing protein 9a"
FT                   /note="gene_id=mCG58472.2 transcript_id=mCT58655.2 created
FT                   on 12-AUG-2002"
FT   CDS             join(<3134526..3136060,3142079..3142246,3146085..3146255,
FT                   3146818..3146988,3149381..3149531)
FT                   /codon_start=1
FT                   /gene="Nalp9a"
FT                   /locus_tag="mCG_58472"
FT                   /product="NACHT, LRR and PYD containing protein 9a"
FT                   /note="gene_id=mCG58472.2 transcript_id=mCT58655.2
FT                   protein_id=mCP30962.2"
FT                   /protein_id="EDL24218.1"
FT                   /translation="IWTMETNTYIPDRSYHEFIEVQYRALQDIFDCESEPVTVVVSGSR
FT                   GGGKTTFLRKAMLDWASRNLLQNRFQYVFYFSVFSLNNITELSLAELISSTLPESSETV
FT                   DDILSDPKRILFILDGFDYLKFDLELRTNLCNDWRKKLPIQIVLSSLLQKIMLPECSLL
FT                   LELGNASLSNIIPLLQYPREIIMSGFSEQTIEIYCVSFFNTQTGVEIFKNLKSIKPLFN
FT                   LCRCPHLCWMICSTIKWQYERREVASRFGRTLGLLYTIFMVSAFKSTYARNPSKQNRAR
FT                   IRTLCTLAVEGMWKQVYVFDSDDLRRNGISESDKKVWLRMKFLQNQGSNIVFYHSTLQW
FT                   YFAVLFYFLQYKDTRHPVIGNLAQLLGEIYAHKQNQWFHTRILLFGMATEQVNSLLEPC
FT                   FGCISSKEVRQEIIRYIKSLSQQECNEKLVVHPQNLFFCILDNQEERFVRQLMDRFEEM
FT                   TVDISDVDDMSATPYCLHRAPKVKNLHLHIQKRVFLEIHDPEYGDLELFKLDQKLGKCD
FT                   ISSEACGIIAASLINSEVKHLSLVENPLKNKGVMSLCEMLKDPSCVLESLMLPGCYLTS
FT                   ECCEEISAVLTCNTNLKTLKLGNNNIQDTGVKRLCEALCHPNCEMQCLGLDMCDFTSDC
FT                   CEDLALVLTTCNTLKSLNLDWNAFDHSGLEMLCKALNHKACNLEVLGLDKSLFSEESQT
FT                   LLQAVEKKNKNLKVLHFPWLKEELEKRGVRLVWNSKN"
FT   assembly_gap    3144165..3144184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3153760..3153779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3155006..3155025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3157452..3157471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3163674..3163693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3170016..3170276
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    3171410..3171581
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    3181138..3181157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3198414..3198433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3206195..3206598
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    3213858..3215460
FT                   /estimated_length=1603
FT                   /gap_type="unknown"
FT   assembly_gap    3227915..3228195
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    3229267..3230113
FT                   /estimated_length=847
FT                   /gap_type="unknown"
FT   assembly_gap    3231786..3232136
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    3233875..3233894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3234785..>3257234)
FT                   /locus_tag="mCG_10947"
FT                   /note="gene_id=mCG10947.1"
FT   mRNA            complement(join(3234785..3235343,3241938..3242079,
FT                   3242250..3242437,3243581..3243722,3244205..3244381,
FT                   3250192..3250352,3252118..3252267,3252400..3252562,
FT                   3257064..>3257234))
FT                   /locus_tag="mCG_10947"
FT                   /product="mCG10947"
FT                   /note="gene_id=mCG10947.1 transcript_id=mCT10861.1 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(3235162..3235343,3241938..3242079,
FT                   3242250..3242437,3243581..3243722,3244205..3244381,
FT                   3250192..3250352,3252118..3252267,3252400..3252562,
FT                   3257064..3257234))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10947"
FT                   /product="mCG10947"
FT                   /note="gene_id=mCG10947.1 transcript_id=mCT10861.1
FT                   protein_id=mCP3766.1"
FT                   /protein_id="EDL24217.1"
FT                   /translation="MEPSVLLLLALLTGFLLLLIRGQPKAYSRLPPGPRPLPFLGNLLQ
FT                   MDRGGLLKSFIKLRDKHGDVFTVHLGPRPVVMLYGTETIKEALVDHSDAFSGRGAIAVI
FT                   QPIVQDYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGA
FT                   PLDPTFLFQCITANIICSIVFGERFDYTDHQFLHLLDLFYQTLSLISSFSSQLFELFSA
FT                   VLKYFPGTHRQISKNIQEILNYIGHSVEQHKATLDPSAPRDFIDTYLLRMEKEKSNHHT
FT                   EFHHQNLLISVLSLFFAGTETTSTTLRYGFLLMLKYPHVAEKVQKEIDQVISAHHVPTL
FT                   EDRIKMPYTEAVIHEIQRFSDLAPIGLPHTVTKDTVFRGYLLPKNTEVYPILSSALHDP
FT                   RYFEQPDKFNPEHFLDANGALKKSEAFLPFSTGKRICLGEGIARNELFLFFTALLQNFS
FT                   LSSPVAPEDIDLTPKESGFVKIPPVYRICFLPR"
FT   assembly_gap    3236865..3236890
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    3247589..3247608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3268073..3268213
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    3298972..3298991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3309299..>3316597
FT                   /locus_tag="mCG_118149"
FT                   /note="gene_id=mCG118149.1"
FT   mRNA            join(<3309299..3309486,3309711..3309804,3316446..>3316597)
FT                   /locus_tag="mCG_118149"
FT                   /product="mCG118149"
FT                   /note="gene_id=mCG118149.1 transcript_id=mCT119300.1
FT                   created on 09-AUG-2002"
FT   CDS             join(<3309301..3309486,3309711..3309804,3316446..>3316597)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118149"
FT                   /product="mCG118149"
FT                   /note="gene_id=mCG118149.1 transcript_id=mCT119300.1
FT                   protein_id=mCP57740.1"
FT                   /protein_id="EDL24216.1"
FT                   /translation="KVQKEIDQVIGSHQLPTLDDRTKMPYTDTVIHEIQRFSDLAAIDL
FT                   PHRVTIHTLSQVYLLPKYFEQLDCFNPEHFLDANGTLKKSEAFLPFSTGKHVCLGKGIA
FT                   HNELFLFFPTILQNFPVSVPLAPKDIDITPKESGTGKIPQ"
FT   assembly_gap    3311189..3311208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3327935..3343637
FT                   /locus_tag="mCG_10948"
FT                   /note="gene_id=mCG10948.1"
FT   mRNA            join(<3327935..3328108,3329784..3329946,3330089..3330238,
FT                   3332992..3333152,3334091..3334267,3334998..3335139,
FT                   3337483..3337670,3337846..3337987,3342196..3343088,
FT                   3343133..3343637)
FT                   /locus_tag="mCG_10948"
FT                   /product="mCG10948"
FT                   /note="gene_id=mCG10948.1 transcript_id=mCT10862.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(3327935..3328108,3329784..3329946,3330089..3330238,
FT                   3332992..3333152,3334091..3334267,3334998..3335139,
FT                   3337483..3337670,3337846..3337987,3342196..3342377)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10948"
FT                   /product="mCG10948"
FT                   /note="gene_id=mCG10948.1 transcript_id=mCT10862.1
FT                   protein_id=mCP3762.1"
FT                   /protein_id="EDL24215.1"
FT                   /translation="MEFSVLLLLALTTGFLIFLVSQSQPKTHGHFPPGPRPLPFLGNLL
FT                   QMDRRGLLSSFIQLQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAV
FT                   LDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKG
FT                   APLNPTFYFQCIVANIICSIVFGERFDYKDHQFLHLLNLIYQTFSLMSSLSSQVFELFS
FT                   AILKYFPGAHRQISKNLQEILDYIGHSVEKHRATLDPSAPRDFIDTYLLRMEKEKSNHH
FT                   TEFHHQNLVISVLSLFFAGTETSSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPT
FT                   LDDRTKMPYTDAVIHEIQRFTDLAPIGLPHKVTKDTLFRGYLIPKNTEVYPILSSALHD
FT                   PRYFEQPDSFNPEHFLDANGALKTNEAFMPFSTGKRICLGEGIARNELFLFFTTILQNF
FT                   SLASPVAPENIDLIPNNSGATKTPPQYQIHFLSR"
FT   assembly_gap    3339716..3340876
FT                   /estimated_length=1161
FT                   /gap_type="unknown"
FT   assembly_gap    3343107..3343126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3347762..3348029
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    3350363..3350691
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    3352209..3352552
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    3369725..3369843
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   gene            <3378912..3391002
FT                   /gene="Cyp2g1"
FT                   /locus_tag="mCG_10949"
FT                   /note="gene_id=mCG10949.1"
FT   mRNA            join(<3378912..3379091,3379668..3379830,3381344..3381493,
FT                   3384038..3384198,3384532..3384708,3386466..3386607,
FT                   3388877..3389065,3389185..3389326,3390491..3391002)
FT                   /gene="Cyp2g1"
FT                   /locus_tag="mCG_10949"
FT                   /product="cytochrome P450, family 2, subfamily g,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG10949.1 transcript_id=mCT10863.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(3378912..3379091,3379668..3379830,3381344..3381493,
FT                   3384038..3384198,3384532..3384708,3386466..3386607,
FT                   3388877..3388938)
FT                   /codon_start=1
FT                   /gene="Cyp2g1"
FT                   /locus_tag="mCG_10949"
FT                   /product="cytochrome P450, family 2, subfamily g,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG10949.1 transcript_id=mCT10863.1
FT                   protein_id=mCP3763.1"
FT                   /protein_id="EDL24214.1"
FT                   /translation="MMLGGAFSIFMALCLSCLLILIAWKRTSKGGKLPPGPTPIPFLGN
FT                   FLQVRTDATFQSFQKLQKKYGSVFTVYFGPRPVVVLCGHEAVKEALVDQADDFSGRGEM
FT                   PTLEKNFQGYGLALSNGERWKILRRFSLTVLRNFGMGKRSIEERIQEEAGYLLEELHKV
FT                   KGAPIDPTLYLSRTVSNVICSVVFGKRFNYQDQRFQSLMKMINESFVEMSKPWAQLYDM
FT                   YWKVMQYFPGRHNYLYNLIEDLKDFIASRVKINEASFDPSNPRDFIDCFLIKMHQDKSD
FT                   PHTEFNLKNLVLTTLNLFFAGTETVSSTLRYGFLLLLKYPEVEAKIHEEINQVIGTHRT
FT                   PRSG"
FT   assembly_gap    3382071..3382285
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    3387668..3387687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3391003..3391288
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    3392954..3401414
FT                   /estimated_length=8461
FT                   /gap_type="unknown"
FT   assembly_gap    3402420..3402439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3402538..3409980
FT                   /locus_tag="mCG_118140"
FT                   /note="gene_id=mCG118140.1"
FT   mRNA            join(<3402538..3402810,3405694..3405798,3407122..3407263,
FT                   3407699..3407886,3408490..3408631,3409640..3409980)
FT                   /locus_tag="mCG_118140"
FT                   /product="mCG118140, transcript variant mCT171717"
FT                   /note="gene_id=mCG118140.1 transcript_id=mCT171717.0
FT                   created on 07-AUG-2002"
FT   mRNA            join(<3402538..3402713,3403431..3403580,3403847..3404007,
FT                   3405622..3405798,3407122..3407263,3407699..3407886,
FT                   3408490..3408631,3409640..3409926)
FT                   /locus_tag="mCG_118140"
FT                   /product="mCG118140, transcript variant mCT119291"
FT                   /note="gene_id=mCG118140.1 transcript_id=mCT119291.0
FT                   created on 07-AUG-2002"
FT   CDS             join(<3402539..3402713,3403431..3403580,3403847..3404007,
FT                   3405622..3405798,3407122..3407263,3407699..3407886,
FT                   3408490..3408631,3409640..3409821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118140"
FT                   /product="mCG118140, isoform CRA_a"
FT                   /note="gene_id=mCG118140.1 transcript_id=mCT119291.0
FT                   protein_id=mCP57576.0 isoform=CRA_a"
FT                   /protein_id="EDL24212.1"
FT                   /translation="TSHQISQRYGPVFTIYLGPRRIVVLCGQEAVKEALVDQAEEFSGR
FT                   GEQATFDWLFKGYGVAFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDSF
FT                   RKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSMGQL
FT                   YEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEE
FT                   KKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGR
FT                   NRQPKYEDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLG
FT                   SVLKDPKFFSNPKDFNPKHFLDDKGQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTN
FT                   IMQNFHFKSTQAPQDIDVSPRLVGFATIPPTYTMSFLSR"
FT   CDS             join(<3402742..3402810,3405694..3405798,3407122..3407263,
FT                   3407699..3407886,3408490..3408631,3409640..3409821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118140"
FT                   /product="mCG118140, isoform CRA_b"
FT                   /note="gene_id=mCG118140.1 transcript_id=mCT171717.0
FT                   protein_id=mCP94636.0 isoform=CRA_b"
FT                   /protein_id="EDL24213.1"
FT                   /translation="GRGHLRASFPPLLPPPLTFPPLQGLEDFITKKVEHNQRTLDPNSP
FT                   RDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDI
FT                   EAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFRD
FT                   FLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKNDAFVPFSIGKRYCFG
FT                   EGLARMELFLFLTNIMQNFHFKSTQAPQDIDVSPRLVGFATIPPTYTMSFLSR"
FT   assembly_gap    3411485..3411681
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    3421111..3421130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3421871..3421890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3438859..3439016
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    3443954..3443973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3452977..3453013
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    3468942..3469244
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   gene            <3477271..3510382
FT                   /locus_tag="mCG_118142"
FT                   /note="gene_id=mCG118142.1"
FT   mRNA            join(<3477271..3477450,3477649..3477836,3503314..3503399,
FT                   3503660..3503820,3505455..3505665,3507188..3507329,
FT                   3507756..3507943,3508545..3508659,3510155..3510382)
FT                   /locus_tag="mCG_118142"
FT                   /product="mCG118142"
FT                   /note="gene_id=mCG118142.1 transcript_id=mCT119293.1
FT                   created on 09-AUG-2002"
FT   assembly_gap    3480587..3480606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3482845..3488359
FT                   /estimated_length=5515
FT                   /gap_type="unknown"
FT   gene            complement(3488495..3496254)
FT                   /locus_tag="mCG_118150"
FT                   /note="gene_id=mCG118150.0"
FT   mRNA            complement(join(3488495..3489395,3490342..3490483,
FT                   3490992..3491179,3491624..3491762,3493172..3493348,
FT                   3494571..3494731,3494943..3495092,3495604..3495766,
FT                   3496047..3496254))
FT                   /locus_tag="mCG_118150"
FT                   /product="mCG118150"
FT                   /note="gene_id=mCG118150.0 transcript_id=mCT119301.1
FT                   created on 09-AUG-2002"
FT   CDS             complement(join(3489214..3489395,3490342..3490483,
FT                   3490992..3491179,3491624..3491762,3493172..3493348,
FT                   3494571..3494731,3494943..3495092,3495604..3495766,
FT                   3496047..3496223))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118150"
FT                   /product="mCG118150"
FT                   /note="gene_id=mCG118150.0 transcript_id=mCT119301.1
FT                   protein_id=mCP57742.1"
FT                   /db_xref="GOA:B2RXZ2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008067"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:3648316"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXZ2"
FT                   /protein_id="EDL24211.1"
FT                   /translation="MLGSGLLLVAILAFLSVMVLVSVWQQKIRGKLPPGPIPLPFIGNY
FT                   LQLNRKDVYSSITQLQEHYGPVFTIHLGPRRVVVLYGYDAVKEALEDNAEEFSGRGEQA
FT                   TFNTLFKGYGVTFSNGERAKQLRRFSIATLKDFGLGKRGMEERIQEEAGCLIKMLQGTC
FT                   GAPIDPTMYLSKTVSNVISSIVFGDRFNYEDKEFLSLLQMMSQMNQFAASPTGQLYDMF
FT                   HSVMKYLPGPQQQIIKDSHKLEDFMIQKVKHNHSTLDPNSPRGFIDSFLIHMQKEKNFN
FT                   SEFHMKNLVMTSLNLFFAGSETVSSLLRYGFLLLMKHPDVEAKVHEEIDRVIGRNRQPQ
FT                   YEDHMKMPYTQAVIHEIQRFSNFAPLGIPRRITKDTSFRGFFLPKGTDVFPIMGSLMID
FT                   PKFFSSPKDFNPQHFLDDKGQLKKIPAFLPFSIGKRSCLGYSLGKMQLFLFFTTILQNF
FT                   RFKFPRKLEDINESPKPEGFTRIIPKYTMSFVPI"
FT   assembly_gap    3496453..3497226
FT                   /estimated_length=774
FT                   /gap_type="unknown"
FT   CDS             join(<3503780..3503820,3505455..3505665,3507188..3507329,
FT                   3507756..3507943,3508545..3508659,3510155..3510177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118142"
FT                   /product="mCG118142"
FT                   /note="gene_id=mCG118142.1 transcript_id=mCT119293.1
FT                   protein_id=mCP57586.1"
FT                   /protein_id="EDL24210.1"
FT                   /translation="CWEASSSLLPPWGSFLDFSSLFYPQLYEMFSSVMKHLSGPQQQAF
FT                   KELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTQN
FT                   LFFAGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDWVTGRNWQPKYEDRMKMPYAEAVI
FT                   HEIQRFADMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFFNPKDFNPKH
FT                   FLDDKGQFKKKSLCSFY"
FT   assembly_gap    3504045..3504338
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    3514741..3515090
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    3522131..3522150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3524977..3525770
FT                   /estimated_length=794
FT                   /gap_type="unknown"
FT   assembly_gap    3528245..3528602
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   gene            3580197..3587967
FT                   /locus_tag="mCG_133379"
FT                   /note="gene_id=mCG133379.0"
FT   mRNA            join(3580197..3580397,3580677..3580839,3581851..3582000,
FT                   3582217..3582377,3583602..3583778,3585141..3585279,
FT                   3585726..3585913,3586426..3586567,3587580..3587967)
FT                   /locus_tag="mCG_133379"
FT                   /product="mCG133379, transcript variant mCT134745"
FT                   /note="gene_id=mCG133379.0 transcript_id=mCT134745.1
FT                   created on 07-AUG-2002"
FT   mRNA            join(3580205..3580397,3580677..3580839,3581946..3582000,
FT                   3582217..3582377,3583602..3583778,3585141..3585279,
FT                   3585726..3585913,3586426..3586567,3587580..3587931)
FT                   /locus_tag="mCG_133379"
FT                   /product="mCG133379, transcript variant mCT171736"
FT                   /note="gene_id=mCG133379.0 transcript_id=mCT171736.0
FT                   created on 07-AUG-2002"
FT   CDS             join(3580221..3580397,3580677..3580839,3581851..3582000,
FT                   3582217..3582377,3583602..3583778,3585141..3585279,
FT                   3585726..3585913,3586426..3586567,3587580..3587761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133379"
FT                   /product="mCG133379, isoform CRA_a"
FT                   /note="gene_id=mCG133379.0 transcript_id=mCT134745.1
FT                   protein_id=mCP57667.1 isoform=CRA_a"
FT                   /db_xref="GOA:P56593"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008067"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:105055"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56593"
FT                   /protein_id="EDL24208.1"
FT                   /translation="MLGSGLLLLAILAFLSVMVLVSVWQQKIRGKLPPGPIPLPFIGNY
FT                   LQLNRKDVYSSITQLQEHYGPVFTIHLGPRRVVVLYGYDAVKEALVDHAEEFSGRGEQA
FT                   TFNTLFKGYGVAFSNGERAKQLRRFSIATLRDFGMGKRGVEERIQEEAGCLIKMLQGTC
FT                   GAPIDPTIYLSKTASNVISSIVFGDRFNYEDKEFLSLLQMMGQVNKFAASPTGQLYDMF
FT                   HSVMKYLPGPQQQIIKDSHKLEDFMIQKVKQNQSTLDPNSPRDFIDSFLIHMQKEKYVN
FT                   SEFHMKNLVMTSLNLFFAGSETVSSTLRYGFLLLMKHPDVEAKVHEEIDRVIGRNRQPQ
FT                   YEDHMKMPYTQAVINEIQRFSNFAPLGIPRRITKDTSFRGFFLPKGTEVFPILGSLMTD
FT                   PKFFSSPKDFNPQHFLDDKGQLKKIPAFLPFSTGKRFCLGDSLAKMELFLFFTTILQNF
FT                   RFKFPRKLEDINESPTPEGFTRIIPKYTMSFVPI"
FT   CDS             join(3580375..3580397,3580677..3580839,3581946..3582000,
FT                   3582217..3582377,3583602..3583778,3585141..3585279,
FT                   3585726..3585913,3586426..3586567,3587580..3587761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133379"
FT                   /product="mCG133379, isoform CRA_b"
FT                   /note="gene_id=mCG133379.0 transcript_id=mCT171736.0
FT                   protein_id=mCP94655.0 isoform=CRA_b"
FT                   /protein_id="EDL24209.1"
FT                   /translation="MYTAPSHSSKSTMALCSPSTLGLAGLWCFMDTMQSKRLWWTTLRS
FT                   SVDEANRPPLIHSSKAMERIQEEAGCLIKMLQGTCGAPIDPTIYLSKTASNVISSIVFG
FT                   DRFNYEDKEFLSLLQMMGQVNKFAASPTGQLYDMFHSVMKYLPGPQQQIIKDSHKLEDF
FT                   MIQKVKQNQSTLDPNSPRDFIDSFLIHMQKEKYVNSEFHMKNLVMTSLNLFFAGSETVS
FT                   STLRYGFLLLMKHPDVEAKVHEEIDRVIGRNRQPQYEDHMKMPYTQAVINEIQRFSNFA
FT                   PLGIPRRITKDTSFRGFFLPKGTEVFPILGSLMTDPKFFSSPKDFNPQHFLDDKGQLKK
FT                   IPAFLPFSTGKRFCLGDSLAKMELFLFFTTILQNFRFKFPRKLEDINESPTPEGFTRII
FT                   PKYTMSFVPI"
FT   assembly_gap    3593709..3601993
FT                   /estimated_length=8285
FT                   /gap_type="unknown"
FT   assembly_gap    3603320..3603339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3604464..3604483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3607381..3607944)
FT                   /pseudo
FT                   /locus_tag="mCG_1031281"
FT                   /note="gene_id=mCG1031281.1"
FT   mRNA            complement(join(3607381..3607568,3607767..3607944))
FT                   /pseudo
FT                   /locus_tag="mCG_1031281"
FT                   /note="gene_id=mCG1031281.1 transcript_id=mCT148985.1
FT                   created on 13-FEB-2003"
FT   assembly_gap    3608486..3608932
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    3610636..3610655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3614971..3614990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3619349..3619368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3623350..3623369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3637391..3637751
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    3639137..3639156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3643287..3644036
FT                   /estimated_length=750
FT                   /gap_type="unknown"
FT   assembly_gap    3649437..3649617
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    3659716..3659735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3666777..3666796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3673409..3673428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3675564..3675583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3682914..3696593
FT                   /gene="Cyp2f2"
FT                   /locus_tag="mCG_22749"
FT                   /note="gene_id=mCG22749.2"
FT   mRNA            join(3682914..3682954,3684482..3684672,3684766..3684928,
FT                   3687789..3687938,3692123..3692283,3692649..3692825,
FT                   3693226..3693367,3694102..3694289,3695407..3695548,
FT                   3696149..3696592)
FT                   /gene="Cyp2f2"
FT                   /locus_tag="mCG_22749"
FT                   /product="cytochrome P450, family 2, subfamily f,
FT                   polypeptide 2, transcript variant mCT23682"
FT                   /note="gene_id=mCG22749.2 transcript_id=mCT23682.1 created
FT                   on 07-AUG-2002"
FT   mRNA            join(3682917..3682954,3684482..3684577,3684890..3684928,
FT                   3687789..3687938,3692123..3692283,3692649..3692825,
FT                   3693226..3693367,3694102..3694289,3695407..3695548,
FT                   3696149..3696593)
FT                   /gene="Cyp2f2"
FT                   /locus_tag="mCG_22749"
FT                   /product="cytochrome P450, family 2, subfamily f,
FT                   polypeptide 2, transcript variant mCT171739"
FT                   /note="gene_id=mCG22749.2 transcript_id=mCT171739.0 created
FT                   on 07-AUG-2002"
FT   mRNA            join(3682939..3682954,3684482..3684640,3684853..3684928,
FT                   3687789..3687938,3692123..3692283,3692649..3692825,
FT                   3693226..3693367,3694102..3694289,3695407..3695548,
FT                   3696149..3696593)
FT                   /gene="Cyp2f2"
FT                   /locus_tag="mCG_22749"
FT                   /product="cytochrome P450, family 2, subfamily f,
FT                   polypeptide 2, transcript variant mCT171740"
FT                   /note="gene_id=mCG22749.2 transcript_id=mCT171740.0 created
FT                   on 07-AUG-2002"
FT   assembly_gap    3683869..3683888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(3684502..3684672,3684766..3684928,3687789..3687938,
FT                   3692123..3692283,3692649..3692825,3693226..3693367,
FT                   3694102..3694289,3695407..3695548,3696149..3696330)
FT                   /codon_start=1
FT                   /gene="Cyp2f2"
FT                   /locus_tag="mCG_22749"
FT                   /product="cytochrome P450, family 2, subfamily f,
FT                   polypeptide 2, isoform CRA_b"
FT                   /note="gene_id=mCG22749.2 transcript_id=mCT23682.1
FT                   protein_id=mCP4626.2 isoform=CRA_b"
FT                   /protein_id="EDL24206.1"
FT                   /translation="MDGVSTAILLLLLAVISLSLTFSSRGKGQLPPGPKPLPILGNLLQ
FT                   LRSQDLLTSLTKLSKEYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGRGAYPVF
FT                   FNFTRGNGIAFSDGERWKILRRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKMEGK
FT                   PFDPVFILSRSVSNIICSVVFGSRFDYDDERLLTIIHFINDNFKIMSSPWGEMYNIFPS
FT                   VLDWIPGPHKRLFRNFGGMKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQEKQDPLS
FT                   HFNMDTLLMTTHNLLFGGTETVGTTLRHAFLILMKYPKVQARVQEEIDRVVGRSRMPTL
FT                   EDRTSMPYTDAVIHEVQRFADVIPMNLPHRVTRDTPFRGFLIPKGTDVITLLNTVHYDS
FT                   DQFKTPQEFNPEHFLDDNHSFKKSPAFMPFSAGRRLCLGEPLARMELFIYFTSILQNFT
FT                   LQPLVDPEDIDLTPLSSGLGNLPRPFQLCMHIR"
FT   CDS             join(3684502..3684577,3684890..3684928,3687789..3687938,
FT                   3692123..3692283,3692649..3692825,3693226..3693367,
FT                   3694102..3694289,3695407..3695548,3696149..3696330)
FT                   /codon_start=1
FT                   /gene="Cyp2f2"
FT                   /locus_tag="mCG_22749"
FT                   /product="cytochrome P450, family 2, subfamily f,
FT                   polypeptide 2, isoform CRA_a"
FT                   /note="gene_id=mCG22749.2 transcript_id=mCT171739.0
FT                   protein_id=mCP94658.0 isoform=CRA_a"
FT                   /protein_id="EDL24205.1"
FT                   /translation="MDGVSTAILLLLLAVISLSLTFSSRGAYPVFFNFTRGNGIAFSDG
FT                   ERWKILRRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKMEGKPFDPVFILSRSVSN
FT                   IICSVVFGSRFDYDDERLLTIIHFINDNFKIMSSPWGEMYNIFPSVLDWIPGPHKRLFR
FT                   NFGGMKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQEKQDPLSHFNMDTLLMTTHNL
FT                   LFGGTETVGTTLRHAFLILMKYPKVQARVQEEIDRVVGRSRMPTLEDRTSMPYTDAVIH
FT                   EVQRFADVIPMNLPHRVTRDTPFRGFLIPKGTDVITLLNTVHYDSDQFKTPQEFNPEHF
FT                   LDDNHSFKKSPAFMPFSAGRRLCLGEPLARMELFIYFTSILQNFTLQPLVDPEDIDLTP
FT                   LSSGLGNLPRPFQLCMHIR"
FT   CDS             join(3687863..3687938,3692123..3692283,3692649..3692825,
FT                   3693226..3693367,3694102..3694289,3695407..3695548,
FT                   3696149..3696330)
FT                   /codon_start=1
FT                   /gene="Cyp2f2"
FT                   /locus_tag="mCG_22749"
FT                   /product="cytochrome P450, family 2, subfamily f,
FT                   polypeptide 2, isoform CRA_c"
FT                   /note="gene_id=mCG22749.2 transcript_id=mCT171740.0
FT                   protein_id=mCP94659.0 isoform=CRA_c"
FT                   /protein_id="EDL24207.1"
FT                   /translation="MGKRSIEERILEEGSFLLEVLRKMEGKPFDPVFILSRSVSNIICS
FT                   VVFGSRFDYDDERLLTIIHFINDNFKIMSSPWGEMYNIFPSVLDWIPGPHKRLFRNFGG
FT                   MKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQEKQDPLSHFNMDTLLMTTHNLLFGG
FT                   TETVGTTLRHAFLILMKYPKVQARVQEEIDRVVGRSRMPTLEDRTSMPYTDAVIHEVQR
FT                   FADVIPMNLPHRVTRDTPFRGFLIPKGTDVITLLNTVHYDSDQFKTPQEFNPEHFLDDN
FT                   HSFKKSPAFMPFSAGRRLCLGEPLARMELFIYFTSILQNFTLQPLVDPEDIDLTPLSSG
FT                   LGNLPRPFQLCMHIR"
FT   gene            3718068..>3721496
FT                   /locus_tag="mCG_22750"
FT                   /note="gene_id=mCG22750.2"
FT   mRNA            join(3718068..3718235,3718565..3718727,3719089..3719238,
FT                   3719448..3719608,3720150..3720326,3720403..3720544,
FT                   3720646..3720833,3721084..3721225,3721315..>3721496)
FT                   /locus_tag="mCG_22750"
FT                   /product="mCG22750"
FT                   /note="gene_id=mCG22750.2 transcript_id=mCT23683.2 created
FT                   on 09-AUG-2002"
FT   CDS             join(3718095..3718235,3718565..3718727,3719089..3719238,
FT                   3719448..3719608,3720150..3720326,3720403..3720544,
FT                   3720646..3720833,3721084..3721225,3721315..3721496)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22750"
FT                   /product="mCG22750"
FT                   /note="gene_id=mCG22750.2 transcript_id=mCT23683.2
FT                   protein_id=mCP4656.2"
FT                   /protein_id="EDL24204.1"
FT                   /translation="MLLLWWGGVVRRQAQMQKDLPPGPAPLPLLGNLLQLQSGDLDRVL
FT                   MELSSHWGPVFTVWLGPLPAVVLCGYEALRDALVLQADAFSGRGAMAVFDRFTCGNGIV
FT                   FSNGPRWHSLRNFALGVLRELGVGRSTIEDRILEEAACVLDEFQATMGAPFDPQQLLDS
FT                   AVSNVICTVVFGKRYDYGDPEFRRLLNLFSDNFCIMSSRWAEIYNMFPSFMDWIPGPHN
FT                   RIFKNFQELRLFISEQIQWHWQSRQTGEPRDFIDCFLDQMDKEQQDLESHFQDETLVMT
FT                   THDLFFGGTETTSTTLRYGLLIMLKYPEVAAKVQEELDATVGRTWAPRIEDRARLPYTN
FT                   AVLHEIQRFISVLPLGLPRALTRDVNLKNHFLHKGTFVIPLLVSAHRDPTQFKDPDHFN
FT                   PTNFLDDHGEFQNNDAFMPFALGKRMCLGAGLARSEIFLFLTAILQKFSLLPVGSPANI
FT                   NLNPQCTGLGNVPPAFQLRLVAR"
FT   gene            complement(3721587..3729689)
FT                   /gene="Egln2"
FT                   /locus_tag="mCG_22752"
FT                   /note="gene_id=mCG22752.2"
FT   mRNA            complement(join(3721587..3722143,3722456..3722523,
FT                   3722719..3722855,3723220..3723339,3727552..3728660,
FT                   3729248..3729310))
FT                   /gene="Egln2"
FT                   /locus_tag="mCG_22752"
FT                   /product="EGL nine homolog 2 (C. elegans), transcript
FT                   variant mCT23685"
FT                   /note="gene_id=mCG22752.2 transcript_id=mCT23685.2 created
FT                   on 07-AUG-2002"
FT   mRNA            complement(join(3721591..3722143,3722456..3722523,
FT                   3722719..3722855,3723220..3723339,3727552..3728660,
FT                   3729616..3729689))
FT                   /gene="Egln2"
FT                   /locus_tag="mCG_22752"
FT                   /product="EGL nine homolog 2 (C. elegans), transcript
FT                   variant mCT171741"
FT                   /note="gene_id=mCG22752.2 transcript_id=mCT171741.0 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(3722088..3722143,3722456..3722523,
FT                   3722719..3722855,3723220..3723339,3727552..3728430))
FT                   /codon_start=1
FT                   /gene="Egln2"
FT                   /locus_tag="mCG_22752"
FT                   /product="EGL nine homolog 2 (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG22752.2 transcript_id=mCT171741.0
FT                   protein_id=mCP94660.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q80X29"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="MGI:MGI:1932287"
FT                   /db_xref="UniProtKB/TrEMBL:Q80X29"
FT                   /protein_id="EDL24202.1"
FT                   /translation="MDSPCQPQALNQALPQLPGSVSESLESSRARMGVESYLPCPLLPA
FT                   YHRPGASGEASAGNGTPRTTATATTTTASPLREGFGGQDGGELWPLQSEGAAALVTKEC
FT                   QRLAAQGARPEAPKRKWAKDGGDAPSPSKRPWARQENQEAKGESGMGCDSGASNSSSSS
FT                   SNTTSSSGEASARLREEVQPSAPERLALDYIVPCMRYYGICVKDNFLGAVLGGRVLAEV
FT                   EALKWGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAG
FT                   RLGNYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQ
FT                   IFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAARDKY
FT                   QLASGQKGVQVPVSQPTTPT"
FT   CDS             complement(join(3722088..3722143,3722456..3722523,
FT                   3722719..3722855,3723220..3723339,3727552..3728430))
FT                   /codon_start=1
FT                   /gene="Egln2"
FT                   /locus_tag="mCG_22752"
FT                   /product="EGL nine homolog 2 (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG22752.2 transcript_id=mCT23685.2
FT                   protein_id=mCP4668.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q80X29"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="MGI:MGI:1932287"
FT                   /db_xref="UniProtKB/TrEMBL:Q80X29"
FT                   /protein_id="EDL24203.1"
FT                   /translation="MDSPCQPQALNQALPQLPGSVSESLESSRARMGVESYLPCPLLPA
FT                   YHRPGASGEASAGNGTPRTTATATTTTASPLREGFGGQDGGELWPLQSEGAAALVTKEC
FT                   QRLAAQGARPEAPKRKWAKDGGDAPSPSKRPWARQENQEAKGESGMGCDSGASNSSSSS
FT                   SNTTSSSGEASARLREEVQPSAPERLALDYIVPCMRYYGICVKDNFLGAVLGGRVLAEV
FT                   EALKWGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAG
FT                   RLGNYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQ
FT                   IFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAARDKY
FT                   QLASGQKGVQVPVSQPTTPT"
FT   gene            complement(3731365..>3741728)
FT                   /gene="Rab4b"
FT                   /locus_tag="mCG_144021"
FT                   /note="gene_id=mCG144021.0"
FT   mRNA            complement(join(3731365..3731736,3735482..3735612,
FT                   3735709..3735804,3737267..3737421,3737561..3737623,
FT                   3738624..3738738,3739003..3739083,3741572..>3741728))
FT                   /gene="Rab4b"
FT                   /locus_tag="mCG_144021"
FT                   /product="RAB4B, member RAS oncogene family"
FT                   /note="gene_id=mCG144021.0 transcript_id=mCT183445.0
FT                   created on 04-JUN-2003"
FT   CDS             complement(join(3735497..3735612,3735709..3735804,
FT                   3737267..3737421,3737561..3737623,3738624..3738738,
FT                   3739003..3739083,3741572..>3741590))
FT                   /codon_start=1
FT                   /gene="Rab4b"
FT                   /locus_tag="mCG_144021"
FT                   /product="RAB4B, member RAS oncogene family"
FT                   /note="gene_id=mCG144021.0 transcript_id=mCT183445.0
FT                   protein_id=mCP105729.0"
FT                   /protein_id="EDL24201.1"
FT                   /translation="AMAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVE
FT                   FGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWL
FT                   TDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAF
FT                   LKCARTILNKIDSGELDPERMGSGIQYGDISLRQLRQPRSAQAVAPQPCGC"
FT   gene            complement(3742588..3744021)
FT                   /gene="Mia1"
FT                   /locus_tag="mCG_22753"
FT                   /note="gene_id=mCG22753.2"
FT   mRNA            complement(join(3742588..3742679,3743014..3743678,
FT                   3743767..3744021))
FT                   /gene="Mia1"
FT                   /locus_tag="mCG_22753"
FT                   /product="melanoma inhibitory activity 1, transcript
FT                   variant mCT171742"
FT                   /note="gene_id=mCG22753.2 transcript_id=mCT171742.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(3742592..3742679,3743014..3743124,
FT                   3743545..3743678,3743767..3743999))
FT                   /gene="Mia1"
FT                   /locus_tag="mCG_22753"
FT                   /product="melanoma inhibitory activity 1, transcript
FT                   variant mCT23686"
FT                   /note="gene_id=mCG22753.2 transcript_id=mCT23686.1 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(3742656..3742679,3743014..3743124,
FT                   3743545..3743678,3743767..3743893))
FT                   /codon_start=1
FT                   /gene="Mia1"
FT                   /locus_tag="mCG_22753"
FT                   /product="melanoma inhibitory activity 1, isoform CRA_b"
FT                   /note="gene_id=mCG22753.2 transcript_id=mCT23686.1
FT                   protein_id=mCP4643.1 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="MGI:MGI:109615"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8V2"
FT                   /protein_id="EDL24200.1"
FT                   /translation="MMVWSPVLLGIVVLSVFSGPSRADRAMPKLADWKLCADEECSHPI
FT                   SMAVALQDYVAPDCRFLTIYRGQVVYVFSKLKGRGRLFWGGSVQGGYYGDLAARLGYFP
FT                   SSIVREDLTLKPGKIDMKTDQWDFYCQ"
FT   CDS             complement(join(3743365..3743678,3743767..3743893))
FT                   /codon_start=1
FT                   /gene="Mia1"
FT                   /locus_tag="mCG_22753"
FT                   /product="melanoma inhibitory activity 1, isoform CRA_a"
FT                   /note="gene_id=mCG22753.2 transcript_id=mCT171742.0
FT                   protein_id=mCP94661.0 isoform=CRA_a"
FT                   /protein_id="EDL24199.1"
FT                   /translation="MMVWSPVLLGIVVLSVFSGPSRADRAMPKLADWKLCADEECSHPI
FT                   SMAVALQDYVAPDCRFLTIYRGQVVYVFSKLKGRGRLFWGGSVSLQRVIMGRVWGLFGF
FT                   VKPCFPYEGKIWGEGKTRFGGRKDILLLIAFFFFFFRNYREA"
FT   gene            complement(3749851..3759092)
FT                   /locus_tag="mCG_22754"
FT                   /note="gene_id=mCG22754.2"
FT   mRNA            complement(join(3749851..3750209,3751711..3751799,
FT                   3752204..3752377,3754449..3754625,3755715..3755887,
FT                   3758289..3758401,3758836..3759092))
FT                   /locus_tag="mCG_22754"
FT                   /product="mCG22754, transcript variant mCT191955"
FT                   /note="gene_id=mCG22754.2 transcript_id=mCT191955.1 created
FT                   on 29-SEP-2004"
FT   mRNA            complement(join(3749851..3750209,3751711..3751799,
FT                   3752204..3752377,3754449..3754625,3755715..3755887,
FT                   3758289..3758401,3758839..3758912))
FT                   /locus_tag="mCG_22754"
FT                   /product="mCG22754, transcript variant mCT23687"
FT                   /note="gene_id=mCG22754.2 transcript_id=mCT23687.2 created
FT                   on 29-SEP-2004"
FT   CDS             complement(join(3750050..3750209,3751711..3751799,
FT                   3752204..3752377,3754449..3754625,3755715..3755887,
FT                   3758289..3758379))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22754"
FT                   /product="mCG22754, isoform CRA_a"
FT                   /note="gene_id=mCG22754.2 transcript_id=mCT191955.1
FT                   protein_id=mCP112909.1 isoform=CRA_a"
FT                   /protein_id="EDL24197.1"
FT                   /translation="MATIATMPVPETRANHTIYINNLNEKIKKDELKKSLYAIFSQFGQ
FT                   ILDILVSRIMKMRGQAFVIFKEVTSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
FT                   GTYVERDRKREKRKPKSQETPAAKKAVQGGAAAPVVGAVQPVPGMPPMPQAPRIMHHMP
FT                   GQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPE
FT                   ETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMK
FT                   ISFAKK"
FT   CDS             complement(join(3750050..3750209,3751711..3751799,
FT                   3752204..3752377,3754449..3754625,3755715..3755887,
FT                   3758289..3758379))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22754"
FT                   /product="mCG22754, isoform CRA_a"
FT                   /note="gene_id=mCG22754.2 transcript_id=mCT23687.2
FT                   protein_id=mCP4652.2 isoform=CRA_a"
FT                   /protein_id="EDL24198.1"
FT                   /translation="MATIATMPVPETRANHTIYINNLNEKIKKDELKKSLYAIFSQFGQ
FT                   ILDILVSRIMKMRGQAFVIFKEVTSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
FT                   GTYVERDRKREKRKPKSQETPAAKKAVQGGAAAPVVGAVQPVPGMPPMPQAPRIMHHMP
FT                   GQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPE
FT                   ETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMK
FT                   ISFAKK"
FT   gene            <3759968..>3767140
FT                   /locus_tag="mCG_145392"
FT                   /note="gene_id=mCG145392.0"
FT   mRNA            join(<3759968..3760019,3760084..3760274,3763462..3763530,
FT                   3763926..3764050,3765389..3765518,3765608..3765678,
FT                   3766892..>3767140)
FT                   /locus_tag="mCG_145392"
FT                   /product="mCG145392"
FT                   /note="gene_id=mCG145392.0 transcript_id=mCT184816.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<3759990..3760019,3760084..3760274,3763462..3763530,
FT                   3763926..3764050,3765389..3765518,3765608..3765678,
FT                   3766892..>3767140)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145392"
FT                   /product="mCG145392"
FT                   /note="gene_id=mCG145392.0 transcript_id=mCT184816.0
FT                   protein_id=mCP105751.0"
FT                   /protein_id="EDL24196.1"
FT                   /translation="SPYIYFIPTAPPPPPPAPPPPPPPPPLPSAVEPVLPHVYGLKNSQ
FT                   LLKEALEKAGPAPKGKEDVKRLLKLHKDRFRSDLQWILFCADLPSCIQEGPQCGLVALW
FT                   MAEALLSTPDSVSLERLVQVAKERGYTAQGEMFSVADMAKLAQETLDCQAELLCGGLGG
FT                   PNRERVLQHLITGHPLLIPYDEDFNHEPCQKKGHKAHWAVSAGQELALPAVGLQPSPGE
FT                   QPAADRLLTRKGCRWTGVRGTCWWGRGWPLWPGPAAQTTGGKPLAGAGTPALNLTLSTL
FT                   ECFSFFP"
FT   assembly_gap    3760027..3760046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3764558..3764715
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            complement(3770156..>3791442)
FT                   /gene="Itpkc"
FT                   /locus_tag="mCG_22755"
FT                   /note="gene_id=mCG22755.2"
FT   mRNA            complement(join(3770156..3771425,3775293..3775364,
FT                   3775941..3776042,3777357..3777561,3779933..3780146,
FT                   3782581..3782683,3790332..>3791442))
FT                   /gene="Itpkc"
FT                   /locus_tag="mCG_22755"
FT                   /product="inositol 1,4,5-trisphosphate 3-kinase C"
FT                   /note="gene_id=mCG22755.2 transcript_id=mCT23688.2 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(3771222..3771425,3775293..3775364,
FT                   3775941..3776042,3777357..3777561,3779933..3780146,
FT                   3782581..3782683,3790332..>3791441))
FT                   /codon_start=1
FT                   /gene="Itpkc"
FT                   /locus_tag="mCG_22755"
FT                   /product="inositol 1,4,5-trisphosphate 3-kinase C"
FT                   /note="gene_id=mCG22755.2 transcript_id=mCT23688.2
FT                   protein_id=mCP4674.2"
FT                   /protein_id="EDL24195.1"
FT                   /translation="LSEAEAGALPAEARMGLEALRGGRRRQPGLQRPGPGAGGPTGRPE
FT                   GGGPRAWIEESSLHSEAERTDLEPAPCPNGPQAESCGDGHAECEAAGLVVASEKPRQNK
FT                   ELDGSNLQTHPRRNSPLVEMEMAGSWTDGFRTDLHRSDLQSRPKRASLCTQPGFDESWT
FT                   ELDRSDMWQTLPERDNKPRVDNLRTHHGVSKLQTHPVCLSPESSADNSGKELSADASRT
FT                   PHDTDGFWIESQTDDSLKGPSTQTACRQPGSDGFSSKDTESALTQPGTDGLRDDSVLGE
FT                   SNGNDPLDLSEPGELVTNLCSHLECSSLCPVPRLIITPETPEPEAQPVGPQSRIEGGTG
FT                   GFSSASSFDESEDDLVAGGGGTSDPEDRAGSKPWKKLKTVLKYSPFVVSFHKHYYPWVQ
FT                   LSGHAGNFQAGEDGRILKRFCQCEQRSLELLMGDPLRPFVPAYYGMVQRDGQAFNQMED
FT                   LLADFEGPSIMDCKMGSRTYLEEELVKARERPKPRKDMYEKMVAVDPGAPTPEEHAQGA
FT                   ITKPRYMQWRETLSSTSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVNGDLG
FT                   ILRKYVARLEDLRETLENSPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQ
FT                   MLSHRLPWTEGNREDGYLWGLDNLICLLQGLAQS"
FT   gene            3795992..3820920
FT                   /gene="Adck4"
FT                   /locus_tag="mCG_49370"
FT                   /note="gene_id=mCG49370.1"
FT   mRNA            join(3795992..3796151,3796440..3796547,3796916..3796982,
FT                   3800353..3800430,3802772..3802894,3803015..3803100,
FT                   3804954..3805094,3805187..3805268,3806278..3806371,
FT                   3813261..3813402,3813510..3813617,3815235..3815300,
FT                   3819586..3819672,3820197..3820920)
FT                   /gene="Adck4"
FT                   /locus_tag="mCG_49370"
FT                   /product="aarF domain containing kinase 4, transcript
FT                   variant mCT49553"
FT                   /note="gene_id=mCG49370.1 transcript_id=mCT49553.1 created
FT                   on 06-AUG-2002"
FT   mRNA            join(<3796000..3796151,3796440..3796547,3796677..3796796,
FT                   3796916..3796982,3800353..3800430,3802772..3802894,
FT                   3803015..3803100,3804954..3805094,3805187..3805268,
FT                   3806278..3806371,3813261..3813402,3813510..3813617,
FT                   3815235..3815300,3819586..3819672,3820197..3820919)
FT                   /gene="Adck4"
FT                   /locus_tag="mCG_49370"
FT                   /product="aarF domain containing kinase 4, transcript
FT                   variant mCT191916"
FT                   /note="gene_id=mCG49370.1 transcript_id=mCT191916.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3796143..3796151,3796440..3796547,3796677..3796796,
FT                   3796916..3796982,3800353..3800430,3802772..3802894,
FT                   3803015..3803100,3804954..3805094,3805187..3805268,
FT                   3806278..3806371,3813261..3813402,3813510..3813617,
FT                   3815235..3815300,3819586..3819672,3820197..3820499)
FT                   /codon_start=1
FT                   /gene="Adck4"
FT                   /locus_tag="mCG_49370"
FT                   /product="aarF domain containing kinase 4, isoform CRA_a"
FT                   /note="gene_id=mCG49370.1 transcript_id=mCT191916.0
FT                   protein_id=mCP112855.0 isoform=CRA_a"
FT                   /protein_id="EDL24193.1"
FT                   /translation="QPRAMWLELGAMLRRTCGPLGRAVRLPCGGALGPRPHWWGPCRSC
FT                   LAQSVHQDQPGRGLSEDDIRRAREARLRKAPRPQLSDRSRERKVPASRISRLASFGGLA
FT                   VGLGLGALAEVTKKSLPGGSLQHEGVSGLGSSPFLSEANAERIVQTLCTVRGAALKIGQ
FT                   MLSIQDNSFISPQLQRIFERVRQSADFMPRWQMMRVLEEELGKDWQDKVASLEEVPFAA
FT                   ASIGQVHQGLLKDGTEVAVKIQYPGVAQSIQSDVENLLALLKMSVGLPEGLFAEQSLQT
FT                   LQQELAWECDYRREAACAQTFRKLLADDPFFRVPAVVQELCTTRVLGMELAGGIPLDQC
FT                   QGLSQDIRNQICFQLLRLCLRELFEFRFMQTDPNWANFLYDASSHQVTLLDFGASRAFG
FT                   TEFTDHYIEVVKAAADGDRDRVLQKSQDLKFLTGFETKAFSDAHVEAVMILGEPFAASG
FT                   PYDFGAGETARRIQGLIPVLLRHRLRPPPEETYALHRKLAGAFLACARLHAHIACRDLF
FT                   QDTYHRYWASRQTLPLPAAS"
FT   CDS             join(3796443..3796547,3796916..3796982,3800353..3800430,
FT                   3802772..3802894,3803015..3803100,3804954..3805094,
FT                   3805187..3805268,3806278..3806371,3813261..3813402,
FT                   3813510..3813617,3815235..3815300,3819586..3819672,
FT                   3820197..3820499)
FT                   /codon_start=1
FT                   /gene="Adck4"
FT                   /locus_tag="mCG_49370"
FT                   /product="aarF domain containing kinase 4, isoform CRA_b"
FT                   /note="gene_id=mCG49370.1 transcript_id=mCT49553.1
FT                   protein_id=mCP27643.2 isoform=CRA_b"
FT                   /protein_id="EDL24194.1"
FT                   /translation="MWLELGAMLRRTCGPLGRAVRLPCGGALGPRPHWWLSDRSRERKV
FT                   PASRISRLASFGGLAVGLGLGALAEVTKKSLPGGSLQHEGVSGLGSSPFLSEANAERIV
FT                   QTLCTVRGAALKIGQMLSIQDNSFISPQLQRIFERVRQSADFMPRWQMMRVLEEELGKD
FT                   WQDKVASLEEVPFAAASIGQVHQGLLKDGTEVAVKIQYPGVAQSIQSDVENLLALLKMS
FT                   VGLPEGLFAEQSLQTLQQELAWECDYRREAACAQTFRKLLADDPFFRVPAVVQELCTTR
FT                   VLGMELAGGIPLDQCQGLSQDIRNQICFQLLRLCLRELFEFRFMQTDPNWANFLYDASS
FT                   HQVTLLDFGASRAFGTEFTDHYIEVVKAAADGDRDRVLQKSQDLKFLTGFETKAFSDAH
FT                   VEAVMILGEPFAASGPYDFGAGETARRIQGLIPVLLRHRLRPPPEETYALHRKLAGAFL
FT                   ACARLHAHIACRDLFQDTYHRYWASRQTLPLPAAS"
FT   gene            3821851..3845129
FT                   /gene="Numbl"
FT                   /locus_tag="mCG_133361"
FT                   /note="gene_id=mCG133361.0"
FT   mRNA            join(3821851..3821935,3825147..3825231,3827872..3828011,
FT                   3829550..3829624,3829722..3829796,3831774..3831914,
FT                   3836944..3837133,3839616..3839921,3842492..3842614,
FT                   3843742..3845129)
FT                   /gene="Numbl"
FT                   /locus_tag="mCG_133361"
FT                   /product="numb-like"
FT                   /note="gene_id=mCG133361.0 transcript_id=mCT134724.0
FT                   created on 06-AUG-2002"
FT   CDS             join(3821912..3821935,3825147..3825231,3827872..3828011,
FT                   3829550..3829624,3829722..3829796,3831774..3831914,
FT                   3836944..3837133,3839616..3839921,3842492..3842614,
FT                   3843742..3844397)
FT                   /codon_start=1
FT                   /gene="Numbl"
FT                   /locus_tag="mCG_133361"
FT                   /product="numb-like"
FT                   /note="gene_id=mCG133361.0 transcript_id=mCT134724.0
FT                   protein_id=mCP57511.1"
FT                   /db_xref="GOA:O08919"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR010449"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016698"
FT                   /db_xref="MGI:MGI:894702"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08919"
FT                   /protein_id="EDL24192.1"
FT                   /translation="MSRSAAASGGPRRPDQHLSPAPCGASGPPETFRTESDGAGTMNKL
FT                   RQSLRRRKPAYVPEASRPHQWQADEDAVRKGTCSFPVRYLGHVEVEESRGMHVCEDAVK
FT                   KLKAMGRKSVKSVLWVSADGLRVVDDKTKDLLVDQTIEKVSFCAPDRNLDKAFSYICRD
FT                   GTTRRWICHCFLALKDSGERLSHAVGCAFAACLERKQRREKECGVTAAFDASRTSFARE
FT                   GSFRLSGGGRPAEREAGDKKKAEAAAAPAVAPGPAQPGHVSPTPATTSPGEKGEAGTPV
FT                   AAGTTAAAIPRRHAPLEQLVRQGSFRGFPALSQKNSPFKRQLSLRLNELPSTLQRRTDF
FT                   QVKGTVPEMEPPGTGDSDGINALCTQISSSFASAGAPASGPPPATTGTSAWGEPSVPAA
FT                   AAFQPGHKRTPSEAERWLEEVSQVAKAQQQQQQQQQQQQQQQATSVPPMPTMAPTLQPF
FT                   SAPVGPFDTAAAQVAVFLPPTHMQPPFVPAYPGLGYPPMPRVPVVGITPSQMVANAFCS
FT                   AAQLQPQPATLLGKAGAFPPPAAPSAPGGQARPRPNGAPWPPEPAPAPAPELDPFEAQW
FT                   AALEGKPAVEKPSNPFSGDLQKTFEIEL"
FT   gene            complement(<3834932..3922194)
FT                   /locus_tag="mCG_140845"
FT                   /note="gene_id=mCG140845.0"
FT   mRNA            complement(join(<3834932..3835371,3868212..3868340,
FT                   3868857..3869009,3869352..3869732,3870558..3870710,
FT                   3871713..3871859,3872078..3872206,3872973..3873044,
FT                   3873313..3873579,3877024..3877170,3882728..3882853,
FT                   3882942..3883163,3885435..3885560,3885649..3885780,
FT                   3888049..3888180,3888316..3888438,3888838..3888963,
FT                   3889169..3889297,3890114..3890233,3890321..3890446,
FT                   3891046..3891288,3891706..3891831,3892515..3892640,
FT                   3892720..3892851,3893653..3893802,3894201..3894365,
FT                   3894755..3894877,3894983..3895057,3895394..3895496,
FT                   3895586..3895833,3900692..3900801,3901258..3901396,
FT                   3908570..3908614,3909098..3909276,3910493..3910589,
FT                   3911026..3911181,3912855..3913025,3914185..3914301,
FT                   3914387..3914474,3916452..3916567,3917656..3917846,
FT                   3917940..3918030,3918555..3918716,3920332..3920398,
FT                   3920686..3920776,3921174..3921247,3921361..3921406,
FT                   3921533..3921586,3921831..3922194))
FT                   /locus_tag="mCG_140845"
FT                   /product="mCG140845"
FT                   /note="gene_id=mCG140845.0 transcript_id=mCT171735.0
FT                   created on 09-AUG-2002"
FT   CDS             complement(join(3834932..3835371,3868212..3868340,
FT                   3868857..3869009,3869352..3869732,3870558..3870710,
FT                   3871713..3871859,3872078..3872206,3872973..3873044,
FT                   3873313..3873579,3877024..3877170,3882728..3882853,
FT                   3882942..3883163,3885435..3885560,3885649..3885780,
FT                   3888049..3888180,3888316..3888438,3888838..3888963,
FT                   3889169..3889297,3890114..3890233,3890321..3890446,
FT                   3891046..3891288,3891706..3891831,3892515..3892640,
FT                   3892720..3892851,3893653..3893802,3894201..3894365,
FT                   3894755..3894877,3894983..3895057,3895394..3895496,
FT                   3895586..3895833,3900692..3900801,3901258..3901396,
FT                   3908570..3908614,3909098..3909276,3910493..3910589,
FT                   3911026..3911181,3912855..3913025,3914185..3914301,
FT                   3914387..3914474,3916452..3916567,3917656..3917846,
FT                   3917940..3918030,3918555..3918716,3920332..3920398,
FT                   3920686..3920776,3921174..3921247,3921361..3921406,
FT                   3921533..3921586,3921831..3922180))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140845"
FT                   /product="mCG140845"
FT                   /note="gene_id=mCG140845.0 transcript_id=mCT171735.0
FT                   protein_id=mCP94654.0"
FT                   /protein_id="EDL24191.1"
FT                   /translation="MYYTKIREPRKGGGELLNHSKGSPSAPRRNQERPALFKESETVIA
FT                   LSELSVQSPVDPGVSRPMSKRKRRGLCTPGSGCEPAGLRGGGAMAVATTAVEGVPSRGA
FT                   PGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAIFIDRDPTVFAPI
FT                   LNFLRTKELDPRFLHPNLPYYPGVSMVPASSMKPNSTDSLHWVREELDRSSCGNVLFNG
FT                   YLPPPVFPVKRRNRHSLVGPQQIGGRPAPVRRSNTMPPNLGNAGLLGRMLDERAPPSPS
FT                   GQPEEPGMVRLVCGHHNWIAVAYTHFLVCYRLKEASGWQLAFSSPRLDWPIERLALAAR
FT                   VLGGAPGEHDKMVAAATGSEILLWALQAQGGGSEIGVFHLGVPVEALFFVGNQLIATSH
FT                   TGRIGVWNAVTKHWQVQEVQPITSYDAAGSFLLLGCSNGSIYYVDVQKFPLRMKDNDLL
FT                   VSELYRDPAEDGVTALSVYLTPKTSDSGNWIEIAYGTSSGVVRVIVQHPETVGSGPQLF
FT                   QTFSVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILAL
FT                   ESVDGLGGCSAGNDIGPYGERDDQQVFIQKVVPNASQLFVRLSSTGQRVCSVRSVDGSP
FT                   TTAFTVLECEGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLGQTPAGGLTEEELMD
FT                   QLEQSSCRVRNCPPAKCTGLEGCLTPTPSVPSPSRSPVEKSQVSLNWQPLTLQEARALL
FT                   RQRRPRGPWARALLKRRPPHRAPAGQARGVASMVSVHVEHPQEASVVVHQVERVSGPWE
FT                   EANPEALARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGSECASPLPG
FT                   LRTQEVCCRGEGLAWGVHDCHPCAEHLRNSNQVSGPNGPCPPGFERVNGSCVDVDECAT
FT                   GGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCYRVLHDGGCSLPI
FT                   LRNITKQICCCSRVGKAWGRGCQLCPPYGSEGFREICPAGPGYHYSASDLRYNTRPLNQ
FT                   DPPRVTFNQPRVPPATPRPPTGPSSSMCQRNPQVCGPGRCVPRPSGYTCACDPGFRLGP
FT                   QGTRCIDIDECRRVPTPCAPGRCENTPGSFRCVCGTGFQAGPRATECLDVDECRRVPPP
FT                   CDRGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGVCENLPGSFRCVC
FT                   PAGFRGSACEEDVDECAQQPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECS
FT                   RSPSPCAYGRCENTEGSFKCVCPTGFQPNAAGSECEDVDECENRLACPGQECVNSPGSF
FT                   QCRACPVGHHLHRGRCTDVDECSSGTPCGLHGQCTNTKGSFHCSCSTGYRAPSGQPGPC
FT                   ADINECLEGDFCFPHGECLNTDGSFTCTCAPGYRPGPRGASCLDVDECSEEDLCQSGIC
FT                   TNTDGSFECICPPGHRAGPDLASCLDIDECRERGPALCGSQRCENSPGSYRCVRDCDPG
FT                   YHPGPEGTCDDIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDEC
FT                   RNRSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVGTSQSYRLEVALAYPHPNLRSL
FT                   RPGPHSVADIDECREYGSAICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRN
FT                   RSFCGAHAMCQNLPGSFQCVCDQGYEGARDGRHCVDVNECETLQGVCGSALCENVEGSF
FT                   LCVCPNSPEEFDPMTGRCVPPRAPAGTFPGSQPQAPASPSLPARPPAPPPPRRPSPPRQ
FT                   GPVSSGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQCPGTETAEYQ
FT                   SLCPHGRGYLVPSGDLSARRDVDECQLFQDQVCKSGVCVNTAPGYSCYCSNGFYYHAHR
FT                   LECVDNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSRRRCVSNESQSLDDNLGV
FT                   CWQEVGPDLVCSRPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFEALCNVLRPPA
FT                   YGPPRPGGFGIPYEYGPDIGPPYQSLPYGPDLYPPPVLPYDPYPPPPGPFARREAPYGA
FT                   PPFDMPDFEDDGGPYGESETPDPPSRGTGWPYRSRDTRGSFPEPEESSERGSYTGALSE
FT                   PYEGLEAEECGILDGCPHGRCVRVPEGFTCDCFDGYRLDITRMSCVDVNECDEAEATSP
FT                   LCINARCVNTDGSFRCICRPGFAPTHQPHHCVSWRVPSGLWAFGSHPGKLVATVDAIDQ
FT                   KRVLVDGPCTQCPHFKCMQLTGFILEFPHSAGQKYVRKAWEKADINAKWAATRWAKKIS
FT                   ARERLAKMTDFDRLQVMRPMKTRNRIIKTEVKKLQRAAILKAAHKKSSCCSGRHCGGC"
FT   assembly_gap    3852182..3852426
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    3880252..3880271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3883327..3883346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3899686..3899765
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    3915349..3915386
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   gene            complement(3922343..4016061)
FT                   /gene="Spnb4"
FT                   /locus_tag="mCG_22758"
FT                   /note="gene_id=mCG22758.3"
FT   mRNA            complement(join(3922343..3923410,3925700..3925742,
FT                   3925892..3926065,3927512..3927804,3928341..3928413,
FT                   3930067..3930686,3931557..3931753,3932401..3932485,
FT                   3932593..3932731,3933592..3933836,3935181..3935561,
FT                   3936397..3936601,3937871..3938001,3938094..3938372,
FT                   3940143..3940232,3941241..3941465,3957000..3957263,
FT                   3959722..3959868,3963516..3963606,3968301..3968503,
FT                   3969733..3970483,3972958..3973095,3974090..3975023,
FT                   3983087..3983237,3985134..3985436,3986387..3986545,
FT                   3986800..3986917,3986994..3987181,3987417..3987529,
FT                   3992133..3992248,3995253..3995333,3996611..3996702,
FT                   4001469..4001642,4002627..4002778,4010767..4010953,
FT                   4014838..>4014964))
FT                   /gene="Spnb4"
FT                   /locus_tag="mCG_22758"
FT                   /product="spectrin beta 4, transcript variant mCT191958"
FT                   /note="gene_id=mCG22758.3 transcript_id=mCT191958.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3922344..3923410,3925700..3925742,
FT                   3925892..3926065,3927512..3927789,3928341..3928413,
FT                   3930067..3930686,3931557..3931753,3932401..3932485,
FT                   3932593..3932731,3933592..3933938,3935181..3935561,
FT                   3936397..3936601,3937871..3938001,3938094..3938372,
FT                   3940143..3940232,3941241..3941465,3957000..3957263,
FT                   3959722..3959868,3963516..3963606,3968301..3968503,
FT                   3969733..3970483,3972958..3973095,3974090..3975023,
FT                   3983087..3983237,3985134..3985436,3986387..3986545,
FT                   3986800..3986917,3986994..3987181,3987417..3987529,
FT                   3992133..3992248,3995253..3995333,3996611..3996702,
FT                   4001469..4001642,4002627..4002778,4010767..4010953,
FT                   4014838..>4014966))
FT                   /gene="Spnb4"
FT                   /locus_tag="mCG_22758"
FT                   /product="spectrin beta 4, transcript variant mCT23692"
FT                   /note="gene_id=mCG22758.3 transcript_id=mCT23692.2 created
FT                   on 09-AUG-2002"
FT   mRNA            complement(join(3922347..3923410,3925700..3925742,
FT                   3925892..3926065,3927512..3927804,3928344..3928413,
FT                   3930067..3930686,3931557..3931753,3932401..3932485,
FT                   3932593..3932731,3933592..3933836,3935181..3935561,
FT                   3936397..3936601,3937871..3938001,3938094..3938372,
FT                   3940143..3940232,3941241..3941465,3957000..3957263,
FT                   3959722..3959868,3963516..3963606,3968301..3968503,
FT                   3969733..3970483,3972958..3973095,3974090..3975023,
FT                   3983087..3983237,3985134..3985436,3986387..3986545,
FT                   3986800..3986917,3986994..3987181,3987417..3987529,
FT                   3992133..3992248,3995253..3995333,3996611..3996702,
FT                   4001469..4001642,4002627..4002778,4010767..4010953,
FT                   4015913..4016061))
FT                   /gene="Spnb4"
FT                   /locus_tag="mCG_22758"
FT                   /product="spectrin beta 4, transcript variant mCT171743"
FT                   /note="gene_id=mCG22758.3 transcript_id=mCT171743.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(3923252..3923410,3925700..3925742,
FT                   3925892..3926065,3927512..3927804,3928344..3928413,
FT                   3930067..3930686,3931557..3931753,3932401..3932485,
FT                   3932593..3932731,3933592..3933836,3935181..3935561,
FT                   3936397..3936601,3937871..3938001,3938094..3938372,
FT                   3940143..3940232,3941241..3941465,3957000..3957263,
FT                   3959722..3959868,3963516..3963606,3968301..3968503,
FT                   3969733..3970483,3972958..3973095,3974090..3975023,
FT                   3983087..3983237,3985134..3985436,3986387..3986545,
FT                   3986800..3986917,3986994..3987181,3987417..3987529,
FT                   3992133..3992248,3995253..3995333,3996611..3996702,
FT                   4001469..4001642,4002627..4002778,4010767..4010953,
FT                   4015913..4015954))
FT                   /codon_start=1
FT                   /gene="Spnb4"
FT                   /locus_tag="mCG_22758"
FT                   /product="spectrin beta 4, isoform CRA_c"
FT                   /note="gene_id=mCG22758.3 transcript_id=mCT171743.0
FT                   protein_id=mCP94662.0 isoform=CRA_c"
FT                   /protein_id="EDL24190.1"
FT                   /translation="MVVGDTRFHSLCCNALPPPMAQVPGEVDNMEGPAVSNNNNPSARW
FT                   ESPDRGWDREPPAAANAAASLFECSRIKALADEREAVQKKTFTKWVNSHLARVGCHIGD
FT                   LYADLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHSLENVDKALQFLKEQRVHLENVGSH
FT                   DIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRETRSAKDALLLWCQMKTAGYPEVNI
FT                   QNFTTSWRDGLAFNALIHRHRPDLVDLSKLTKSNANYNLQRAFRTAEQHLGLARLLDPE
FT                   DVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDQVLEVDKIIERYEELAAE
FT                   LLAWIHRTVDLISNQKFANSLSGVQQQLQAFTAYCTLEKPVKFQEKGNLEVLLFSIQSK
FT                   LRAHNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRAELIRQEKLELLAQRFDHKV
FT                   AMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIAAYEERVQGVAELAQALAA
FT                   EGYYDARRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKVFQEMVYMVDWMEEMQT
FT                   QLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAALRFSQLQGYQPCDPQVI
FT                   CNRVNHVHGCLSELQEQAARRRAELEASRSLWALLQELEEAESWARDKERLLEATSGSG
FT                   GAAGTAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALRRGEELAAAGGSVGPGAEP
FT                   LHLAGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGADLDGLLDWLRDAYRLAA
FT                   AGDFGHDEASSRRLARQHRALTGEVEAHRGPVGGLRRQLATLGGASGAGPLVVALQVRV
FT                   VEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEKEQWLLAMRVPDSLDD
FT                   VEVVQHRFESLDQEMNSLMGRVLDVNQTVQELVEGGHPSSDEVRSCQDHLNSRWNRIVE
FT                   LVEQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGALQWRLSGLEAALQA
FT                   LEPRQAALLEEAALLAERFPAQATRLHQGAEELGAEWGALAGAAQACGEAVAAAGRLQR
FT                   FLRDLDTFLDWLVRAQEAAGAVEGPLPRSLEEADGLLARHAALKEEVDQREEDYARIVA
FT                   ASEALLASEGAELGPGLALDEWLPHLEVGWHKLLGLWEERREALVQAHVYQLFLRDLCQ
FT                   ALAVLRNQEVALSGAELPCTVESVEEAMKRHRDFLTTMELNQQKMQVAVQAAESLLRQG
FT                   NAYGEQAQEAVARLLEKSQENQLRAQQWMQKLLDQLVLQHFLRDCHELDGWIHEKMLMA
FT                   RDGTREDSHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAASVRKKLGE
FT                   IRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKRLLHMESQLQDVDPGGDLATVN
FT                   SQLKKLQSMESQVEEWCREVGELQAQTAALPLEQASKELVGERQSAVGERLVRLLEPLQ
FT                   ERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGTGLQAVQQHIKKNQGLRREI
FT                   QAHGPRLEEVLERAGVLASLRSPEAEAVRRGQEQLQSAWTGLREAAERRQQTLDAAFQV
FT                   EQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSR
FT                   QCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSLEQQYWLYQLSRQVDELEH
FT                   WIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGHT
FT                   AAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPR
FT                   LTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQ
FT                   EVLQGWKELLAACEDARLHVSSTADALRFHSQARDLLSWMDGIAGQIGAADKPRDVSSV
FT                   EVLMNYHQGLKTELEARVPELATCQELGRSLLLNKSAMADEIQAQLDKLGSRKEEVSEK
FT                   WDRHWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRK
FT                   AAAAWEERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYD
FT                   RGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPETSGKVEPAAPTAAALD
FT                   TTDTPGTPAATELVRPRSERQELADRAEELPRRRRSERQESVDQPEETARRRRPERQES
FT                   ADHEGPHSLTLGRYEQMERRRERRERRIERQESSEQETPTRGELVKGKATLADIVEQLQ
FT                   EKEAGPGIPAGPSLPQPRELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGG
FT                   EGGGSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVL
FT                   SKGELGFYKDSKGPASGGTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQ
FT                   AKDEEEMNGWLEAVANSVAEHAEIARWGQTLPTTSSTDEGNPKREGGERRASGRRK"
FT   CDS             complement(join(3923252..3923410,3925700..3925742,
FT                   3925892..3926065,3927512..3927789,3928341..3928413,
FT                   3930067..3930686,3931557..3931753,3932401..3932485,
FT                   3932593..3932731,3933592..3933938,3935181..3935561,
FT                   3936397..3936601,3937871..3938001,3938094..3938372,
FT                   3940143..3940232,3941241..3941465,3957000..3957263,
FT                   3959722..3959868,3963516..3963606,3968301..3968503,
FT                   3969733..3970483,3972958..3973095,3974090..3975023,
FT                   3983087..3983237,3985134..3985436,3986387..3986545,
FT                   3986800..3986917,3986994..3987181,3987417..3987529,
FT                   3992133..3992248,3995253..3995333,3996611..3996702,
FT                   4001469..4001642,4002627..4002778,4010767..4010953,
FT                   4014838..4014966))
FT                   /codon_start=1
FT                   /gene="Spnb4"
FT                   /locus_tag="mCG_22758"
FT                   /product="spectrin beta 4, isoform CRA_b"
FT                   /note="gene_id=mCG22758.3 transcript_id=mCT23692.2
FT                   protein_id=mCP4629.2 isoform=CRA_b"
FT                   /protein_id="EDL24189.1"
FT                   /translation="MRIWPSGGPVGPNRAGPGPATNARREGGAARRASGTASAAGAQAL
FT                   PPPMAQVPGEVDNMEGPAVSNNNNPSARWESPDRGWDREPPAAANAAASLFECSRIKAL
FT                   ADEREAVQKKTFTKWVNSHLARVGCHIGDLYADLRDGFVLTRLLEVLSGEQLPRPTRGR
FT                   MRIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIET
FT                   EDNRETRSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDLSKL
FT                   TKSNANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALA
FT                   VEGKRIGKVLDQVLEVDKIIERYEELAAELLAWIHRTVDLISNQKFANSLSGVQQQLQA
FT                   FTAYCTLEKPVKFQEKGNLEVLLFSIQSKLRAHNRRLFVPREGCGIWDIDKAWGELEKA
FT                   EHEREAALRAELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAM
FT                   KKHEAIEADIAAYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQWALLTGLVGAR
FT                   RTRLEQNLALQKVFQEMVYMVDWMEEMQTQLLSRECGQHLVEADDLLQKHGLLEGDIAA
FT                   QSERVEALNAAALRFSQLQGYQPCDPQVICNRVNHVHGCLSELQEQAARRRAELEASRS
FT                   LWALLQELEEAESWARDKERLLEATSGSGGAAGTAGGAHDLSSTARLLAQHKILQGELG
FT                   GRRALLQQALRRGEELAAAGGSVGPGAEPLHLAGLAERAASARRRWQRLEEAAARRERR
FT                   LQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG
FT                   PVGGLRRQLATLGGASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRM
FT                   FGEVHACELWIGEKEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNQTVQ
FT                   ELVEGGHPSSDEVRSCQDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVR
FT                   EKRRAVESAPRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAERFPAQATRLHQGA
FT                   EELGAEWGALAGAAQACGEAVAAAGRLQRFLRDLDTFLDWLVRAQEAAGAVEGPLPRSL
FT                   EEADGLLARHAALKEEVDQREEDYARIVAASEALLASEGAELGPGLALDEWLPHLEVGW
FT                   HKLLGLWEERREALVQAHVYQLFLRDLCQALAVLRNQEVALSGAELPCTVESVEEAMKR
FT                   HRDFLTTMELNQQKMQVAVQAAESLLRQGNAYGEQAQEAVARLLEKSQENQLRAQQWMQ
FT                   KLLDQLVLQHFLRDCHELDGWIHEKMLMARDGTREDSHKLHKRWLRHQAFMAELAQNKE
FT                   WLEKIEREGQQLMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQ
FT                   SFAELDKRLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQAQTAAL
FT                   PLEQASKELVGERQSAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELAWVQERL
FT                   PLAMQTERGTGLQAVQQHIKKNQGLRREIQAHGPRLEEVLERAGVLASLRSPEAEAVRR
FT                   GQEQLQSAWTGLREAAERRQQTLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDE
FT                   QSTLQLLKKHLQLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVAL
FT                   KELGEERRVSLEQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSE
FT                   FASETGTAGRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLL
FT                   AASRELHKFFSDARELQGQIEEKRRRLPRLTAPPEPRPSASSMQRTLRAFEHDLQLLVS
FT                   QVMEEERMEVESSKMNRRVEPVPALDQRRTWLVSQVRQLQEGAAQLRTVYAGEHAEAIA
FT                   SREQEVLQGWKELLAACEDARLHVSSTADALRFHSQARDLLSWMDGIAGQIGAADKPRD
FT                   VSSVEVLMNYHQGLKTELEARVPELATCQELGRSLLLNKSAMADEIQAQLDKLGSRKEE
FT                   VSEKWDRHWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHE
FT                   AFRKAAAAWEERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRP
FT                   GGYDRGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPETSGKVEPAAPTA
FT                   AALDTTDTPGTPAATELVRPRSERQELADRAEELPRRRRSERQESVDQPEETARRRRPE
FT                   RQESADHEGPHSLTLGRYEQMERRRERRERRIERQESSEQETPTRGELVKGKATLADIV
FT                   EQLQEKEAGPGIPAGVPRELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGG
FT                   EGGGSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVL
FT                   SKGELGFYKDSKGPASGGTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQ
FT                   AKDEEEMNGWLEAVANSVAEHAEIARWGQTLPTTSSTDEGNPKREGGERRASGRRK"
FT   CDS             complement(join(3923252..3923410,3925700..3925742,
FT                   3925892..3926065,3927512..3927804,3928341..3928413,
FT                   3930067..3930686,3931557..3931753,3932401..3932485,
FT                   3932593..3932731,3933592..3933836,3935181..3935561,
FT                   3936397..3936601,3937871..3938001,3938094..3938372,
FT                   3940143..3940232,3941241..3941465,3957000..3957263,
FT                   3959722..3959868,3963516..3963606,3968301..3968503,
FT                   3969733..3970483,3972958..3973095,3974090..3975023,
FT                   3983087..3983237,3985134..3985436,3986387..3986545,
FT                   3986800..3986917,3986994..3987181,3987417..3987529,
FT                   3992133..3992248,3995253..3995333,3996611..3996702,
FT                   4001469..4001642,4002627..4002778,4010767..4010953,
FT                   4014838..>4014963))
FT                   /codon_start=1
FT                   /gene="Spnb4"
FT                   /locus_tag="mCG_22758"
FT                   /product="spectrin beta 4, isoform CRA_a"
FT                   /note="gene_id=mCG22758.3 transcript_id=mCT191958.0
FT                   protein_id=mCP112910.0 isoform=CRA_a"
FT                   /protein_id="EDL24188.1"
FT                   /translation="RIWPSGGPVGPNRAGPGPATNARREGGAARRASGTASAAGAQALP
FT                   PPMAQVPGEVDNMEGPAVSNNNNPSARWESPDRGWDREPPAAANAAASLFECSRIKALA
FT                   DEREAVQKKTFTKWVNSHLARVGCHIGDLYADLRDGFVLTRLLEVLSGEQLPRPTRGRM
FT                   RIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETE
FT                   DNRETRSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDLSKLT
FT                   KSNANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAV
FT                   EGKRIGKVLDQVLEVDKIIERYEELAAELLAWIHRTVDLISNQKFANSLSGVQQQLQAF
FT                   TAYCTLEKPVKFQEKGNLEVLLFSIQSKLRAHNRRLFVPREGCGIWDIDKAWGELEKAE
FT                   HEREAALRAELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMK
FT                   KHEAIEADIAAYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQWALLTGLVGARR
FT                   TRLEQNLALQKVFQEMVYMVDWMEEMQTQLLSRECGQHLVEADDLLQKHGLLEGDIAAQ
FT                   SERVEALNAAALRFSQLQGYQPCDPQVICNRVNHVHGCLSELQEQAARRRAELEASRSL
FT                   WALLQELEEAESWARDKERLLEATSGSGGAAGTAGGAHDLSSTARLLAQHKILQGELGG
FT                   RRALLQQALRRGEELAAAGGSVGPGAEPLHLAGLAERAASARRRWQRLEEAAARRERRL
FT                   QEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGP
FT                   VGGLRRQLATLGGASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMF
FT                   GEVHACELWIGEKEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNQTVQE
FT                   LVEGGHPSSDEVRSCQDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVRE
FT                   KRRAVESAPRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAERFPAQATRLHQGAE
FT                   ELGAEWGALAGAAQACGEAVAAAGRLQRFLRDLDTFLDWLVRAQEAAGAVEGPLPRSLE
FT                   EADGLLARHAALKEEVDQREEDYARIVAASEALLASEGAELGPGLALDEWLPHLEVGWH
FT                   KLLGLWEERREALVQAHVYQLFLRDLCQALAVLRNQEVALSGAELPCTVESVEEAMKRH
FT                   RDFLTTMELNQQKMQVAVQAAESLLRQGNAYGEQAQEAVARLLEKSQENQLRAQQWMQK
FT                   LLDQLVLQHFLRDCHELDGWIHEKMLMARDGTREDSHKLHKRWLRHQAFMAELAQNKEW
FT                   LEKIEREGQQLMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQS
FT                   FAELDKRLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQAQTAALP
FT                   LEQASKELVGERQSAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELAWVQERLP
FT                   LAMQTERGTGLQAVQQHIKKNQGLRREIQAHGPRLEEVLERAGVLASLRSPEAEAVRRG
FT                   QEQLQSAWTGLREAAERRQQTLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQ
FT                   STLQLLKKHLQLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVALK
FT                   ELGEERRVSLEQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEF
FT                   ASETGTAGRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLA
FT                   ASRELHKFFSDARELQGQIEEKRRRLPRLTAPPEPRPSASSMQRTLRAFEHDLQLLVSQ
FT                   VRQLQEGAAQLRTVYAGEHAEAIASREQEVLQGWKELLAACEDARLHVSSTADALRFHS
FT                   QARDLLSWMDGIAGQIGAADKPRDVSSVEVLMNYHQGLKTELEARVPELATCQELGRSL
FT                   LLNKSAMADEIQAQLDKLGSRKEEVSEKWDRHWEWLQQMLEVHQFAQEAVVADAWLTAQ
FT                   EPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEERFSSLRRLTTIEKLKAEQSKQPPT
FT                   PLLGRKFFGDPTELAAKAAPLLRPGGYDRGLEPLARRASDTLSAEVRTRVGYVRQELKP
FT                   ERLQPRIDRLPETSGKVEPAAPTAAALDTTDTPGTPAATELVRPRSERQELADRAEELP
FT                   RRRRSERQESVDQPEETARRRRPERQESADHEGPHSLTLGRYEQMERRRERRERRIERQ
FT                   ESSEQETPTRGELVKGKATLADIVEQLQEKEAGPGIPAGVPSLPQPRELPPGRLPNGLE
FT                   PPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSAPAPPPPPTHTVQ
FT                   HEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASGGTHGGEPLLSLHK
FT                   ATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVANSVAEHAEIARWGQT
FT                   LPTTSSTDEGNPKREGGERRASGRRK"
FT   assembly_gap    3929249..3929392
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    3951941..3951960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3970895..3970914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3981694..3981713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4016400..4034425
FT                   /gene="Blvrb"
FT                   /locus_tag="mCG_22763"
FT                   /note="gene_id=mCG22763.1"
FT   mRNA            join(4016400..4016571,4027689..4027853,4027996..4028085,
FT                   4031001..4031129,4034154..4034425)
FT                   /gene="Blvrb"
FT                   /locus_tag="mCG_22763"
FT                   /product="biliverdin reductase B (flavin reductase
FT                   (NADPH))"
FT                   /note="gene_id=mCG22763.1 transcript_id=mCT23696.2 created
FT                   on 09-AUG-2002"
FT   CDS             join(4016493..4016571,4027689..4027853,4027996..4028085,
FT                   4031001..4031129,4034154..4034311)
FT                   /codon_start=1
FT                   /gene="Blvrb"
FT                   /locus_tag="mCG_22763"
FT                   /product="biliverdin reductase B (flavin reductase
FT                   (NADPH))"
FT                   /note="gene_id=mCG22763.1 transcript_id=mCT23696.2
FT                   protein_id=mCP4687.2"
FT                   /db_xref="GOA:Q3U6G1"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="MGI:MGI:2385271"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U6G1"
FT                   /protein_id="EDL24187.1"
FT                   /translation="MTVKKIAIFGATGRTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGP
FT                   QPAHVVVGDVRQAADVDKTVAGQEAVIVLLGTGNDLSPTTVMSEGTRNIVTAMKAHGVD
FT                   KVVACTSAFLLWDPTKVPPRLQDVTDDHIRMHKILQESGLKYVAVMPPHIGDQPLTGAY
FT                   TVTLDGRGPSRVISKHDLGHFMLRCLTTNEYDGHTTYPSHQYD"
FT   gene            complement(4037317..4039056)
FT                   /locus_tag="mCG_133364"
FT                   /note="gene_id=mCG133364.0"
FT   mRNA            complement(4037317..4039056)
FT                   /locus_tag="mCG_133364"
FT                   /product="mCG133364"
FT                   /note="gene_id=mCG133364.0 transcript_id=mCT134727.0
FT                   created on 09-AUG-2002"
FT   CDS             complement(4038204..4038968)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133364"
FT                   /product="mCG133364"
FT                   /note="gene_id=mCG133364.0 transcript_id=mCT134727.0
FT                   protein_id=mCP57529.1"
FT                   /db_xref="GOA:Q3U7Z6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="MGI:MGI:97552"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U7Z6"
FT                   /protein_id="EDL24186.1"
FT                   /translation="MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQAL
FT                   RDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETA
FT                   AKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARA
FT                   LPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDK
FT                   NLKPIKPMQFLGDEETVRKAMEAVAAQGKVKK"
FT   gene            4042242..4045625
FT                   /gene="Sertad3"
FT                   /locus_tag="mCG_22762"
FT                   /note="gene_id=mCG22762.1"
FT   mRNA            join(4042242..4042304,4044573..4045506,4045534..4045625)
FT                   /gene="Sertad3"
FT                   /locus_tag="mCG_22762"
FT                   /product="SERTA domain containing 3"
FT                   /note="gene_id=mCG22762.1 transcript_id=mCT23695.1 created
FT                   on 06-AUG-2002"
FT   CDS             4044576..4045169
FT                   /codon_start=1
FT                   /gene="Sertad3"
FT                   /locus_tag="mCG_22762"
FT                   /product="SERTA domain containing 3"
FT                   /note="gene_id=mCG22762.1 transcript_id=mCT23695.1
FT                   protein_id=mCP4677.2"
FT                   /db_xref="GOA:Q3UYB0"
FT                   /db_xref="InterPro:IPR009263"
FT                   /db_xref="MGI:MGI:2180697"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UYB0"
FT                   /protein_id="EDL24185.1"
FT                   /translation="MGGLKRKHSDLEEEEEEEKWDWSPTALRSYQQALLRISLDKVQRS
FT                   LGPRAPSLRRHVLIHNTLQQLQAAIRLAPAPALPPEPLFLGEEDFSLSTTIGSILRELD
FT                   TSMDEMEPPLNPAASSSPQNEIVSQADPVFLEALSSRYLGDSGLDDFFLDIDTSAVEKD
FT                   VALPPPEPPHSLFCSPGSWEWNELDHIMEIILGS"
FT   gene            4055347..4058748
FT                   /gene="Sertad1"
FT                   /locus_tag="mCG_22766"
FT                   /note="gene_id=mCG22766.2"
FT   mRNA            join(4055347..4055515,4057690..4058748)
FT                   /gene="Sertad1"
FT                   /locus_tag="mCG_22766"
FT                   /product="SERTA domain containing 1"
FT                   /note="gene_id=mCG22766.2 transcript_id=mCT23698.2 created
FT                   on 06-AUG-2002"
FT   CDS             4057693..4058403
FT                   /codon_start=1
FT                   /gene="Sertad1"
FT                   /locus_tag="mCG_22766"
FT                   /product="SERTA domain containing 1"
FT                   /note="gene_id=mCG22766.2 transcript_id=mCT23698.2
FT                   protein_id=mCP4659.2"
FT                   /protein_id="EDL24184.1"
FT                   /translation="MLSKGLKRKREEEETMEALSVDSCWLDPSHPAVAQTPPTVASSSL
FT                   FDLSVVKLHHSLRQSEPDLRHLVLVVNTLRRIQASMEPAPVLPPEPIQPPAPSVADSLL
FT                   ASSDAGLSASMASLLEDLNHIEDLNQAPQPQADEGPPGRSIGGISPNLGALDLLGPATG
FT                   CLLDDGLEGLFEDIDTSMYDSELWLPASEGLKPGPENGPAKEEPPELDEAELDYLMDVL
FT                   VGTQALERPPGPGR"
FT   gene            4067759..4088727
FT                   /gene="Prx"
FT                   /locus_tag="mCG_22764"
FT                   /note="gene_id=mCG22764.1"
FT   mRNA            join(4067759..4067800,4072941..4072984,4073073..4073171,
FT                   4073288..4073413,4076354..4076510,4083764..4088727)
FT                   /gene="Prx"
FT                   /locus_tag="mCG_22764"
FT                   /product="periaxin, transcript variant mCT23697"
FT                   /note="gene_id=mCG22764.1 transcript_id=mCT23697.1 created
FT                   on 06-AUG-2002"
FT   mRNA            join(4067759..4067800,4072941..4072984,4073073..4073171,
FT                   4073288..4073413,4076354..4076510,4083764..4083960,
FT                   4084553..4088727)
FT                   /gene="Prx"
FT                   /locus_tag="mCG_22764"
FT                   /product="periaxin, transcript variant mCT171744"
FT                   /note="gene_id=mCG22764.1 transcript_id=mCT171744.0 created
FT                   on 06-AUG-2002"
FT   CDS             join(4073387..4073413,4076354..4076510,4083764..4083960,
FT                   4084553..4088347)
FT                   /codon_start=1
FT                   /gene="Prx"
FT                   /locus_tag="mCG_22764"
FT                   /product="periaxin, isoform CRA_a"
FT                   /note="gene_id=mCG22764.1 transcript_id=mCT171744.0
FT                   protein_id=mCP94663.0 isoform=CRA_a"
FT                   /protein_id="EDL24182.1"
FT                   /translation="MEARSRSAEELRRAELVEIIVETEAQTGVSGFNVAGGGKEGIFVR
FT                   ELREDSPAAKSLSLQEGDQLLSARVFFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGD
FT                   LALRPGTVSGYEMKGPRAKVAKLNIQSLAPVKKKKMVTGALGTPADLAPVDVEFSFPKF
FT                   SRLRRGLKAEAVKGPVPAAPARRRLQLPRLRVREVAEEAQVARMAAAAPPPRKAKAEAE
FT                   AATGAGFTAPQLELVGPRLPSAEVGVPQVSVPKGTPSTEAASGFALHLPTLGLGAPAAP
FT                   AVEPPATGIQVPQVELPTLPSLPTLPTLPCLDTQEGAAVVKVPTLDVAAPSMGVDLALP
FT                   GAEVEAQGEVPEVALKMPRLSFPRFGIRGKEATEAKVVKGSPEAKAKGPRLRMPTFGLS
FT                   LLEPRPSGPEAVAESKLKLPTLKMPSFGIGVTGPEVKAPKGPEVKLPKVPEVKLPKVPE
FT                   AAIPDVQLPEVQLPKMSDMKLPKIPEMVVPDVRLPEVQLPKVPEMKVPEMKLPKVPEMA
FT                   VPDVHLPDVQLPKVPEMKLPKVPEMAVPDVHLPDVQLPKVPEMKLPEMKLPKVPEMAVP
FT                   DVRLPEVQLPKVSEVKLPKMPEMAVPDVHLPELQLPKMSEVKLPKMPEMAVPDVRLPEV
FT                   QLPKVSEMKLPKMPEMTMPDIRLPEVQLPKVPDIKLPEMKLPEIKLPKVPDMAVPDVPL
FT                   PELQLPKVSDIRLPEMQVSQVPEVQLPKMPEMKLSKVPEVQRKSAGAEQAKGTEFSFKL
FT                   PKMTMPKLGKVGKPGEASIEVPDKLMTLPCLQPEVGTEASHVGVPSLSLPSVELDLPGA
FT                   LGLEGQVQEAVPGKVEKPEGPRVAVGVGEVGFRVPSVEIVTPQLPTVEVEKEQLEMVEM
FT                   KVKPSSKFSLPKFGLSGPKAVKGEVEGPGRATKLKVSKFTISLPKARAGTEAEAKGAGE
FT                   AGLLPALDLSIPQLSLDAQLPSGKVEVADSKPKSSRFALPKFGVKGRDSEADVLVAGEA
FT                   ELEGKGWGWDGKVKMPKLKMPSFGLSRGKEAETQDGRVSPGEKLEAIAGQLKIPAVELV
FT                   TPGAQETEKVTSGVKPSGLQVSTTGQVVAEGQESVQRVSTLGISLPQVELASFGEAGPE
FT                   IVAPSAEGTAGSRVQVPQVMLELPGTQVAGGDLLVGEGIFKMPTVTVPQLELDVGLGHE
FT                   AQAGEAAKSEGGIKLKLPTLGTGSRGEGVEPQGPEAQRTFHLSLPDVELTSPVSSHAEY
FT                   QVVEGDGDGGHKLKVRLPLFGLAKAKEGIEVGEKVKSPKLRLPRVGFSQSESVSGEGSP
FT                   SPEEEEEGSGEGASSRRGRVRVRLPRVGLASPSKVSKGQEGDATSKSPVGEKSPKFRFP
FT                   RVSLSPKARSGSRDREEGGFRVRLPSVGFSETAVPGSTRIEGTQAAAI"
FT   CDS             join(4073387..4073413,4076354..4076510,4083764..4084026)
FT                   /codon_start=1
FT                   /gene="Prx"
FT                   /locus_tag="mCG_22764"
FT                   /product="periaxin, isoform CRA_b"
FT                   /note="gene_id=mCG22764.1 transcript_id=mCT23697.1
FT                   protein_id=mCP4619.2 isoform=CRA_b"
FT                   /protein_id="EDL24183.1"
FT                   /translation="MEARSRSAEELRRAELVEIIVETEAQTGVSGFNVAGGGKEGIFVR
FT                   ELREDSPAAKSLSLQEGDQLLSARVFFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGD
FT                   LALRPGTVSGYEMKGPRAKVAKLVRVLSPVPVQDSPSDRVAAAP"
FT   assembly_gap    4080919..4081054
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            <4092060..>4097695
FT                   /locus_tag="mCG_22771"
FT                   /note="gene_id=mCG22771.2"
FT   mRNA            join(<4092060..4092494,4096809..4097165,4097462..>4097695)
FT                   /locus_tag="mCG_22771"
FT                   /product="mCG22771"
FT                   /note="gene_id=mCG22771.2 transcript_id=mCT23704.2 created
FT                   on 26-MAR-2003"
FT   CDS             join(<4092060..4092494,4096809..4097165,4097462..>4097695)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22771"
FT                   /product="mCG22771"
FT                   /note="gene_id=mCG22771.2 transcript_id=mCT23704.2
FT                   protein_id=mCP4647.2"
FT                   /protein_id="EDL24181.1"
FT                   /translation="YDIIEVLGKGTFGEVAKGWRRSTGEMVAIKILKNDAYRSRIIKNE
FT                   LKLLRCVRGLDPDEAHVIRFLEFFHDALKFYLVFELLEQNLFEFQKENNFAPLPARHIR
FT                   TVTLQVLRALARLKELAIIHADLKPENIMLVDQTRCPFRVKVIDFGSASIFSEVRYVKE
FT                   PYIQSRFYRAPEILLGLPFCEKVDVWSLGCVMAELHLGWPLYPGNNEYDQVRYICETQG
FT                   LPKPHLLHAARKAHHFFKRNPHPDATNPWQLKSSADYLAETKVRPLERRKYMLKSLDQI
FT                   ETVNGGGAVSRLSFPDREALAEHADLKSMVELIKRMLTWESHERISPSAALRHPFVSMQ
FT                   QL"
FT   gene            <4097760..4099533
FT                   /locus_tag="mCG_142675"
FT                   /note="gene_id=mCG142675.0"
FT   mRNA            join(<4097760..4098310,4099201..4099533)
FT                   /locus_tag="mCG_142675"
FT                   /product="mCG142675"
FT                   /note="gene_id=mCG142675.0 transcript_id=mCT134749.1
FT                   created on 26-MAR-2003"
FT   CDS             join(<4097762..4098310,4099201..4099380)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142675"
FT                   /product="mCG142675"
FT                   /note="gene_id=mCG142675.0 transcript_id=mCT134749.1
FT                   protein_id=mCP57697.1"
FT                   /protein_id="EDL24180.1"
FT                   /translation="VDGKPPPPVIASAEDGPPYYRLAEEEETAGLGGVTGSGSFFREDK
FT                   APGMQRAIDQLDDLSLQEARRGLWSDTRADMVSDMLVPLKVASTSHRVPDSGPEPILAF
FT                   YGSRLTGRHKARKAPAGSKSDSNFSNLIRLSQASPEDAGPCRGSGWEEGEGRTTSTEPS
FT                   VIPQREGDGPGIKDRPMDAERPGPELFDPSSCPGEWLSEPEWTLEGIRGSRAQGLPAHH
FT                   PHPHGPPRTTSFLQHVGGHH"
FT   gene            complement(4100533..4121539)
FT                   /gene="Pld3"
FT                   /locus_tag="mCG_133360"
FT                   /note="gene_id=mCG133360.0"
FT   mRNA            complement(join(4100533..4100999,4101089..4101188,
FT                   4102160..4102325,4104302..4104441,4106093..4106293,
FT                   4107863..4107990,4108068..4108182,4109610..4109793,
FT                   4110211..4110353,4110439..4110513,4110614..4110706,
FT                   4111269..4111429,4113716..4113790,4121425..4121539))
FT                   /gene="Pld3"
FT                   /locus_tag="mCG_133360"
FT                   /product="phospholipase D family, member 3"
FT                   /note="gene_id=mCG133360.0 transcript_id=mCT134723.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(4100812..4100999,4101089..4101188,
FT                   4102160..4102325,4104302..4104441,4106093..4106293,
FT                   4107863..4107990,4108068..4108182,4109610..4109793,
FT                   4110211..4110353,4110439..4110513,4110614..4110640))
FT                   /codon_start=1
FT                   /gene="Pld3"
FT                   /locus_tag="mCG_133360"
FT                   /product="phospholipase D family, member 3"
FT                   /note="gene_id=mCG133360.0 transcript_id=mCT134723.0
FT                   protein_id=mCP57686.1"
FT                   /protein_id="EDL24179.1"
FT                   /translation="MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLIL
FT                   AVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPS
FT                   TSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRI
FT                   AVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSL
FT                   TQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICL
FT                   NGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFW
FT                   PAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVP
FT                   TDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQL
FT                   EAVFLRDWESPYSHDLDTSANSVGNACRLL"
FT   gene            4121698..4150103
FT                   /gene="2310022A10Rik"
FT                   /locus_tag="mCG_133381"
FT                   /note="gene_id=mCG133381.1"
FT   mRNA            join(4121698..4121780,4124841..4124961,4128016..4128067,
FT                   4131869..4131956,4132043..4132157,4133030..4133111,
FT                   4138889..4139026,4141916..4142065,4146038..4146108,
FT                   4148344..4150103)
FT                   /gene="2310022A10Rik"
FT                   /locus_tag="mCG_133381"
FT                   /product="RIKEN cDNA 2310022A10, transcript variant
FT                   mCT134747"
FT                   /note="gene_id=mCG133381.1 transcript_id=mCT134747.1
FT                   created on 09-AUG-2002"
FT   mRNA            join(4121738..4121780,4124841..4124961,4128016..4128067,
FT                   4131869..4131956,4132043..4132157,4133030..4133077,
FT                   4142028..4142065,4146038..4146108,4148344..4150101)
FT                   /gene="2310022A10Rik"
FT                   /locus_tag="mCG_133381"
FT                   /product="RIKEN cDNA 2310022A10, transcript variant
FT                   mCT171737"
FT                   /note="gene_id=mCG133381.1 transcript_id=mCT171737.0
FT                   created on 09-AUG-2002"
FT   CDS             join(4124917..4124961,4128016..4128067,4131869..4131956,
FT                   4132043..4132157,4133030..4133111,4138889..4139026,
FT                   4141916..4142065,4146038..4146108,4148344..4148844)
FT                   /codon_start=1
FT                   /gene="2310022A10Rik"
FT                   /locus_tag="mCG_133381"
FT                   /product="RIKEN cDNA 2310022A10, isoform CRA_b"
FT                   /note="gene_id=mCG133381.1 transcript_id=mCT134747.1
FT                   protein_id=mCP57685.1 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8E3"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="MGI:MGI:1913617"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8E3"
FT                   /protein_id="EDL24178.1"
FT                   /translation="MGFRIGENLLFNLRKAPGSRVKARKTMVSVTMATSEWIQFFKEAG
FT                   IPPGPAVNYAVMFVDNRIQKSMLLDLNKEIMNELGVTVVGDIIAILKHAKVVHRQDMCK
FT                   AATESVPCNPSPLQGELRRGASSAASRMIANSLNHDSPPHTPTRRSDNSTSKISVTVSN
FT                   KMAAKSAKAAALAHREEESLVVPTKRRRVTAEMEGKYIIHMPKGTTPRTRKILEQQQAA
FT                   KGLHRTSVFDRLGAESKADTTTGTKPTGVFSRLGATPEMDEDLAWDSDNDSSSSSVLQY
FT                   AGVLKKLGRGPTKASAQPALTVKAKATSSATTTATTPKLRRLALPSRPGLEKKPDSLPK
FT                   VSILQRLGKAAVVSEAQDSQVTSTKSKSSAEVKFAIKRTLVGPRGSSSSESLGAQMDHA
FT                   GTVSVFKRLGQRTF"
FT   CDS             join(4132135..4132157,4133030..4133077,4142028..4142065,
FT                   4146038..4146108,4148344..4148844)
FT                   /codon_start=1
FT                   /gene="2310022A10Rik"
FT                   /locus_tag="mCG_133381"
FT                   /product="RIKEN cDNA 2310022A10, isoform CRA_a"
FT                   /note="gene_id=mCG133381.1 transcript_id=mCT171737.0
FT                   protein_id=mCP94656.0 isoform=CRA_a"
FT                   /protein_id="EDL24177.1"
FT                   /translation="MPRWYTARTCAKQPLSQCPATPARTRKILEQQQAAKGLHRTSVFD
FT                   RLGAESKADTTTGTKPTGVFSRLGATPEMDEDLAWDSDNDSSSSSVLQYAGVLKKLGRG
FT                   PTKASAQPALTVKAKATSSATTTATTPKLRRLALPSRPGLEKKPDSLPKVSILQRLGKA
FT                   AVVSEAQDSQVTSTKSKSSAEVKFAIKRTLVGPRGSSSSESLGAQMDHAGTVSVFKRLG
FT                   QRTF"
FT   assembly_gap    4137921..4138019
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    4147243..4147492
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   gene            4159756..4207048
FT                   /locus_tag="mCG_22777"
FT                   /note="gene_id=mCG22777.2"
FT   mRNA            join(4159756..4159885,4176628..4176758,4184246..4184374,
FT                   4186213..4186324,4196846..4196999,4197305..4197436,
FT                   4200427..4200492,4201208..4201276,4202571..4202693,
FT                   4204273..4204401,4204498..4204712,4205157..4205244,
FT                   4205326..4205428,4206296..4207047)
FT                   /locus_tag="mCG_22777"
FT                   /product="mCG22777, transcript variant mCT23667"
FT                   /note="gene_id=mCG22777.2 transcript_id=mCT23667.2 created
FT                   on 09-AUG-2002"
FT   mRNA            join(4173822..4173942,4175248..4175410,4176628..4176758,
FT                   4184246..4184374,4186213..4186324,4196846..4196999,
FT                   4197305..4197436,4200427..4200492,4201208..4201276,
FT                   4202571..4202693,4204273..4204401,4204498..4204712,
FT                   4205157..4205244,4205326..4205428,4206296..4207048)
FT                   /locus_tag="mCG_22777"
FT                   /product="mCG22777, transcript variant mCT171745"
FT                   /note="gene_id=mCG22777.2 transcript_id=mCT171745.0 created
FT                   on 09-AUG-2002"
FT   CDS             join(4176713..4176758,4184246..4184374,4186213..4186324,
FT                   4196846..4196999,4197305..4197436,4200427..4200492,
FT                   4201208..4201276,4202571..4202693,4204273..4204401,
FT                   4204498..4204712,4205157..4205244,4205326..4205428,
FT                   4206296..4206375)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22777"
FT                   /product="mCG22777, isoform CRA_a"
FT                   /note="gene_id=mCG22777.2 transcript_id=mCT23667.2
FT                   protein_id=mCP4657.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TY95"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR034677"
FT                   /db_xref="MGI:MGI:104874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TY95"
FT                   /protein_id="EDL24175.1"
FT                   /translation="MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAP
FT                   DQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQ
FT                   MVANSLKQRGPGEDAMDYKCGSPSDSSTSEMMEVAVNKARAKVTMNDFDYLKLLGKGTF
FT                   GKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTH
FT                   DRLCFVMEYANGGELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENL
FT                   MLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVM
FT                   YEMMCGRLPFYNQDHERLFELILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSD
FT                   AKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDS
FT                   LDPLELDQRTHFPQFSYSASIRE"
FT   CDS             join(4176713..4176758,4184246..4184374,4186213..4186324,
FT                   4196846..4196999,4197305..4197436,4200427..4200492,
FT                   4201208..4201276,4202571..4202693,4204273..4204401,
FT                   4204498..4204712,4205157..4205244,4205326..4205428,
FT                   4206296..4206375)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22777"
FT                   /product="mCG22777, isoform CRA_a"
FT                   /note="gene_id=mCG22777.2 transcript_id=mCT171745.0
FT                   protein_id=mCP94664.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TY95"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR034677"
FT                   /db_xref="MGI:MGI:104874"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TY95"
FT                   /protein_id="EDL24176.1"
FT                   /translation="MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAP
FT                   DQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQ
FT                   MVANSLKQRGPGEDAMDYKCGSPSDSSTSEMMEVAVNKARAKVTMNDFDYLKLLGKGTF
FT                   GKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTH
FT                   DRLCFVMEYANGGELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENL
FT                   MLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVM
FT                   YEMMCGRLPFYNQDHERLFELILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSD
FT                   AKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDS
FT                   LDPLELDQRTHFPQFSYSASIRE"
FT   assembly_gap    4207049..4207094
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            4222139..4224429
FT                   /locus_tag="mCG_22774"
FT                   /note="gene_id=mCG22774.1"
FT   mRNA            join(4222139..4222564,4223129..4223311,4224128..4224429)
FT                   /locus_tag="mCG_22774"
FT                   /product="mCG22774"
FT                   /note="gene_id=mCG22774.1 transcript_id=mCT23664.2 created
FT                   on 09-AUG-2002"
FT   CDS             join(4222144..4222564,4223129..4223311,4224128..4224243)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22774"
FT                   /product="mCG22774"
FT                   /note="gene_id=mCG22774.1 transcript_id=mCT23664.2
FT                   protein_id=mCP4683.2"
FT                   /protein_id="EDL24174.1"
FT                   /translation="MQRGALSPVLMLSAAPEPPPRPPPALSPPGPGSAPRHGSARSGPA
FT                   PEPSGGLAAALDSSLRAAVAFKAEGQRCYREKKFREAIGKYHRALLQLKAAQGARPGGL
FT                   PTPSPGPTTSPGPARLSEEQRRLVENTEVECYDSLTACLLQSELVNYERVREYCLKVLE
FT                   KQQGNFKATYRAGIAFYHLGDYARALRYLQEARSREPTDTNVLRYIQLTQLKMNRCSLQ
FT                   REDSDGGTGGPARNVVG"
FT   gene            complement(4224597..>4232742)
FT                   /locus_tag="mCG_145397"
FT                   /note="gene_id=mCG145397.0"
FT   mRNA            complement(join(4224597..4225203,4226069..4226749,
FT                   4227047..4227159,4227238..4227391,4229744..4229860,
FT                   4231434..4231680,4232607..>4232742))
FT                   /locus_tag="mCG_145397"
FT                   /product="mCG145397"
FT                   /note="gene_id=mCG145397.0 transcript_id=mCT184821.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4224881..4225203,4226069..4226749,
FT                   4227047..4227159,4227238..4227391,4229744..4229860,
FT                   4231434..4231680,4232607..>4232741))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145397"
FT                   /product="mCG145397"
FT                   /note="gene_id=mCG145397.0 transcript_id=mCT184821.0
FT                   protein_id=mCP105756.0"
FT                   /protein_id="EDL24173.1"
FT                   /translation="SILKQLEVIEQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEK
FT                   ELRSREEELLRAAQEQRFQEEQLRRREQELAEREMDIVERELHLLMSQLSQEKPRVRKR
FT                   KGNFKRSRLLKLREGSSHISLPSGFEHKITVQASPTLDKRKGSDGASPPASPSIIPRLR
FT                   AIRLTPMDCGGSSGSGTWSRSGPPKKEELVGGKKKGRTWGPSSTLQKERAGGEERLKAL
FT                   GEGSKQWSSSAPNLGKSPKHTPMAPGFASLNEMEEFAEADEGNNVPPSPYSTPSYLKVP
FT                   LPAEPSPCVQAPWEPPAVTPSRPGHGARRRCDLALLSCATLLSAVGLGADVAEARAGDG
FT                   EEQRRWLDSLFFPRPGRFPRGLSPTGRPGGRREDTAPGLGLAPSATLVSLSSVSDCNST
FT                   RSLLRSDSDEAAPAAPSPPPSPLAPSPSTNPLVDVELESFKKDPRQSLTPTHVTAAHAV
FT                   SRGHRRTPSDGALRQREPLELTNHGPRDPLDFPRLPDPQALFPTRRRPLEFPGRPTTLT
FT                   FAPRPRPAASRPRLDPWKLVSFGRTLSISPPSRPDTPESPGPPSVQPTLLDMDMEGQSQ
FT                   DNTVPLCGVYGSH"
FT   gene            complement(4236357..4242788)
FT                   /locus_tag="mCG_147826"
FT                   /note="gene_id=mCG147826.0"
FT   mRNA            complement(join(4236357..4236738,4241550..4242788))
FT                   /locus_tag="mCG_147826"
FT                   /product="mCG147826"
FT                   /note="gene_id=mCG147826.0 transcript_id=mCT188089.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(4236551..4236738,4241550..4242231))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147826"
FT                   /product="mCG147826"
FT                   /note="gene_id=mCG147826.0 transcript_id=mCT188089.0
FT                   protein_id=mCP108445.0"
FT                   /db_xref="GOA:A0A0U1RQ74"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015785"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1346879"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U1RQ74"
FT                   /protein_id="EDL24172.1"
FT                   /translation="MEEEEGAAAREWGATPAGPVWTAVFDYEAVGDEELTLRRGDRVQV
FT                   LSQDCAVSGDEGWWTGQLPSGRVGVFPSNYVAPAAPAAPSDLQLPQEIPFHELQLEEII
FT                   GVGGFGKVYRAVWRGEEVAVKAARLDPERDPAVTAEQVRQEARLFGALQHPNIIALRGA
FT                   CLSPPNLCLVMEYARGGALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRD
FT                   LKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFS
FT                   KSSDVWRC"
FT   gene            4242868..4275111
FT                   /locus_tag="mCG_147820"
FT                   /note="gene_id=mCG147820.0"
FT   mRNA            join(4242868..4242994,4259972..4260052,4261239..4261291,
FT                   4262239..4262365,4267404..4267502,4271011..4275111)
FT                   /locus_tag="mCG_147820"
FT                   /product="mCG147820"
FT                   /note="gene_id=mCG147820.0 transcript_id=mCT188083.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    4248825..4248844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(4261259..4261291,4262239..4262365,4267404..4267502,
FT                   4271011..4272698)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147820"
FT                   /product="mCG147820"
FT                   /note="gene_id=mCG147820.0 transcript_id=mCT188083.0
FT                   protein_id=mCP108438.0"
FT                   /db_xref="GOA:G3X9H3"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:2148237"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9H3"
FT                   /protein_id="EDL24171.1"
FT                   /translation="MASSSSQHMVCGSVTFRDVAVDFSQEEWACLDATQKVLYRNIMLE
FT                   TYSNLVAVVGRCISKPDLIVLLEQEKEPWMAVKEETDRPSPDVETCVEAENISPENHMS
FT                   DVNLHKQSIRQFSKTFDLKESTFSDGPSCSTFKGLQGYQGDADERVTKKERVPPCTCQT
FT                   LAHNTEKAYECKECGTCFDCSSALTQHQSVHAGEKLYECKECGKAFRLPQELTRHQKSH
FT                   SGEKPFQCNECGKAFHLPDLLKYHKVIHTGEKPFECEVCGKFFSRVSSLAEHRIVHADV
FT                   KPYECSECGKAFKRRSDLMQHQKIHSGERPFQCKDCGKAFIVLAQLAQHQSIHTGEKLE
FT                   CKHCGKIFSSGFYLVRHQSIHTGEKPFGCHVCGKAFRLQVYLNEHQKTHTDEKPFKCKL
FT                   CGSAFRRKYQLSEHQKIHTNVKPYQCKECGKSFRRRSNFTEHQSIHTGKKPFECKDCGK
FT                   VFRLNIHLIRHQRFHSGKTPFECNECGKGFHFSSQLNYHKTIHTGQTPFECKECGKSFK
FT                   RICSLLEHGVIHAAVKPFECSECGKTFNRRSNLIQHQKIHSDERPFECKDCGKAFTVLA
FT                   QLTRHHTIHTGKKSYECEQCGSAFRLPYQLTQHQRIHDDVKPFQCKECGKGFVRGTALR
FT                   IHQRVHTGEALPV"
FT   assembly_gap    4268061..4268312
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    4283671..4285664
FT                   /estimated_length=1994
FT                   /gap_type="unknown"
FT   assembly_gap    4288785..4288804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4292747..4292852
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            4297031..4315719
FT                   /locus_tag="mCG_23672"
FT                   /note="gene_id=mCG23672.2"
FT   mRNA            join(4297031..4297064,4302530..4302582,4303897..4304023,
FT                   4304162..4304286,4306551..4306649,4313762..4315719)
FT                   /locus_tag="mCG_23672"
FT                   /product="mCG23672, transcript variant mCT171749"
FT                   /note="gene_id=mCG23672.2 transcript_id=mCT171749.0 created
FT                   on 05-MAR-2003"
FT   mRNA            join(4297031..4297064,4302550..4302582,4303897..4304023,
FT                   4306551..4306649,4313762..>4315617)
FT                   /locus_tag="mCG_23672"
FT                   /product="mCG23672, transcript variant mCT23668"
FT                   /note="gene_id=mCG23672.2 transcript_id=mCT23668.1 created
FT                   on 05-MAR-2003"
FT   mRNA            join(4297104..4297258,4302530..4302582,4303897..4304023,
FT                   4306551..4306649,4313762..4315692)
FT                   /locus_tag="mCG_23672"
FT                   /product="mCG23672, transcript variant mCT171750"
FT                   /note="gene_id=mCG23672.2 transcript_id=mCT171750.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(4302550..4302582,4303897..4304023,4306551..4306649,
FT                   4313762..4315617)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23672"
FT                   /product="mCG23672, isoform CRA_a"
FT                   /note="gene_id=mCG23672.2 transcript_id=mCT171750.0
FT                   protein_id=mCP94669.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8K0D9"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:99207"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K0D9"
FT                   /protein_id="EDL24168.1"
FT                   /translation="MANSSSQHMVCGSVTFRDVAVDFSQEEWACLDATQKVLYRNIMLE
FT                   TYSNLVAVVGRCIPKPDLIVLLEQEKEPWMAVKKETGRPSQGLETGFEAENRSPKNHVY
FT                   NKKLPKQTIQQLSKTSDVQGVSVSNGPGYSVIKEPQNYQEGDANRNITNKKEMSTYTSK
FT                   TLAHNKEKPYKCKDCGKCFGCKSNLHQHESIHTGEKPYECKDCGKTFRLPQMLSRHQKS
FT                   HSDERPFECNICGKSFHLPTLLQYHKNIHTGLKPFECEECGKSFNRISTLFQHRTIHAG
FT                   MKPYKCNVCGKAFNRRSNLLQHQKIHSEDRPFHCKVCGKAFTVLAQLTRHENIHTEDKS
FT                   FECKQCGKIFSNGSYLLRHYDTHTNEKPFECNICGKAFRLHLYLSEHQKTHTDEKPFKC
FT                   KLCESAFRRKYQLSEHQRIHTDVKPYQCKDCGKFFRRRSNFTEHQSIHTGKKPFECKDC
FT                   GKVFRLNIHLIRHQRFHSDEKPFECKECGKAFHFSSQLNNHKTSHTGQTPFECKECGKS
FT                   FKRVSSLVEHRIIHSGVKPYKCNACGRAFNRRSNLMQHEKIHSDERPFECKDCGKAFTV
FT                   LAQLTRHQTIHNGKKSYECEQCGSAFRLPYQLTQHQRIHYDVKPFQCKECGKGFVRSTG
FT                   LRIHERIHTGEKPFQCKECGEAFQYHYQFLGHFRIHTGKNPYECSECGKYFTYGRDLKV
FT                   HQSIHNLEKP"
FT   CDS             join(4302550..4302582,4303897..4304023,4306551..4306649,
FT                   4313762..4315617)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23672"
FT                   /product="mCG23672, isoform CRA_a"
FT                   /note="gene_id=mCG23672.2 transcript_id=mCT23668.1
FT                   protein_id=mCP4671.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8K0D9"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:99207"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K0D9"
FT                   /protein_id="EDL24169.1"
FT                   /translation="MANSSSQHMVCGSVTFRDVAVDFSQEEWACLDATQKVLYRNIMLE
FT                   TYSNLVAVVGRCIPKPDLIVLLEQEKEPWMAVKKETGRPSQGLETGFEAENRSPKNHVY
FT                   NKKLPKQTIQQLSKTSDVQGVSVSNGPGYSVIKEPQNYQEGDANRNITNKKEMSTYTSK
FT                   TLAHNKEKPYKCKDCGKCFGCKSNLHQHESIHTGEKPYECKDCGKTFRLPQMLSRHQKS
FT                   HSDERPFECNICGKSFHLPTLLQYHKNIHTGLKPFECEECGKSFNRISTLFQHRTIHAG
FT                   MKPYKCNVCGKAFNRRSNLLQHQKIHSEDRPFHCKVCGKAFTVLAQLTRHENIHTEDKS
FT                   FECKQCGKIFSNGSYLLRHYDTHTNEKPFECNICGKAFRLHLYLSEHQKTHTDEKPFKC
FT                   KLCESAFRRKYQLSEHQRIHTDVKPYQCKDCGKFFRRRSNFTEHQSIHTGKKPFECKDC
FT                   GKVFRLNIHLIRHQRFHSDEKPFECKECGKAFHFSSQLNNHKTSHTGQTPFECKECGKS
FT                   FKRVSSLVEHRIIHSGVKPYKCNACGRAFNRRSNLMQHEKIHSDERPFECKDCGKAFTV
FT                   LAQLTRHQTIHNGKKSYECEQCGSAFRLPYQLTQHQRIHYDVKPFQCKECGKGFVRSTG
FT                   LRIHERIHTGEKPFQCKECGEAFQYHYQFLGHFRIHTGKNPYECSECGKYFTYGRDLKV
FT                   HQSIHNLEKP"
FT   CDS             join(4304238..4304286,4306551..4306649,4313762..4315617)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23672"
FT                   /product="mCG23672, isoform CRA_b"
FT                   /note="gene_id=mCG23672.2 transcript_id=mCT171749.0
FT                   protein_id=mCP94668.1 isoform=CRA_b"
FT                   /protein_id="EDL24170.1"
FT                   /translation="MLSSLFQTKQTYLNEIMGRCIPKPDLIVLLEQEKEPWMAVKKETG
FT                   RPSQGLETGFEAENRSPKNHVYNKKLPKQTIQQLSKTSDVQGVSVSNGPGYSVIKEPQN
FT                   YQEGDANRNITNKKEMSTYTSKTLAHNKEKPYKCKDCGKCFGCKSNLHQHESIHTGEKP
FT                   YECKDCGKTFRLPQMLSRHQKSHSDERPFECNICGKSFHLPTLLQYHKNIHTGLKPFEC
FT                   EECGKSFNRISTLFQHRTIHAGMKPYKCNVCGKAFNRRSNLLQHQKIHSEDRPFHCKVC
FT                   GKAFTVLAQLTRHENIHTEDKSFECKQCGKIFSNGSYLLRHYDTHTNEKPFECNICGKA
FT                   FRLHLYLSEHQKTHTDEKPFKCKLCESAFRRKYQLSEHQRIHTDVKPYQCKDCGKFFRR
FT                   RSNFTEHQSIHTGKKPFECKDCGKVFRLNIHLIRHQRFHSDEKPFECKECGKAFHFSSQ
FT                   LNNHKTSHTGQTPFECKECGKSFKRVSSLVEHRIIHSGVKPYKCNACGRAFNRRSNLMQ
FT                   HEKIHSDERPFECKDCGKAFTVLAQLTRHQTIHNGKKSYECEQCGSAFRLPYQLTQHQR
FT                   IHYDVKPFQCKECGKGFVRSTGLRIHERIHTGEKPFQCKECGEAFQYHYQFLGHFRIHT
FT                   GKNPYECSECGKYFTYGRDLKVHQSIHNLEKP"
FT   assembly_gap    4345487..4345506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4359056..4362307
FT                   /estimated_length=3252
FT                   /gap_type="unknown"
FT   gene            <4376064..>4387662
FT                   /locus_tag="mCG_145395"
FT                   /note="gene_id=mCG145395.0"
FT   mRNA            join(<4376064..4376106,4377071..4377197,4379621..4379719,
FT                   4386725..>4387662)
FT                   /locus_tag="mCG_145395"
FT                   /product="mCG145395"
FT                   /note="gene_id=mCG145395.0 transcript_id=mCT184819.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4376068..4376106,4377071..4377197,4379621..4379719,
FT                   4386725..>4387662)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145395"
FT                   /product="mCG145395"
FT                   /note="gene_id=mCG145395.0 transcript_id=mCT184819.0
FT                   protein_id=mCP105753.0"
FT                   /protein_id="EDL24167.1"
FT                   /translation="RRMASSSSQDMVCGSVTFRDVAVDFSQEEWAFLDATQKVLYRDMM
FT                   LETYSNLVAVVGSCISKPDLIVLLEQEKEPWMAVKEETDWPSPDLEADYDAENVFPENH
FT                   SYNRNSPKQDIRQSSKTFDFRGSRFSDGPKCSTFQGLQGCQEGDAGQQVTKKEGVPPYT
FT                   CQTLAHSLQKPYECKQCGKCFNCSSTLSQHQSVHAGEKPYECKEYGKVFRLPQQLTRHQ
FT                   KSHSSEKPFECNECGKAFHLPHLLQNHKTTHTGTKAFECEECGKIFNRVSNLVAHRIIH
FT                   ADVKPYKCNECGKAFKRRSYYMQHQKIHSGERPFQCKECGKAFIFLAHLNGHQMIHTGE
FT                   KSFACKECGKAFRLLQQLTRHQKFHSGDRPFKCNECGKAFPFPDRLKLHKTIHTNTKPF
FT                   EC"
FT   gene            4413188..4425847
FT                   /gene="Zfp59"
FT                   /locus_tag="mCG_15243"
FT                   /note="gene_id=mCG15243.1"
FT   mRNA            join(4413188..4413281,4415274..4415372,4422254..4423914,
FT                   4424156..4425847)
FT                   /gene="Zfp59"
FT                   /locus_tag="mCG_15243"
FT                   /product="zinc finger protein 59"
FT                   /note="gene_id=mCG15243.1 transcript_id=mCT14681.1 created
FT                   on 06-AUG-2002"
FT   CDS             join(4413248..4413281,4415274..4415372,4422254..4423914,
FT                   4424156..4424188)
FT                   /codon_start=1
FT                   /gene="Zfp59"
FT                   /locus_tag="mCG_15243"
FT                   /product="zinc finger protein 59"
FT                   /note="gene_id=mCG15243.1 transcript_id=mCT14681.1
FT                   protein_id=mCP10519.2"
FT                   /protein_id="EDL24165.1"
FT                   /translation="MLETYSNLVAVVGSCISKPDLIVLLEQEKEPWMAVNEETGRPSPD
FT                   LEADYDAENISPQNRIYNRKFSKQSIKQLSRTFDPKGSWFSNGPNYSTFHGLRDCQSDA
FT                   GQQITNKEGVPPHTCQTLAHNTEKPYECKECGKCFGCRSTLTQHQSVHTGEKPYECKEC
FT                   GKAFRLPQQLTRHQKCHSGEKPFSHNEGRQAFQHPNLLKYPKAIHTGAKAFACRECGKS
FT                   FNRVSSLVEHGLIHADVKPYECNECGKAFKRHRSFVRHQKIHSGERPFQCKDCGKGFIV
FT                   LAHLTRHQSSHSEEKPFECEECGKKFRTARHLVKHQRIHSGEKPFECNVCGSAFRLQLY
FT                   LSEHQKTHMEEKYLECNVCGKAFRLQVYLSEHLKTHTEENPFKCKLCGSAFPNKYQLNK
FT                   HLTVHTDGKPYQCKECGKCFRQRSKLTEHESIHTGKKPFQCEECGKFFRLNTLLIHHQK
FT                   SHSGERPFECKECGKAFLLPSQLNSHKIVHTSKRPFECKVCGKSFKRESNLIQHGAVHA
FT                   GVKSYECSECGKGFIHRSSLFHHRKIHSDEKPFKCQECGKAFVVLAYLIQHQSIHTGEK
FT                   PFECELCGSAFRCRSQLNKHLRNSHCKKHYHC"
FT   CDS             join(4431428..4431460,4432260..4432386,4434441..4434539,
FT                   4446636..4448437)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051036"
FT                   /product="mCG1051036"
FT                   /note="gene_id=mCG1051036.0 transcript_id=mCT194825.0
FT                   protein_id=mCP115856.0"
FT                   /db_xref="GOA:Q3TQG9"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:3584526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TQG9"
FT                   /protein_id="EDL24164.1"
FT                   /translation="MASSSSQHMVCGSVTFRDVAVDFSQEEWACLDATQKVLYRDMMLE
FT                   TYSNLVAVVGRCISKPDLIVLLEQEKEPWMAVKEETDRPSPDLELCYEAENMSPENQTY
FT                   DINLFKQRIKQFSKTFDLKICSFTSGPNYNTSKGLQSSQEGDDNQKITNKEEIPTHTCQ
FT                   TLAHNTEKAYECKECGKCFGCRSTLTQHQSVHAGEKPYECEECGKAFRLPQQLTRHQKS
FT                   HSGERPFECNECGKAFHLPDLLKYHKVIHTDEKPFECEVCGKSFKRVSHLVEHRTIHAG
FT                   VKPYECSECAKAFKRRSYLMQHQKIHSGERPFQCKDCGKSFIVLAQLTRHQNIHTEDKS
FT                   FECKHCGKIFSCGSFLLRHQSIHTNEKPFECNVCGKAFRLQVYLSEHRKTHTDERPFEC
FT                   KLCGSAFRRKDQLSEHQKIHTNVKPYQCKECGNLFRRKSSFIEHQSIHSEKKPFNCKDC
FT                   GKVFRLNTHLMRHQKSHSGERPFECKECGKAFHLPSQLTYHKTVHTNQKPFACEECGKS
FT                   FKHVSSLIEHRVIHAGLKPYECGECGKAFNHRSNLKQHQKIHSDERPFECKDCGKGFTV
FT                   LAQLTRHQSIHTGEKSFECEQCGSSFRLKSQLNQHQRIHTDVKPYQCKECGKGFVRGTA
FT                   LRIHQRIHTGEKPFQCNKCGEAFQYHYQFLAHFRTHTGKKPSECEELWRRP"
FT   gene            complement(4451284..4453404)
FT                   /pseudo
FT                   /locus_tag="mCG_23314"
FT                   /note="gene_id=mCG23314.2"
FT   mRNA            complement(4451284..4453404)
FT                   /pseudo
FT                   /locus_tag="mCG_23314"
FT                   /note="gene_id=mCG23314.2 transcript_id=mCT23669.2 created
FT                   on 04-APR-2003"
FT   assembly_gap    4467186..4469733
FT                   /estimated_length=2548
FT                   /gap_type="unknown"
FT   assembly_gap    4493304..4493323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4493724..>4499120)
FT                   /locus_tag="mCG_145396"
FT                   /note="gene_id=mCG145396.0"
FT   mRNA            complement(join(4493724..4494290,4495977..4496103,
FT                   4497090..4497142,4498984..>4499120))
FT                   /locus_tag="mCG_145396"
FT                   /product="mCG145396"
FT                   /note="gene_id=mCG145396.0 transcript_id=mCT184820.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(4494205..4494290,4495977..4496103,
FT                   4497090..>4497128))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145396"
FT                   /product="mCG145396"
FT                   /note="gene_id=mCG145396.0 transcript_id=mCT184820.0
FT                   protein_id=mCP105755.0"
FT                   /protein_id="EDL24163.1"
FT                   /translation="RRMASSSSQDMVCGSVTFRDVAVDFSQEEWACLDATQKVLYRDMM
FT                   LETYSNLVSVDIELSAPSEPCLPGSCHASCHDDNGLNL"
FT   gene            complement(<4524140..>4540507)
FT                   /locus_tag="mCG_133373"
FT                   /note="gene_id=mCG133373.1"
FT   mRNA            complement(join(<4524140..4526227,4532981..4533079,
FT                   4535077..4535203,4536111..4536163,4538098..4538191,
FT                   4540448..>4540507))
FT                   /locus_tag="mCG_133373"
FT                   /product="mCG133373"
FT                   /note="gene_id=mCG133373.1 transcript_id=mCT134736.1
FT                   created on 09-AUG-2002"
FT   CDS             complement(join(<4524140..4526227,4532981..4533079,
FT                   4535077..4535203,4536111..>4536149))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133373"
FT                   /product="mCG133373"
FT                   /note="gene_id=mCG133373.1 transcript_id=mCT134736.1
FT                   protein_id=mCP57689.1"
FT                   /protein_id="EDL24162.1"
FT                   /translation="RRMANSNSQDMVCGSVTFRDVAVDFSQEEWACLDATQKVLYRDMM
FT                   LETYSNLVAVVGRCISKPDLIVLLEQEKEPWMAVKEETDRPSPDLETDYDAENISPENP
FT                   INNKKFLKQSIKQLITFDPKDSSTSIGPNYSTFHGLQDCQSDAGQQITNKEGVPPHTCQ
FT                   TLAHNTEKPYECKECGKCFGCRSTLTQHQSIHTGEKPYECEECGKAFRLPQQLTRHQKS
FT                   HSGEKPFECNECGKAFHLPDLLKYHKTIHTGEKPFECRECGKSFNRVSNLVAHRIIHAD
FT                   VKPYKCSECGKAFKRRSNLVQHQKTHSDERPFQCKDCGKGFIVLAQLTRHQNIHTGEKS
FT                   FECHECGKAFRLPQQLTRHQKSHSGEKPFKCNECGKAFHLPDLLKYHKTIHTSTKPFEC
FT                   RECGKSFHRISNLVEHRLIHADVKPHKCNECGKAFKRSKSLMQHQKIHSGERPFQCQEC
FT                   GKAFIVLTHLTRHQTIHTGEKSFECNECGKKFRTATHLVMHQTIHTGEKPFECNVCGKA
FT                   FRLQVYLSEHQKIHIEEKPFKCKLCGSAFRRKYQLNEHYTIHTDEKPYQCKECGKCFRQ
FT                   RSNFTEHQSIHTGNKPFECKECGKFFRLNTLLIRHQKSHSSERPYKCKECGKAFHLPSE
FT                   LNNHQIVHTSNRPFECKVCGKSFKRESTLIQHSVIHGGVKSYECNECGKAFIHRSSLFH
FT                   HRKIHSDEKPFKCQECGKAFVVLAYLTRHQSIHTGEKSFECQQCGSAFRYKSQLSKHQR
FT                   SHTDVKLFQCMEGGNDFVHGTNLSIHQGIHT"
FT   gene            complement(4546242..4546892)
FT                   /locus_tag="mCG_23673"
FT                   /note="gene_id=mCG23673.0"
FT   mRNA            complement(4546242..4546892)
FT                   /locus_tag="mCG_23673"
FT                   /product="mCG23673"
FT                   /note="gene_id=mCG23673.0 transcript_id=mCT23671.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(4546255..4546677)
FT                   /codon_start=1
FT                   /locus_tag="mCG_23673"
FT                   /product="mCG23673"
FT                   /note="gene_id=mCG23673.0 transcript_id=mCT23671.0
FT                   protein_id=mCP4669.1"
FT                   /db_xref="GOA:Q05CJ1"
FT                   /db_xref="InterPro:IPR032842"
FT                   /db_xref="MGI:MGI:3036281"
FT                   /db_xref="UniProtKB/TrEMBL:Q05CJ1"
FT                   /protein_id="EDL24161.1"
FT                   /translation="MQEEEPQKAKKMASCKYNTCHVAPIRKLAEHEATCVNRSSVEEED
FT                   TLGPLQVSLPLPQNEDTLQVCWLSNLDIWNVDGTNCHPKFFRVLFSKNLFVKVTPKSHG
FT                   EETNAQKILRLGPGRQTSSRRKRALECMDGLCISSE"
FT   gene            complement(4594291..4602617)
FT                   /gene="Psmc4"
FT                   /locus_tag="mCG_23676"
FT                   /note="gene_id=mCG23676.1"
FT   mRNA            complement(join(4594291..4594494,4594675..4594730,
FT                   4594913..4595081,4595224..4595300,4595383..4595550,
FT                   4599560..4599653,4599747..4599856,4599940..4600086,
FT                   4601367..4601553,4601678..4601776,4602557..4602617))
FT                   /gene="Psmc4"
FT                   /locus_tag="mCG_23676"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   ATPase, 4"
FT                   /note="gene_id=mCG23676.1 transcript_id=mCT23674.0 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(4594381..4594494,4594675..4594730,
FT                   4594913..4595081,4595224..4595300,4595383..4595550,
FT                   4599560..4599653,4599747..4599856,4599940..4600086,
FT                   4601367..4601553,4601678..4601776,4602557..4602592))
FT                   /codon_start=1
FT                   /gene="Psmc4"
FT                   /locus_tag="mCG_23676"
FT                   /product="proteasome (prosome, macropain) 26S subunit,
FT                   ATPase, 4"
FT                   /note="gene_id=mCG23676.1 transcript_id=mCT23674.0
FT                   protein_id=mCP4645.1"
FT                   /db_xref="GOA:P54775"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035256"
FT                   /db_xref="MGI:MGI:1346093"
FT                   /db_xref="PDB:3AJI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54775"
FT                   /protein_id="EDL24160.1"
FT                   /translation="MEEIGILVEKIQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYK
FT                   KLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVG
FT                   STTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVM
FT                   YADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHH
FT                   TTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGA
FT                   DREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQ
FT                   KRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDF
FT                   EKAYKTVIKKDEQEHEFYK"
FT   assembly_gap    4620476..4621330
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   gene            <4624063..4640450
FT                   /locus_tag="mCG_145389"
FT                   /note="gene_id=mCG145389.0"
FT   mRNA            join(<4624063..4624122,4627548..4627897,4637307..4640450)
FT                   /locus_tag="mCG_145389"
FT                   /product="mCG145389"
FT                   /note="gene_id=mCG145389.0 transcript_id=mCT184813.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4624065..4624122,4627548..4627897,4637307..4637885)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145389"
FT                   /product="mCG145389"
FT                   /note="gene_id=mCG145389.0 transcript_id=mCT184813.0
FT                   protein_id=mCP105750.0"
FT                   /protein_id="EDL24159.1"
FT                   /translation="DMGSPWKWWALWAGATLLWALLTPAEASCQGIQCASGQRCQMVSG
FT                   KARCVAESTAVCRAQGDPHYTTFDGRRYDMMGTCSYTMAELCGSDETLPAFSVEAKNEH
FT                   RGSRQVSYVGLVTVYAYSHSVSLVRGEIGFVRIDNQRSRLPASLSEGRLRVHKSGTRGV
FT                   IEMDFGLVVTYDWDGQLTLSLPKRFQDQVCGLCGNYNGDPADDFLTPDLDQAPDALEFA
FT                   NSWKLDDGDYLCDDGCHNSCPSCTPGQTQHYKGDRLCGMLTLSTGPFSACHEFLDPKPF
FT                   LDDCVFDLCVTGGERLSLCRSLSAYAQACVELGVTLENWRLPASCRK"
FT   assembly_gap    4628498..4630678
FT                   /estimated_length=2181
FT                   /gap_type="unknown"
FT   gene            <4647314..4668314
FT                   /locus_tag="mCG_145390"
FT                   /note="gene_id=mCG145390.1"
FT   mRNA            join(<4647314..4647427,4651870..4652207,4653326..4653899,
FT                   4654224..4654840,4655337..4655880,4656710..4657281,
FT                   4657593..4658166,4661381..4661580,4664654..4665037,
FT                   4667774..4668045,4668150..4668310)
FT                   /locus_tag="mCG_145390"
FT                   /product="mCG145390, transcript variant mCT184814"
FT                   /note="gene_id=mCG145390.1 transcript_id=mCT184814.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4647316..4647427,4651870..4652207,4653326..4653899,
FT                   4654224..4654840,4655337..4655880,4656710..4657281,
FT                   4657593..4658166,4661381..4661580,4664654..4665037,
FT                   4667774..4668045,4668150..4668159)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145390"
FT                   /product="mCG145390, isoform CRA_a"
FT                   /note="gene_id=mCG145390.1 transcript_id=mCT184814.0
FT                   protein_id=mCP105745.0 isoform=CRA_a"
FT                   /protein_id="EDL24157.1"
FT                   /translation="QQHCVCQPGKGMMCQDHSCKPGQVCEPSGGVLTCVTKDPCHGITC
FT                   RPQETCKVQGGEGVCVPNYNSTCWLWGDPHYNSFDGWSFDFQGTCNYLLAGTLCPGVNA
FT                   EGLTPFTVTTKNENRGSPAVSYVRQVTVTTLNTNISIHKNEIGKVRVNGVLMALPVYLA
FT                   GGRISVINGGSKAVLETDFGLQVTYDWNWRVDVTLPSSYHGAVCGLCGNMDKNHQNDQV
FT                   FPNGTMAPSIPTWGGSWQVPGWDPLCWHECQGSCPTCPEDRVEEYEGPGFCGPLAPGTG
FT                   SPFTSCHAHVPPESFFKGCVLDVCLGGGSKDILCQALAAYAAACQAAGIKIEDWRTQAG
FT                   CEITCPDNSHYELCGPPCPASCPPPARHTAPTVCDGPCVEGCQCDEGFVLSADQCVPLD
FT                   GGCGCWVNGTYYEAGTEFWADTTCSKRCHCGPGGDSLVCKPASCGLGEECALLPSGEIG
FT                   CQPTSITECQAWGDPHYTTLDGHRFDFQGTCEYLLSAPCHEPPTGTEYFNVTVANEHRG
FT                   SQAVSYTRSVTLQIYGLSLTLSAQWPRKLQVNGEFVALPFHLDQKLSVYISGADVVVNT
FT                   ASGVSLAFDGDSFVRLRVPAAYAGTLCGLCGNYNKNPNDDLTAVGGKPEGWKVGGAPGC
FT                   DQCEPEPCPKPCTPEEQEPFRGPDACGIITAPEGPLAPCHSLVPPTQYFEACLLDACQV
FT                   QGHPGGLCPAIATYVAACQAAGAQLGEWRKPDFCPLQCPAHSHYQLCGDSCPVSCPSLS
FT                   APVGCETICREGCVCDAGFVLSGDTCVPVGQCGCLYQGRYYVLGATFYPGPECERLCEC
FT                   GPDGQVTCQEGADCEPYEECRIENGVQACHPTGCGHCLANGGLHYVTLDGRVYDLHGSC
FT                   SYVLASVCHPKPGDEEFSIVLEKNSAGDPQRVVVTVAGQVVGLARGPQVTVDGEVVTLP
FT                   VATGHVSVTAEGRNIVLQTNKGMKVLFDGDAHILMSIPSSFRGRLCGLCGNFNGNWSDD
FT                   FVLPSGAVAPNVEAFGTAWRAPGSSLGCGEGCGPQGCPVCLAEETQAYEKNDACGKIRD
FT                   PHGPFAACHKVLSPLEYFRQCVYDMCAHKGDKAYLCRSLAAYTAACQAAGAAVKPWRTD
FT                   SVCPLQCPAHSHYSICTRSCQGSCAALSGLTGCTTRCFEGCECDDHFLLSHGVCIPAQD
FT                   CGCVHNGQYMPVNSSLMSSDCSERCFCSPNNGLTCHEAGCPSGHVCEIQAGVRECQAAR
FT                   GLCSISVGANLTTFDGAHNAISSPGVYELSSRCPGLQKNVPWYRVLADVQPCHNNDKIV
FT                   SKVHIFFQDGLVTVIPSKGAWVNGLRVDLPATVLTSVSVRRMPDGSMLVHQKAGVTVWL
FT                   GKDGLLDVMVGDDLAAMLCGACGNFDGDQTNDAYGSQGKTPIEKWRAQDFSPCSN"
FT   mRNA            join(<4651479..4652207,4653326..4653899,4654224..4654840,
FT                   4655337..4655880,4656710..4657281,4657593..4658166,
FT                   4661381..4661580,4664654..4665037,4667774..4668045,
FT                   4668150..4668314)
FT                   /locus_tag="mCG_145390"
FT                   /product="mCG145390, transcript variant mCT191936"
FT                   /note="gene_id=mCG145390.1 transcript_id=mCT191936.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<4651794..4652207,4653326..4653899,4654224..4654840,
FT                   4655337..4655880,4656710..4657281,4657593..4658166,
FT                   4661381..4661580,4664654..4665037,4667774..4668045,
FT                   4668150..4668159)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145390"
FT                   /product="mCG145390, isoform CRA_b"
FT                   /note="gene_id=mCG145390.1 transcript_id=mCT191936.0
FT                   protein_id=mCP112884.0 isoform=CRA_b"
FT                   /protein_id="EDL24158.1"
FT                   /translation="HRQADGRSRHACGGQPLTVLSPLLTDPCHGITCRPQETCKVQGGE
FT                   GVCVPNYNSTCWLWGDPHYNSFDGWSFDFQGTCNYLLAGTLCPGVNAEGLTPFTVTTKN
FT                   ENRGSPAVSYVRQVTVTTLNTNISIHKNEIGKVRVNGVLMALPVYLAGGRISVINGGSK
FT                   AVLETDFGLQVTYDWNWRVDVTLPSSYHGAVCGLCGNMDKNHQNDQVFPNGTMAPSIPT
FT                   WGGSWQVPGWDPLCWHECQGSCPTCPEDRVEEYEGPGFCGPLAPGTGSPFTSCHAHVPP
FT                   ESFFKGCVLDVCLGGGSKDILCQALAAYAAACQAAGIKIEDWRTQAGCEITCPDNSHYE
FT                   LCGPPCPASCPPPARHTAPTVCDGPCVEGCQCDEGFVLSADQCVPLDGGCGCWVNGTYY
FT                   EAGTEFWADTTCSKRCHCGPGGDSLVCKPASCGLGEECALLPSGEIGCQPTSITECQAW
FT                   GDPHYTTLDGHRFDFQGTCEYLLSAPCHEPPTGTEYFNVTVANEHRGSQAVSYTRSVTL
FT                   QIYGLSLTLSAQWPRKLQVNGEFVALPFHLDQKLSVYISGADVVVNTASGVSLAFDGDS
FT                   FVRLRVPAAYAGTLCGLCGNYNKNPNDDLTAVGGKPEGWKVGGAPGCDQCEPEPCPKPC
FT                   TPEEQEPFRGPDACGIITAPEGPLAPCHSLVPPTQYFEACLLDACQVQGHPGGLCPAIA
FT                   TYVAACQAAGAQLGEWRKPDFCPLQCPAHSHYQLCGDSCPVSCPSLSAPVGCETICREG
FT                   CVCDAGFVLSGDTCVPVGQCGCLYQGRYYVLGATFYPGPECERLCECGPDGQVTCQEGA
FT                   DCEPYEECRIENGVQACHPTGCGHCLANGGLHYVTLDGRVYDLHGSCSYVLASVCHPKP
FT                   GDEEFSIVLEKNSAGDPQRVVVTVAGQVVGLARGPQVTVDGEVVTLPVATGHVSVTAEG
FT                   RNIVLQTNKGMKVLFDGDAHILMSIPSSFRGRLCGLCGNFNGNWSDDFVLPSGAVAPNV
FT                   EAFGTAWRAPGSSLGCGEGCGPQGCPVCLAEETQAYEKNDACGKIRDPHGPFAACHKVL
FT                   SPLEYFRQCVYDMCAHKGDKAYLCRSLAAYTAACQAAGAAVKPWRTDSVCPLQCPAHSH
FT                   YSICTRSCQGSCAALSGLTGCTTRCFEGCECDDHFLLSHGVCIPAQDCGCVHNGQYMPV
FT                   NSSLMSSDCSERCFCSPNNGLTCHEAGCPSGHVCEIQAGVRECQAARGLCSISVGANLT
FT                   TFDGAHNAISSPGVYELSSRCPGLQKNVPWYRVLADVQPCHNNDKIVSKVHIFFQDGLV
FT                   TVIPSKGAWVNGLRVDLPATVLTSVSVRRMPDGSMLVHQKAGVTVWLGKDGLLDVMVGD
FT                   DLAAMLCGACGNFDGDQTNDAYGSQGKTPIEKWRAQDFSPCSN"
FT   gene            <4677093..4690919
FT                   /gene="9530053A07Rik"
FT                   /locus_tag="mCG_144735"
FT                   /note="gene_id=mCG144735.0"
FT   mRNA            join(<4677093..4677162,4678704..4679053,4684344..4684914,
FT                   4687021..4687625,4689504..4690919)
FT                   /gene="9530053A07Rik"
FT                   /locus_tag="mCG_144735"
FT                   /product="RIKEN cDNA 9530053A07, transcript variant
FT                   mCT184159"
FT                   /note="gene_id=mCG144735.0 transcript_id=mCT184159.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<4677093..4677162,4678704..4679053,4684344..4684914,
FT                   4687021..4687625,4689504..4690127)
FT                   /codon_start=1
FT                   /gene="9530053A07Rik"
FT                   /locus_tag="mCG_144735"
FT                   /product="RIKEN cDNA 9530053A07, isoform CRA_a"
FT                   /note="gene_id=mCG144735.0 transcript_id=mCT184159.0
FT                   protein_id=mCP105737.0 isoform=CRA_a"
FT                   /protein_id="EDL24155.1"
FT                   /translation="LPAADMGSLWSCWALWAGATLLWALLTPAEASCQGIQCAPGQRCQ
FT                   MVSGKAKCLAESTAVCRAQGDPHYTTFDGHRYDMMGTCTYTMAELRSSKDSLLAFKVDA
FT                   KNEHRSSNKVSYVRLVTVHAYNHTVSLIYGEVGLAKIDYQYSSLPVSLSEGLLRVHQSG
FT                   TRGVLELDFGLVVTYDWDGQLTLSLPKRFQDQVSGLCGNYNGDPADDFLTPDGKQAPDV
FT                   LNFTKSWKVNDQDLLCDDGCYGNCPSCIPSQAQLFKKDLFCGMLTLPSGPFADCHQFLD
FT                   PKPFLEECVYDMCVTGGERLTLCRGLNAYAQACVDLGISVREWRSRTNCPLTCPANSHY
FT                   ELCSPACPPSCNSEARPTNCSSRPCVEGCVCLPGFVASRGLCMPVSSCGCIFQDRLLAP
FT                   GQEVYADEKCHLRCTCDGATQKVICRNTTGCLPKEHCGVQNGSFGCFPEYFRICRASGD
FT                   PHYMSLDERIFNFMGTCTYLFTASCGQHPSLPDFKVFIENERRGSQSVSFVRSVKLEAL
FT                   GIKLEVRREYQGKVLVDGILHYLPFQALGGKLVVFRQGKYAILRTNFSLSVSYNWDTHV
FT                   TAKVPSNYFNSVCGLCGNFNGDPRDDLGKQIRAEAIDPRDFGKKWLVSSHLGCRTDEQH
FT                   LCPDFNKGLVSNITQNCRIFTNISGHFKHCWRVPAYNSAYIECAYDCCRMPGQTKPLCD
FT                   TLATYTAICQSSGVIVYPWRTETLCREYQEYQLGIESNACSLAYK"
FT   mRNA            join(<4677093..4677162,4678704..4679053,4684344..4688585)
FT                   /gene="9530053A07Rik"
FT                   /locus_tag="mCG_144735"
FT                   /product="RIKEN cDNA 9530053A07, transcript variant
FT                   mCT191937"
FT                   /note="gene_id=mCG144735.0 transcript_id=mCT191937.0
FT                   created on 09-MAR-2004"
FT   CDS             <4686744..4687769
FT                   /codon_start=1
FT                   /gene="9530053A07Rik"
FT                   /locus_tag="mCG_144735"
FT                   /product="RIKEN cDNA 9530053A07, isoform CRA_b"
FT                   /note="gene_id=mCG144735.0 transcript_id=mCT191937.0
FT                   protein_id=mCP112881.0 isoform=CRA_b"
FT                   /protein_id="EDL24156.1"
FT                   /translation="GAHTVPGAGNRAGGCCGSWVMDTDSAWAWKVKAMRFAHCQVGCPG
FT                   MGRRGHWGLSIRKGGVPLTEGCGPLMKQHCLGEPHTWHDPPFLPTPPALTCPANSHYEL
FT                   CSPACPPSCNSEARPTNCSSRPCVEGCVCLPGFVASRGLCMPVSSCGCIFQDRLLAPGQ
FT                   EVYADEKCHLRCTCDGATQKVICRNTTGCLPKEHCGVQNGSFGCFPEYFRICRASGDPH
FT                   YMSLDERIFNFMGTCTYLFTASCGQHPSLPDFKVFIENERRGSQSVSFVRSVKLEALGI
FT                   KLEVRREYQGKVLVSAAGRERGGGGGANPREDQRLWWKQSGIHSTTLWLRSRPCYFFLS
FT                   L"
FT   gene            4716946..4726549
FT                   /locus_tag="mCG_2967"
FT                   /note="gene_id=mCG2967.3"
FT   mRNA            join(4716946..4717097,4721784..4721966,4722065..4722172,
FT                   4722264..4722358,4723135..4723305,4724423..4724555,
FT                   4725485..4725597,4726178..4726323,4726411..4726549)
FT                   /locus_tag="mCG_2967"
FT                   /product="mCG2967"
FT                   /note="gene_id=mCG2967.3 transcript_id=mCT7015.2 created on
FT                   24-NOV-2004"
FT   CDS             join(4717088..4717097,4721784..4721966,4722065..4722172,
FT                   4722264..4722358,4723135..4723305,4724423..4724555,
FT                   4725485..4725597,4726178..4726323,4726411..4726435)
FT                   /codon_start=1
FT                   /locus_tag="mCG_2967"
FT                   /product="mCG2967"
FT                   /note="gene_id=mCG2967.3 transcript_id=mCT7015.2
FT                   protein_id=mCP4658.2"
FT                   /protein_id="EDL24154.1"
FT                   /translation="MKPGFSPRGGGFGGRGGFGDRGGRGGGRGGRGGFGGGRGGFGGGG
FT                   RGRGGGGGGFRGRGGGGGRGGGFQSGGNRGRGGGRGGKRGNQSGKNVMVEPHRHEGVFI
FT                   CRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGG