spacer

EBI Dbfetch

ID   CH466592; SV 2; linear; genomic DNA; CON; MUS; 8658180 BP.
XX
AC   CH466592;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009791526 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8658180
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-8658180
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-8658180
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; a8a1d149c021b4f51ce44fa3e9237dd6.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000226.
DR   Ensembl-Gn; ENSMUSG00000005836; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024235; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000024240; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033960; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036904; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039540; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050945; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057440; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061802; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063316; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073639; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044829; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047762; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063989; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077856; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081275; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097680; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097682; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107249; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115869; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70977403.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8658180
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(313580..375164)
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /note="gene_id=mCG7749.1"
FT   mRNA            complement(join(313580..315353,320652..320808,
FT                   323921..323956,342273..342415,342555..342649,
FT                   373006..373119,375139..375164))
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /product="cAMP responsive element modulator, transcript
FT                   variant mCT168679"
FT                   /note="gene_id=mCG7749.1 transcript_id=mCT168679.0 created
FT                   on 12-MAY-2002"
FT   mRNA            complement(join(313580..315353,320652..320808,
FT                   335129..335317,342273..342415,342555..342649,
FT                   346395..346541,373006..373119,375139..375164))
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /product="cAMP responsive element modulator, transcript
FT                   variant mCT168678"
FT                   /note="gene_id=mCG7749.1 transcript_id=mCT168678.0 created
FT                   on 12-MAY-2002"
FT   mRNA            complement(join(313580..315353,320652..320808,
FT                   323921..323956,342273..342415,342555..342649,
FT                   373006..373123,375139..375164))
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /product="cAMP responsive element modulator, transcript
FT                   variant mCT6595"
FT                   /note="gene_id=mCG7749.1 transcript_id=mCT6595.0 created on
FT                   12-MAY-2002"
FT   mRNA            complement(join(313580..315353,320652..320808,
FT                   323921..323956,335129..335317,342273..342415,
FT                   342555..342649,346395..346541,373006..>373035))
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /product="cAMP responsive element modulator, transcript
FT                   variant mCT191809"
FT                   /note="gene_id=mCG7749.1 transcript_id=mCT191809.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(315209..315353,320652..320808,
FT                   323921..323956,342273..342415,342555..342649,
FT                   373006..373119))
FT                   /codon_start=1
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /product="cAMP responsive element modulator, isoform CRA_b"
FT                   /note="gene_id=mCG7749.1 transcript_id=mCT168679.0
FT                   protein_id=mCP91677.0 isoform=CRA_b"
FT                   /protein_id="EDL23063.1"
FT                   /translation="MTMETVESQQDRSVTRSVAEHSSAHMQTGQISVPTLAQVATIAET
FT                   DDSADSEVIDSHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMA
FT                   VPTSIYQTSTGQYNEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSP
FT                   QQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD
FT                   LYCHKAE"
FT   CDS             complement(join(315209..315353,320652..320808,
FT                   323921..323956,342273..342415,342555..342649,
FT                   373006..373119))
FT                   /codon_start=1
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /product="cAMP responsive element modulator, isoform CRA_b"
FT                   /note="gene_id=mCG7749.1 transcript_id=mCT6595.0
FT                   protein_id=mCP23105.1 isoform=CRA_b"
FT                   /protein_id="EDL23065.1"
FT                   /translation="MTMETVESQQDRSVTRSVAEHSSAHMQTGQISVPTLAQVATIAET
FT                   DDSADSEVIDSHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMA
FT                   VPTSIYQTSTGQYNEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSP
FT                   QQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD
FT                   LYCHKAE"
FT   CDS             complement(join(315209..315353,320652..320808,
FT                   335129..335317,342273..342415,342555..342649,
FT                   346395..346541,373006..373119))
FT                   /codon_start=1
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /product="cAMP responsive element modulator, isoform CRA_a"
FT                   /note="gene_id=mCG7749.1 transcript_id=mCT168678.0
FT                   protein_id=mCP91676.0 isoform=CRA_a"
FT                   /protein_id="EDL23062.1"
FT                   /translation="MTMETVESQQDRSVTRSVAEHSSAHMQTGQISVPTLAQVSVAGSG
FT                   TGRGSPAVTLVQLPSGQTVQVQGVIQTPHPSVIQSPQIQTVQVATIAETDDSADSEVID
FT                   SHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMAVPTSIYQTST
FT                   GQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVP
FT                   GSQVVVQAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKN
FT                   REAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE"
FT   CDS             complement(join(315209..315353,320652..320808,
FT                   323921..323956,335129..335317,342273..342415,
FT                   342555..342649,346395..346541,373006..>373035))
FT                   /codon_start=1
FT                   /gene="Crem"
FT                   /locus_tag="mCG_7749"
FT                   /product="cAMP responsive element modulator, isoform CRA_c"
FT                   /note="gene_id=mCG7749.1 transcript_id=mCT191809.0
FT                   protein_id=mCP112779.0 isoform=CRA_c"
FT                   /protein_id="EDL23064.1"
FT                   /translation="GQISVPTLAQVSVAGSGTGRGSPAVTLVQLPSGQTVQVQGVIQTP
FT                   HPSVIQSPQIQTVQVATIAETDDSADSEVIDSHKRREILSRRPSYRKILNELSSDVPGI
FT                   PKIEEEKSEEEGTPPNIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQAL
FT                   TMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETDLAPSHMAAATGDMPTY
FT                   QIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAARECRRKKKEYVK
FT                   CLENRVAVLENQNKTLIEELKALKDLYCHKAE"
FT   gene            384135..416444
FT                   /locus_tag="mCG_147793"
FT                   /note="gene_id=mCG147793.0"
FT   mRNA            join(384135..384635,415508..416444)
FT                   /locus_tag="mCG_147793"
FT                   /product="mCG147793"
FT                   /note="gene_id=mCG147793.0 transcript_id=mCT188056.0
FT                   created on 13-JAN-2004"
FT   CDS             join(384446..384635,415508..415536)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147793"
FT                   /product="mCG147793"
FT                   /note="gene_id=mCG147793.0 transcript_id=mCT188056.0
FT                   protein_id=mCP108704.0"
FT                   /protein_id="EDL23061.1"
FT                   /translation="MTRWCSPCATLLEEMGHVIFYLHCERNAGTKALLRAQDCGEQDRR
FT                   PFPVTLRSPSGRPVGLSDGEGSLKTLK"
FT   gene            432519..487062
FT                   /gene="Cul2"
FT                   /locus_tag="mCG_7746"
FT                   /note="gene_id=mCG7746.1"
FT   mRNA            join(432519..432660,450009..450149,456362..456464,
FT                   464807..464901,468212..468317,469241..469323,
FT                   470024..470120,470209..470319,471880..472042,
FT                   474146..474270,475127..475234,476189..476248,
FT                   476772..476900,476994..477080,477435..477587,
FT                   477840..477917,480247..480313,481589..481791,
FT                   482161..482262,485522..487052)
FT                   /gene="Cul2"
FT                   /locus_tag="mCG_7746"
FT                   /product="cullin 2, transcript variant mCT173389"
FT                   /note="gene_id=mCG7746.1 transcript_id=mCT173389.0 created
FT                   on 20-SEP-2002"
FT   mRNA            join(432711..432885,450009..450149,456362..456464,
FT                   464807..464901,468212..468317,469241..469323,
FT                   470024..470120,470209..470319,471880..472042,
FT                   474146..474270,475127..475234,476189..476248,
FT                   476772..476900,476994..477080,477435..477587,
FT                   477840..477917,480247..480313,481589..481791,
FT                   482161..482262,484672..484788,485522..487062)
FT                   /gene="Cul2"
FT                   /locus_tag="mCG_7746"
FT                   /product="cullin 2, transcript variant mCT6599"
FT                   /note="gene_id=mCG7746.1 transcript_id=mCT6599.2 created on
FT                   20-SEP-2002"
FT   mRNA            join(<432711..432885,450009..450149,456362..456464,
FT                   464851..464901,468212..468317,469241..469323,
FT                   470024..470120,470209..470319,471880..472042,
FT                   474146..474270,475127..475234,476189..476248,
FT                   476772..476900,476994..477080,477435..477587,
FT                   477840..477917,480247..480313,481589..481791,
FT                   482161..482262,484672..484788,485522..486063)
FT                   /gene="Cul2"
FT                   /locus_tag="mCG_7746"
FT                   /product="cullin 2, transcript variant mCT191818"
FT                   /note="gene_id=mCG7746.1 transcript_id=mCT191818.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(450031..450149,456362..456464,464807..464901,
FT                   468212..468317,469241..469323,470024..470120,
FT                   470209..470319,471880..472042,474146..474270,
FT                   475127..475234,476189..476248,476772..476900,
FT                   476994..477080,477435..477587,477840..477917,
FT                   480247..480313,481589..481791,482161..482262,
FT                   484672..484788,485522..485653)
FT                   /codon_start=1
FT                   /gene="Cul2"
FT                   /locus_tag="mCG_7746"
FT                   /product="cullin 2, isoform CRA_b"
FT                   /note="gene_id=mCG7746.1 transcript_id=mCT6599.2
FT                   protein_id=mCP23118.2 isoform=CRA_b"
FT                   /protein_id="EDL23059.1"
FT                   /translation="MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYAL
FT                   CVAYPEPLGERLYAETKIFLESHVRHLYKRVLESEEQVLVMYHRYWEEYSKGADYMDCL
FT                   YRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRML
FT                   LREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQE
FT                   ASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHSE
FT                   CHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMPTLFV
FT                   ESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLL
FT                   KKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMI
FT                   NKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAW
FT                   PLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAM
FT                   VTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAE
FT                   SSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDRKMYLQAAIVRIMKARKVL
FT                   RHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA"
FT   CDS             join(450031..450149,456362..456464,464807..464901,
FT                   468212..468317,469241..469323,470024..470120,
FT                   470209..470319,471880..472042,474146..474270,
FT                   475127..475234,476189..476248,476772..476900,
FT                   476994..477080,477435..477587,477840..477917,
FT                   480247..480313,481589..481791,482161..482262,
FT                   485522..485653)
FT                   /codon_start=1
FT                   /gene="Cul2"
FT                   /locus_tag="mCG_7746"
FT                   /product="cullin 2, isoform CRA_c"
FT                   /note="gene_id=mCG7746.1 transcript_id=mCT173389.0
FT                   protein_id=mCP96308.0 isoform=CRA_c"
FT                   /protein_id="EDL23060.1"
FT                   /translation="MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYAL
FT                   CVAYPEPLGERLYAETKIFLESHVRHLYKRVLESEEQVLVMYHRYWEEYSKGADYMDCL
FT                   YRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRML
FT                   LREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQE
FT                   ASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHSE
FT                   CHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMPTLFV
FT                   ESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLL
FT                   KKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMI
FT                   NKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAW
FT                   PLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAM
FT                   VTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAE
FT                   SSFSLNMSFSSKRTKFKITTSMQKDTPQVISQSRARFNPSISMIKKCIEVLIDKQYIER
FT                   SQASADEYSYVA"
FT   CDS             join(<450086..450149,456362..456464,464851..464901,
FT                   468212..468317,469241..469323,470024..470120,
FT                   470209..470319,471880..472042,474146..474270,
FT                   475127..475234,476189..476248,476772..476900,
FT                   476994..477080,477435..477587,477840..477917,
FT                   480247..480313,481589..481791,482161..482262,
FT                   484672..484788,485522..485653)
FT                   /codon_start=1
FT                   /gene="Cul2"
FT                   /locus_tag="mCG_7746"
FT                   /product="cullin 2, isoform CRA_a"
FT                   /note="gene_id=mCG7746.1 transcript_id=mCT191818.0
FT                   protein_id=mCP112778.0 isoform=CRA_a"
FT                   /protein_id="EDL23058.1"
FT                   /translation="LQSKLLLCWNMSSEQHGMTASQISMLYVWPILNHLEKDFMRKQRF
FT                   FWKVTFGICIRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLM
FT                   EIGELALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKK
FT                   KFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLH
FT                   PSSYTKVIHECQQRMVADHLQFLHSECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEE
FT                   LQKHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALT
FT                   SVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQ
FT                   KFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFN
FT                   NFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSG
FT                   RKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKE
FT                   LTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQT
FT                   RSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLID
FT                   KQYIERSQASADEYSYVA"
FT   gene            558624..563436
FT                   /gene="Bambi"
FT                   /locus_tag="mCG_7747"
FT                   /note="gene_id=mCG7747.1"
FT   mRNA            join(558624..558975,561935..562222,562660..563436)
FT                   /gene="Bambi"
FT                   /locus_tag="mCG_7747"
FT                   /product="BMP and activin membrane-bound inhibitor, homolog
FT                   (Xenopus laevis)"
FT                   /note="gene_id=mCG7747.1 transcript_id=mCT6597.1 created on
FT                   20-SEP-2002"
FT   CDS             join(558900..558975,561935..562222,562660..563078)
FT                   /codon_start=1
FT                   /gene="Bambi"
FT                   /locus_tag="mCG_7747"
FT                   /product="BMP and activin membrane-bound inhibitor, homolog
FT                   (Xenopus laevis)"
FT                   /note="gene_id=mCG7747.1 transcript_id=mCT6597.1
FT                   protein_id=mCP23113.1"
FT                   /protein_id="EDL23057.1"
FT                   /translation="MDRHSSYFFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCK
FT                   SELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMC
FT                   NYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRAAVIAVPIAGGL
FT                   ILVLLIMLALRMLRSENKRLQDERQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGQ
FT                   ENCCLTCDKMRQAELSNEKILSLVHWGMYSGHGKLEFI"
FT   gene            1212712..1229280
FT                   /gene="Lyzl1"
FT                   /locus_tag="mCG_7744"
FT                   /note="gene_id=mCG7744.1"
FT   mRNA            join(1212712..1212828,1215406..1215569,1216046..1216204,
FT                   1228158..1228236,1228949..1229280)
FT                   /gene="Lyzl1"
FT                   /locus_tag="mCG_7744"
FT                   /product="lysozyme-like 1"
FT                   /note="gene_id=mCG7744.1 transcript_id=mCT6602.0 created on
FT                   20-SEP-2002"
FT   CDS             join(1215431..1215569,1216046..1216204,1228158..1228236,
FT                   1228949..1229018)
FT                   /codon_start=1
FT                   /gene="Lyzl1"
FT                   /locus_tag="mCG_7744"
FT                   /product="lysozyme-like 1"
FT                   /note="gene_id=mCG7744.1 transcript_id=mCT6602.0
FT                   protein_id=mCP23109.1"
FT                   /protein_id="EDL23056.1"
FT                   /translation="MKSVGVFALIISFSIVAESKIYTRCKLAKIFAKAGLDNYGGFALG
FT                   NWLCMAYYESHYNTTAENVLEDGSTDYGIFQINSFTWCRNARKHQKNHCHVACSALITD
FT                   DLTDAILCAKKIVKETQGMNYWQGWKKNCENKDMSEWKRGCEVS"
FT   gene            complement(1243048..1245278)
FT                   /locus_tag="mCG_19926"
FT                   /note="gene_id=mCG19926.2"
FT   mRNA            complement(join(1243048..1243640,1245206..1245278))
FT                   /locus_tag="mCG_19926"
FT                   /product="mCG19926"
FT                   /note="gene_id=mCG19926.2 transcript_id=mCT17874.2 created
FT                   on 19-SEP-2002"
FT   CDS             complement(1243064..1243192)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19926"
FT                   /product="mCG19926"
FT                   /note="gene_id=mCG19926.2 transcript_id=mCT17874.2
FT                   protein_id=mCP23096.2"
FT                   /protein_id="EDL23055.1"
FT                   /translation="MGLNEIWRKLHCNRFFLNIVIHCSFLQKVTLPCALPVNTIQD"
FT   gene            complement(1376104..1394120)
FT                   /gene="Map3k8"
FT                   /locus_tag="mCG_19924"
FT                   /note="gene_id=mCG19924.1"
FT   mRNA            complement(join(1376104..1377213,1378595..1378841,
FT                   1379394..1379546,1384274..1384380,1385328..1385589,
FT                   1387803..1387970,1393762..1394120))
FT                   /gene="Map3k8"
FT                   /locus_tag="mCG_19924"
FT                   /product="mitogen activated protein kinase kinase kinase 8"
FT                   /note="gene_id=mCG19924.1 transcript_id=mCT17872.1 created
FT                   on 17-SEP-2002"
FT   CDS             complement(join(1377083..1377213,1378595..1378841,
FT                   1379394..1379546,1384274..1384380,1385328..1385589,
FT                   1387803..1387970,1393762..1394097))
FT                   /codon_start=1
FT                   /gene="Map3k8"
FT                   /locus_tag="mCG_19924"
FT                   /product="mitogen activated protein kinase kinase kinase 8"
FT                   /note="gene_id=mCG19924.1 transcript_id=mCT17872.1
FT                   protein_id=mCP23094.2"
FT                   /db_xref="GOA:Q3UEB8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017424"
FT                   /db_xref="MGI:MGI:1346878"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UEB8"
FT                   /protein_id="EDL23054.1"
FT                   /translation="MEYMSTGSDEKEEIDLLIKHLNVSEVIDIMENLYASEEPGVYEPS
FT                   LMTMYPDSNQNEERSESLLRSGQEVPWLSSVRYGTVEDLLAFANHVSNMTKHFYGRRPQ
FT                   ECGILLNMVISPQNGRYQIDSDVLLVPWKLTYRNIGSGFVPRGAFGKVYLAQDMKTKKR
FT                   MACKLIPIDQFKPSDVEIQACFRHENIAELYGAVLWGDTVHLFMEAGEGGSVLEKLESC
FT                   GPMREFEIIWVTKHILKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVKMTEDV
FT                   YLPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYL
FT                   YIIHKQAPPLEDIAGDCSPGMRELIEAALERNPNHRPKAADLLKHEALNPPREDQPRCQ
FT                   SLDSALFERKRLLSRKELQLPENIADSSCTGSTEESEVLRRQRSLYIDLGALAGYFNIV
FT                   RGPPTLEYG"
FT   gene            1412605..1413677
FT                   /locus_tag="mCG_147790"
FT                   /note="gene_id=mCG147790.0"
FT   mRNA            join(1412605..1412797,1413373..1413677)
FT                   /locus_tag="mCG_147790"
FT                   /product="mCG147790"
FT                   /note="gene_id=mCG147790.0 transcript_id=mCT188053.0
FT                   created on 13-JAN-2004"
FT   CDS             1413426..1413599
FT                   /codon_start=1
FT                   /locus_tag="mCG_147790"
FT                   /product="mCG147790"
FT                   /note="gene_id=mCG147790.0 transcript_id=mCT188053.0
FT                   protein_id=mCP108701.0"
FT                   /protein_id="EDL23053.1"
FT                   /translation="MVVSTFCGYLGPNAHLLQEHKDFFTTEPPELRCTKRFWTLVVQKI
FT                   QKWASNNNNGCQ"
FT   gene            <1420340..1442077
FT                   /gene="Papd1"
FT                   /locus_tag="mCG_144717"
FT                   /note="gene_id=mCG144717.1"
FT   mRNA            join(<1420340..1420527,1424318..1424490,1425403..1425636,
FT                   1427938..1428162,1430920..1431131,1431702..1431928,
FT                   1439723..1439815,1439905..1439978,1440854..1441533)
FT                   /gene="Papd1"
FT                   /locus_tag="mCG_144717"
FT                   /product="PAP associated domain containing 1, transcript
FT                   variant mCT191821"
FT                   /note="gene_id=mCG144717.1 transcript_id=mCT191821.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<1420340..1420527,1424318..1424490,1425403..1425636,
FT                   1427934..1428162,1430920..1431131,1431702..1431928,
FT                   1439723..1439815,1439905..1439978,1440854..1441530)
FT                   /gene="Papd1"
FT                   /locus_tag="mCG_144717"
FT                   /product="PAP associated domain containing 1, transcript
FT                   variant mCT191822"
FT                   /note="gene_id=mCG144717.1 transcript_id=mCT191822.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1420341..1420527,1424318..1424490,1425403..1425636,
FT                   1427938..1428162,1430920..1431131,1431702..1431928,
FT                   1439723..1439815,1439905..1439978,1440854..1441216)
FT                   /codon_start=1
FT                   /gene="Papd1"
FT                   /locus_tag="mCG_144717"
FT                   /product="PAP associated domain containing 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG144717.1 transcript_id=mCT191821.0
FT                   protein_id=mCP112769.0 isoform=CRA_b"
FT                   /protein_id="EDL23051.1"
FT                   /translation="LWRLLPAALIMAARGVGLLTRLPVCSQRRNRIPRSISRLLSCPGT
FT                   IAASIGSEEQSSVVAETGIEDKTLQKKFSEVQKERREQAQRTVLIHCPNNINEKKFLKY
FT                   LSQHGPVNNHFFYESFGLFAVVEFCQKDSIKSLQNGTHTPTQSTEAAIPFKSRFLNLRL
FT                   KNPSSQVSGQPFVQTTNQSPPSSKKLFELLSYAESIEEQLNTLLKAFQLTEENIRLRHL
FT                   TCSLIEDIAAAYFPSCVIRPFGSSVNTFGKLGCDLDMFLDLDETGKLDVHKNTGNFFME
FT                   FQVKNVPSERIATQKILSVIGECLDNFGPGCVGVQKILNARCPLVRFSHQGSGFQCDLT
FT                   ANNSIALKSSELLYIYGSLDSRVRALVFSVRCWARAHSLTSSIPGAWITNFSLTVMVIF
FT                   FLQRRSPPILPTLDSLKSIADAEDRCILEGNNCTFVQDVNKIQPSGNTETLELLIKEFF
FT                   EYFGNFAFNKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVELARD
FT                   SAWILEQEDKNQPFSSSRQPWGLAALLLPPGSGHTSLSRKKKKKPMSEKVKGLLASIKS
FT                   NSPDSSTDTSGKRTISTQA"
FT   mRNA            join(<1420351..1420527,1424318..1424490,1425422..1425636,
FT                   1427938..1428162,1430920..1431131,1431702..1431928,
FT                   1439723..1439815,1439905..1439978,1440854..1442077)
FT                   /gene="Papd1"
FT                   /locus_tag="mCG_144717"
FT                   /product="PAP associated domain containing 1, transcript
FT                   variant mCT184141"
FT                   /note="gene_id=mCG144717.1 transcript_id=mCT184141.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<1425424..1425636,1427938..1428162,1430920..1431131,
FT                   1431702..1431928,1439723..1439815,1439905..1439978,
FT                   1440854..1441216)
FT                   /codon_start=1
FT                   /gene="Papd1"
FT                   /locus_tag="mCG_144717"
FT                   /product="PAP associated domain containing 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG144717.1 transcript_id=mCT184141.0
FT                   protein_id=mCP106198.0 isoform=CRA_a"
FT                   /protein_id="EDL23050.1"
FT                   /translation="FCQKDSIKSLQNGTHTPTQSTEAAIPFKSRFLNLRLKNPSSQVSG
FT                   QPFVQTTNQSPPSSKKLFELLSYAESIEEQLNTLLKAFQLTEENIRLRHLTCSLIEDIA
FT                   AAYFPSCVIRPFGSSVNTFGKLGCDLDMFLDLDETGKLDVHKNTGNFFMEFQVKNVPSE
FT                   RIATQKILSVIGECLDNFGPGCVGVQKILNARCPLVRFSHQGSGFQCDLTANNSIALKS
FT                   SELLYIYGSLDSRVRALVFSVRCWARAHSLTSSIPGAWITNFSLTVMVIFFLQRRSPPI
FT                   LPTLDSLKSIADAEDRCILEGNNCTFVQDVNKIQPSGNTETLELLIKEFFEYFGNFAFN
FT                   KNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVELARDSAWILEQED
FT                   KNQPFSSSRQPWGLAALLLPPGSGHTSLSRKKKKKPMSEKVKGLLASIKSNSPDSSTDT
FT                   SGKRTISTQA"
FT   CDS             join(<1427938..1428162,1430920..1431131,1431702..1431928,
FT                   1439723..1439815,1439905..1439978,1440854..1441216)
FT                   /codon_start=1
FT                   /gene="Papd1"
FT                   /locus_tag="mCG_144717"
FT                   /product="PAP associated domain containing 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG144717.1 transcript_id=mCT191822.0
FT                   protein_id=mCP112770.0 isoform=CRA_c"
FT                   /protein_id="EDL23052.1"
FT                   /translation="IEEQLNTLLKAFQLTEENIRLRHLTCSLIEDIAAAYFPSCVIRPF
FT                   GSSVNTFGKLGCDLDMFLDLDETGKLDVHKNTGNFFMEFQVKNVPSERIATQKILSVIG
FT                   ECLDNFGPGCVGVQKILNARCPLVRFSHQGSGFQCDLTANNSIALKSSELLYIYGSLDS
FT                   RVRALVFSVRCWARAHSLTSSIPGAWITNFSLTVMVIFFLQRRSPPILPTLDSLKSIAD
FT                   AEDRCILEGNNCTFVQDVNKIQPSGNTETLELLIKEFFEYFGNFAFNKNSINIRQGREQ
FT                   NKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVELARDSAWILEQEDKNQPFSSSRQPW
FT                   GLAALLLPPGSGHTSLSRKKKKKPMSEKVKGLLASIKSNSPDSSTDTSGKRTISTQA"
FT   gene            1529491..1530347
FT                   /pseudo
FT                   /locus_tag="mCG_117690"
FT                   /note="gene_id=mCG117690.1"
FT   mRNA            1529491..1530347
FT                   /pseudo
FT                   /locus_tag="mCG_117690"
FT                   /note="gene_id=mCG117690.1 transcript_id=mCT118834.1
FT                   created on 30-MAY-2002"
FT   gene            1680309..1724766
FT                   /locus_tag="mCG_55337"
FT                   /note="gene_id=mCG55337.2"
FT   mRNA            join(1680309..1680389,1694446..1694776,1716578..1720230,
FT                   1724566..1724766)
FT                   /locus_tag="mCG_55337"
FT                   /product="mCG55337"
FT                   /note="gene_id=mCG55337.2 transcript_id=mCT55520.2 created
FT                   on 16-AUG-2002"
FT   CDS             join(1694502..1694776,1716578..1720230,1724566..1724600)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55337"
FT                   /product="mCG55337"
FT                   /note="gene_id=mCG55337.2 transcript_id=mCT55520.2
FT                   protein_id=mCP42824.2"
FT                   /db_xref="GOA:B7ZN02"
FT                   /db_xref="InterPro:IPR028221"
FT                   /db_xref="MGI:MGI:2685174"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN02"
FT                   /protein_id="EDL23049.1"
FT                   /translation="MYSVEDLLISHGYKPARDAAAPCEDKSERCRSTRTGPRAGQGLLN
FT                   GYKDGATAHTHSRTSLGTGHVSNSENRISRPRGHREHQSTSRTPEARFLNQPSLAWSSQ
FT                   PQSGRDDIYWSRGRQEGSGSLCPRDWKELESRGMAQAYSLPVHVRENLWEVAGRTEHVM
FT                   KNAIWEEELRMQDMSLESWKKPRELGRQASDGDGRKRPQEKFEGLYPFVHGEHTSQNRK
FT                   KSQSLPRALSPKSLNFTEIPVPLHDGHITGVPKVPPYPPSFPSPSEPMRNLEKASSSGP
FT                   FPRPKFGKPLKTPCYSSHSQPRGEGGFQDHQHRDPRGSYPTRSKDPSHELGMLDPGLEP
FT                   PVYVPPPSYRSPPQHIPNPYLEDPVPRHVSSNQSQQQVPEKPETSCPLPSGSLAARDLY
FT                   DAMPGSPPQGLPPQPYPIATHGGSIQYIPFDDPRIRHIKLAQPPEFYEEAKLDDTSYNP
FT                   GLLTTQEPAIGKRQYDDAPSVPRGPTPSPVNEQSSAFVHSSPRWLQGQLPLGIGPGGFH
FT                   GQTEHHVMGGLTTNVTDIKAEGHASSPQPQSEGTCKTYTKLRKFETGVQSKKSSKKKSN
FT                   ATIFCLVSIPVKSESLVLATDTNNNDFKLVADKTRGLCQGSALQEQSLLSMSSTDLELQ
FT                   ALMGSMAWRRTSPRQGLRESEDGQIDDPRILHLIKPKELQASSPWPGHQYRDQQTQTSF
FT                   HEDSKSSQLLPATKPGEASNVAPTPTCPDTTASEVCLHTALAFSDQNQKPSVPHLQGQT
FT                   SLSPSRNSAFSRTSSAINQASMSKGTSDQLPGANPVPKPEVVKGESTTGQCNSTQLFGQ
FT                   FLLKPVSRRPWDLISQLESFNKELQEEEESHGGSGSEDSEAEQPEDCADSRTKSWALQG
FT                   TRTAQQPAGLALENVASPDRRLNDSQSWNEEPKPGHSSVHPQSLGPSQEEGSRGVPVQW
FT                   ADGSLTAEQKSQEDLNGMCERDFSPRPVSRIAPIDTKAAPLYCLSEPRGSQELTKFGDA
FT                   VGSVQLGRETPTQVGNGGDTEVLPCVLLPLADKYRGHSTPDFRSLELTLGQEQNAYKLE
FT                   CLDLENTVEVLPSESLQERAERILGIEVAVESLLPSARRTEQSQLPEPDASACNPSSSR
FT                   EDSSHSLALPVGPKVATDAFYGRRKCGWTESPLFVGERAPQASICSDVDGFPTSQATSP
FT                   EPGKKDEEAKAPFKSTLFHFMEKSTNVVGPEKRLRNPSKVVENLQEKLVSPPKKADSVH
FT                   LIRMREVNSLSQMRCLSSKSADSVEEPDPLKVIKSSAWLSEGLTSLGGKDEAWQAGHLP
FT                   SVSQNENGHPEVPRDKMSDQDLWCADSYDPSRVERV"
FT   gene            1787405..1788205
FT                   /pseudo
FT                   /locus_tag="mCG_19925"
FT                   /note="gene_id=mCG19925.0"
FT   mRNA            1787405..1788205
FT                   /pseudo
FT                   /locus_tag="mCG_19925"
FT                   /note="gene_id=mCG19925.0 transcript_id=mCT17873.0 created
FT                   on 31-MAY-2002"
FT   gene            1965819..2164705
FT                   /gene="Svil"
FT                   /locus_tag="mCG_19929"
FT                   /note="gene_id=mCG19929.1"
FT   mRNA            join(1965819..1966155,2016615..2016722,2082657..2082714,
FT                   2085671..2085762,2092122..2092179,2092297..2092448,
FT                   2094418..2095027,2099599..2099679,2101561..2102430,
FT                   2102950..2103114,2103800..2103834,2104388..2104449,
FT                   2104905..2105044,2106190..2106285,2107837..2108056,
FT                   2108556..2109132,2109833..2110052,2119173..2119296,
FT                   2128075..2128225,2134056..2134233,2136206..2136378,
FT                   2138265..2138420,2139958..2140094,2140592..2140739,
FT                   2140856..2141001,2142847..2143022,2144328..2144472,
FT                   2144854..2145130,2148993..2149144,2151184..2151289,
FT                   2152082..2152289,2154002..2154135,2159947..2160102,
FT                   2161394..2161537,2162389..2162513,2163516..2163671,
FT                   2163762..2164705)
FT                   /gene="Svil"
FT                   /locus_tag="mCG_19929"
FT                   /product="supervillin, transcript variant mCT17877"
FT                   /note="gene_id=mCG19929.1 transcript_id=mCT17877.2 created
FT                   on 19-SEP-2002"
FT   gene            2005202..2005872
FT                   /locus_tag="mCG_147791"
FT                   /note="gene_id=mCG147791.0"
FT   mRNA            2005202..2005872
FT                   /locus_tag="mCG_147791"
FT                   /product="mCG147791"
FT                   /note="gene_id=mCG147791.0 transcript_id=mCT188054.0
FT                   created on 13-JAN-2004"
FT   CDS             2005426..2005548
FT                   /codon_start=1
FT                   /locus_tag="mCG_147791"
FT                   /product="mCG147791"
FT                   /note="gene_id=mCG147791.0 transcript_id=mCT188054.0
FT                   protein_id=mCP108702.0"
FT                   /protein_id="EDL23048.1"
FT                   /translation="MAAVSHRKMKHLSLVEGQGAPSVFLELWVSQQQYMAAFQG"
FT   mRNA            join(2040558..2040645,2082657..2082714,2085671..2085762,
FT                   2092122..2092179,2092297..2092448,2094418..2095027,
FT                   2099599..2099679,2101561..2102430,2102950..2103114,
FT                   2103800..2103834,2104388..2104449,2104905..2105044,
FT                   2106190..2106285,2107837..2108080,2108556..2109132,
FT                   2109833..2110052,2119173..2119296,2128075..2128225,
FT                   2134056..2134233,2136206..2136378,2138265..2138420,
FT                   2139958..2140094,2140592..2140739,2140856..2141001,
FT                   2142847..2143022,2144328..2144472,2144854..2145130,
FT                   2148993..2149144,2151184..2151289,2152082..2152289,
FT                   2154002..2154135,2159947..2160102,2161394..2161537,
FT                   2162389..2162513,2163516..2163671,2163762..2164705)
FT                   /gene="Svil"
FT                   /locus_tag="mCG_19929"
FT                   /product="supervillin, transcript variant mCT173384"
FT                   /note="gene_id=mCG19929.1 transcript_id=mCT173384.0 created
FT                   on 19-SEP-2002"
FT   CDS             join(2092172..2092179,2092297..2092448,2094418..2095027,
FT                   2099599..2099679,2101561..2102430,2102950..2103114,
FT                   2103800..2103834,2104388..2104449,2104905..2105044,
FT                   2106190..2106285,2107837..2108080,2108556..2109132,
FT                   2109833..2110052,2119173..2119296,2128075..2128225,
FT                   2134056..2134233,2136206..2136378,2138265..2138420,
FT                   2139958..2140094,2140592..2140739,2140856..2141001,
FT                   2142847..2143022,2144328..2144472,2144854..2145130,
FT                   2148993..2149144,2151184..2151289,2152082..2152289,
FT                   2154002..2154135,2159947..2160102,2161394..2161537,
FT                   2162389..2162513,2163516..2163671,2163762..2163848)
FT                   /codon_start=1
FT                   /gene="Svil"
FT                   /locus_tag="mCG_19929"
FT                   /product="supervillin, isoform CRA_b"
FT                   /note="gene_id=mCG19929.1 transcript_id=mCT173384.0
FT                   protein_id=mCP96303.0 isoform=CRA_b"
FT                   /protein_id="EDL23047.1"
FT                   /translation="MKRKERIARRLEGIENDSQPILLQSCTGLVTHRLLEEDTPRYMRA
FT                   TDPASPHIGRSKEEEDTPGSSLEKQTPSKYCIETSGIHSSGSMDTHSLESKAERIARYK
FT                   AERRRQLAEKYGLTLDPEADSEYLSRYAKSRKDPDVTERRGKSDKQEEQSKDANSRHSR
FT                   TESGPRTSLVASQDCTPLGSNMSDQEQLLNVENQRRVQDPPLGEDGSSAFFSERSISFP
FT                   EVPRSPKQIPSSPLQQPASPNHPGDSPLPTEARASTGKPTHEWFLQRDSEGDTPSLINW
FT                   PSRVKVREKLVKEESARSSPELTSESLTQRRQQPAPAHFLPIQSESSTFDRVTSKAVSS
FT                   LQPSQSGVLPTDPVHAIKLVTMDTPESTSEFSWVGSATPKVIKSTTLKILEGGSRDAPV
FT                   LHICESKAEDWLSPEPLERSPKSLLTSEDDRLVRGHKDPSGNKDLDKAIICSIDVESER
FT                   ERQVQHLPTQRTGRSEMLLYVQSGPVSQDATLTSHTKEASPKKRKVLARSLSDYTGPPQ
FT                   LQVPRHKDEAPSQELELQSSRAEGPGAEASVLDTRVSVAQLRNIFMESTRASKKPELQS
FT                   RVERSAEGIGLPMERERGSRKPRRYLSPGESRKTSERFRTQPITSAERKESDRYPSGSE
FT                   IPVVEDEEKVDERAKLSVAAKRLLFREMEKSFDEHTVPKRHSRNAAVEQRLRRLQDRSH
FT                   TQPITTEEVVIAATEPIPASCSGVTHPVTARLPSPTVARSSVQPARLQASAHQKALARD
FT                   QANEGRESAEPGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRIDVRQRRMNARYQTQ
FT                   PVTLGEVEQVQSGKLISFSPTVNTSVSIMASAVAPTYAGDLRKLSVDNNTSATDYKSPP
FT                   AENSDSPVRSILKPQAWRPLVEHSGSKGMPGESGKTESKNALTVAAEDSGVQTRGAFEE
FT                   EEEPSYPILGRVREGDGQKEPKHVVLRRGSLELGNPSAAHLGDELKEVSTAKSSLQENL
FT                   DLKDKQASEENTDVETVMRKFSLKEFGETTSEQTEVAARKASVQMATPGAWKQQESSEQ
FT                   LAEKLFKNPCAMFASGEVKVPVGDSFLDSPSKTMSIKERLALLKKSGEEDWKNRLIRKQ
FT                   EYGKATGGLHTQEVEQSLKKKRVTESRESQMTIEERKHLITVREEAWKTKGRGAANDST
FT                   QFTVAGRMVKKGLAGIQETVLTVTGKSVKEVMKLDDDETFAKFYRSVDHSIPRSPVELE
FT                   EDFDVIFDPYAPKLTSSVAEHKRQVRPKRRVQASKNPLKLLAARDDLLQEYTEQRLNVA
FT                   FMESKRMKVEKMSSNSNFSEVTLAGLASRENFSNINLRSVNLMEQNSNNSAMPYKKLML
FT                   LQIKGRRHVQTRLVEPRASSLNSGDCFLLLSPQYCFLWVGEFSNVIEKAKASELATLIQ
FT                   TKRELGCRATYIQTIEEGINTHTHAAKDFWKLLGGQTSYQSAGDPKEDELYETAIIETN
FT                   CVYRLTDDKLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQL
FT                   AKHLWNGTFDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRVTEHNETILFKEKFLD
FT                   WTELKRPTEKNSGEVVQQKDDPRADVKPYDVTRMVATPQITAGTILDGVNVGRGYGLVE
FT                   GDDRRQFEIATVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMASTAVGSRQKG
FT                   EHLVRVAGKEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQC
FT                   FQGGMVVHSGRREEEEENVQSEWRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNI
FT                   NKALIYLWHGCKAQGHTKEVGRTAANKIKEECPLEAGLHSSSNVTIHECDEGSEPLGFW
FT                   DALGRRDRKAYDCMLQDPGSFNFAPRLFILSSSSGDFSATEFVYPAQAPSAVSSMPFLQ
FT                   EDLYSAPQPALFLVDNHHEVYLWQGWWPTENKITGSARIRWASDRKSAMETVLQYCRGK
FT                   NLKRPPPKSYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLC
FT                   KTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMSRDEFNALPTWKQVNLKKSKG
FT                   LF"
FT   CDS             join(2092172..2092179,2092297..2092448,2094418..2095027,
FT                   2099599..2099679,2101561..2102430,2102950..2103114,
FT                   2103800..2103834,2104388..2104449,2104905..2105044,
FT                   2106190..2106285,2107837..2108056,2108556..2109132,
FT                   2109833..2110052,2119173..2119296,2128075..2128225,
FT                   2134056..2134233,2136206..2136378,2138265..2138420,
FT                   2139958..2140094,2140592..2140739,2140856..2141001,
FT                   2142847..2143022,2144328..2144472,2144854..2145130,
FT                   2148993..2149144,2151184..2151289,2152082..2152289,
FT                   2154002..2154135,2159947..2160102,2161394..2161537,
FT                   2162389..2162513,2163516..2163671,2163762..2163848)
FT                   /codon_start=1
FT                   /gene="Svil"
FT                   /locus_tag="mCG_19929"
FT                   /product="supervillin, isoform CRA_a"
FT                   /note="gene_id=mCG19929.1 transcript_id=mCT17877.2
FT                   protein_id=mCP23084.2 isoform=CRA_a"
FT                   /protein_id="EDL23046.1"
FT                   /translation="MKRKERIARRLEGIENDSQPILLQSCTGLVTHRLLEEDTPRYMRA
FT                   TDPASPHIGRSKEEEDTPGSSLEKQTPSKYCIETSGIHSSGSMDTHSLESKAERIARYK
FT                   AERRRQLAEKYGLTLDPEADSEYLSRYAKSRKDPDVTERRGKSDKQEEQSKDANSRHSR
FT                   TESGPRTSLVASQDCTPLGSNMSDQEQLLNVENQRRVQDPPLGEDGSSAFFSERSISFP
FT                   EVPRSPKQIPSSPLQQPASPNHPGDSPLPTEARASTGKPTHEWFLQRDSEGDTPSLINW
FT                   PSRVKVREKLVKEESARSSPELTSESLTQRRQQPAPAHFLPIQSESSTFDRVTSKAVSS
FT                   LQPSQSGVLPTDPVHAIKLVTMDTPESTSEFSWVGSATPKVIKSTTLKILEGGSRDAPV
FT                   LHICESKAEDWLSPEPLERSPKSLLTSEDDRLVRGHKDPSGNKDLDKAIICSIDVESER
FT                   ERQVQHLPTQRTGRSEMLLYVQSGPVSQDATLTSHTKEASPKKRKVLARSLSDYTGPPQ
FT                   LQVPRHKDEAPSQELELQSSRAEGPGAEASVLDTRVSVAQLRNIFMESTRASKKPELQS
FT                   RVERSAEGIGLPMERERGSRKPRRYLSPGESRKTSERFRTQPITSAERKESDRYPSGSE
FT                   IPVVEDEEKVDERAKLSVAAKRLLFREMEKSFDEHTVPKRHSRNAAVEQRLRRLQDRSH
FT                   TQPITTEEVVIAATEPIPASCSGVTHPVTARLPSPTVARSSVQPARLQASAHQKALARD
FT                   QANEGRESAEPGEPDSSTLSLAEKLALFNKLSQPVSKAISTRNRIDVRQRRMNARYQTQ
FT                   PVQSGKLISFSPTVNTSVSIMASAVAPTYAGDLRKLSVDNNTSATDYKSPPAENSDSPV
FT                   RSILKPQAWRPLVEHSGSKGMPGESGKTESKNALTVAAEDSGVQTRGAFEEEEEPSYPI
FT                   LGRVREGDGQKEPKHVVLRRGSLELGNPSAAHLGDELKEVSTAKSSLQENLDLKDKQAS
FT                   EENTDVETVMRKFSLKEFGETTSEQTEVAARKASVQMATPGAWKQQESSEQLAEKLFKN
FT                   PCAMFASGEVKVPVGDSFLDSPSKTMSIKERLALLKKSGEEDWKNRLIRKQEYGKATGG
FT                   LHTQEVEQSLKKKRVTESRESQMTIEERKHLITVREEAWKTKGRGAANDSTQFTVAGRM
FT                   VKKGLAGIQETVLTVTGKSVKEVMKLDDDETFAKFYRSVDHSIPRSPVELEEDFDVIFD
FT                   PYAPKLTSSVAEHKRQVRPKRRVQASKNPLKLLAARDDLLQEYTEQRLNVAFMESKRMK
FT                   VEKMSSNSNFSEVTLAGLASRENFSNINLRSVNLMEQNSNNSAMPYKKLMLLQIKGRRH
FT                   VQTRLVEPRASSLNSGDCFLLLSPQYCFLWVGEFSNVIEKAKASELATLIQTKRELGCR
FT                   ATYIQTIEEGINTHTHAAKDFWKLLGGQTSYQSAGDPKEDELYETAIIETNCVYRLTDD
FT                   KLVPDDDYWGKIPKCSLLQSKEVLVFDFGSEVYVWHGKEVTLAQRKIAFQLAKHLWNGT
FT                   FDYENCDINPLDPGECNPLIPRKGQGRPDWAIFGRVTEHNETILFKEKFLDWTELKRPT
FT                   EKNSGEVVQQKDDPRADVKPYDVTRMVATPQITAGTILDGVNVGRGYGLVEGDDRRQFE
FT                   IATVSVDVWHILEFDYSRLPRQSIGQFHEGDAYVVKWKYMASTAVGSRQKGEHLVRVAG
FT                   KEKCVYFFWQGRHSTVSEKGTSALMTVELDEERGAQVQVLQGKEPPCFLQCFQGGMVVH
FT                   SGRREEEEENVQSEWRLYCVRGEVPMEGNLLEVACHCSSLRSRTSMVVLNINKALIYLW
FT                   HGCKAQGHTKEVGRTAANKIKEECPLEAGLHSSSNVTIHECDEGSEPLGFWDALGRRDR
FT                   KAYDCMLQDPGSFNFAPRLFILSSSSGDFSATEFVYPAQAPSAVSSMPFLQEDLYSAPQ
FT                   PALFLVDNHHEVYLWQGWWPTENKITGSARIRWASDRKSAMETVLQYCRGKNLKRPPPK
FT                   SYLIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLAD
FT                   LLARPLPEGVDPLKLEIYLTDEDFEFALDMSRDEFNALPTWKQVNLKKSKGLF"
FT   gene            complement(<2208350..>2211204)
FT                   /locus_tag="mCG_144722"
FT                   /note="gene_id=mCG144722.0"
FT   mRNA            complement(join(<2208350..2209902,2210758..2210872,
FT                   2211141..>2211204))
FT                   /locus_tag="mCG_144722"
FT                   /product="mCG144722"
FT                   /note="gene_id=mCG144722.0 transcript_id=mCT184146.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(<2208350..>2208734)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144722"
FT                   /product="mCG144722"
FT                   /note="gene_id=mCG144722.0 transcript_id=mCT184146.0
FT                   protein_id=mCP106202.0"
FT                   /protein_id="EDL23045.1"
FT                   /translation="DRATAQALHAQGTVARAAARSHRAAQEQGLITYRYVRGCLPCLPP
FT                   KCRCHAIALEMGSGPFPLPRWFSFPVIWSWKRLWNITWSSFTQEISCSCEKILTRFFWF
FT                   VVVVVVVVYPSLLPPHLTPPKGKE"
FT   gene            complement(2253706..>2378782)
FT                   /gene="Zfp438"
FT                   /locus_tag="mCG_52667"
FT                   /note="gene_id=mCG52667.4"
FT   mRNA            complement(join(2253706..2254870,2256791..2258591,
FT                   2289060..2289127,2332643..2332720,2378319..2378413))
FT                   /gene="Zfp438"
FT                   /locus_tag="mCG_52667"
FT                   /product="zinc finger protein 438, transcript variant
FT                   mCT52850"
FT                   /note="gene_id=mCG52667.4 transcript_id=mCT52850.2 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(2253796..2254870,2256791..2258591,
FT                   2289060..2289127,2332643..2332720,2378691..>2378782))
FT                   /gene="Zfp438"
FT                   /locus_tag="mCG_52667"
FT                   /product="zinc finger protein 438, transcript variant
FT                   mCT191819"
FT                   /note="gene_id=mCG52667.4 transcript_id=mCT191819.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2254312..2254870,2256791..2258591,
FT                   2289060..2289127,2332643..>2332671))
FT                   /codon_start=1
FT                   /gene="Zfp438"
FT                   /locus_tag="mCG_52667"
FT                   /product="zinc finger protein 438, isoform CRA_a"
FT                   /note="gene_id=mCG52667.4 transcript_id=mCT191819.0
FT                   protein_id=mCP112775.0 isoform=CRA_a"
FT                   /protein_id="EDL23043.1"
FT                   /translation="KTFAKSSYFTKATLRVIYIIMRNSSSVPPKDQGESNIRSGTTQSG
FT                   KTLQSKSQFRTIAPKVVPKVLTSRVLPCPSSISDQGSLTLMPKPLGMPTQNYALMQVAG
FT                   QEGTFSLVAFPNVASAQPVQKPRMSTHENLKLPIPRYQPLSSQGLRKKQDLSSPKSGSS
FT                   DPPGPSQLCHLTSSPQAYPDPHHKPSLWKQMPTLNPSPTNINTATLTSGVGQGDLSPLV
FT                   TNSCGDLELSAMPVYTTEDSSSQQSLPASMQKAGCARKEAPTTPAIASEELKEQLASAQ
FT                   TVLSSAVQLLSVVPKGKLPILPLPRVKTTEVGKVESDADNAELSLSGCRANCDERLSIT
FT                   EGFDAATEIASKIAALHGSKQSACESAFCPVTKLDLSHKAKPSSGIKRRGRKWKVPDEI
FT                   LALQGKRRKCIIGMCGDGIERARNSPQEARDQKPRVASRKYRNIMPKPVLVLSALAPLA
FT                   SHTAVLSQAPSSLGQDVLNNALPSKCLGSKQSDSSTPKPSSVLRNGFSGIKKPWHMCPV
FT                   CNYHFQFKHHLLDHMNTHTNRRPYSCGICRKTYVRPGSLSAHMKLHHGDNHPKKLVCCE
FT                   FCAKVFGHVRVYFGHLKEVHRVVISTEPSPSELQPGDTPKNKNRDPGMQGPDNSLERET
FT                   KSSLEEDFLLNQADEVKLQIRCGRCQITAQSFAEIKFHLLHVHGEEIQGRLQEMILPGS
FT                   RSDAPHQKQYTERRKQMKPYASLEDSPAFPRVKRLPAPHQNREEALVGSEGGQWGMAGS
FT                   QHPAKLLWSHTGFNCLLCAQMLGRKEDLLLHWVHKHNCEDPSRLWALLGKFSKQGAPEL
FT                   HSESRL"
FT   CDS             complement(join(2254312..2254870,2256791..2258591,
FT                   2289060..2289096))
FT                   /codon_start=1
FT                   /gene="Zfp438"
FT                   /locus_tag="mCG_52667"
FT                   /product="zinc finger protein 438, isoform CRA_b"
FT                   /note="gene_id=mCG52667.4 transcript_id=mCT52850.2
FT                   protein_id=mCP42835.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BFX2"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2444919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BFX2"
FT                   /protein_id="EDL23044.1"
FT                   /translation="MRNSSSVPPKDQGESNIRSGTTQSGKTLQSKSQFRTIAPKVVPKV
FT                   LTSRVLPCPSSISDQGSLTLMPKPLGMPTQNYALMQVAGQEGTFSLVAFPNVASAQPVQ
FT                   KPRMSTHENLKLPIPRYQPLSSQGLRKKQDLSSPKSGSSDPPGPSQLCHLTSSPQAYPD
FT                   PHHKPSLWKQMPTLNPSPTNINTATLTSGVGQGDLSPLVTNSCGDLELSAMPVYTTEDS
FT                   SSQQSLPASMQKAGCARKEAPTTPAIASEELKEQLASAQTVLSSAVQLLSVVPKGKLPI
FT                   LPLPRVKTTEVGKVESDADNAELSLSGCRANCDERLSITEGFDAATEIASKIAALHGSK
FT                   QSACESAFCPVTKLDLSHKAKPSSGIKRRGRKWKVPDEILALQGKRRKCIIGMCGDGIE
FT                   RARNSPQEARDQKPRVASRKYRNIMPKPVLVLSALAPLASHTAVLSQAPSSLGQDVLNN
FT                   ALPSKCLGSKQSDSSTPKPSSVLRNGFSGIKKPWHMCPVCNYHFQFKHHLLDHMNTHTN
FT                   RRPYSCGICRKTYVRPGSLSAHMKLHHGDNHPKKLVCCEFCAKVFGHVRVYFGHLKEVH
FT                   RVVISTEPSPSELQPGDTPKNKNRDPGMQGPDNSLERETKSSLEEDFLLNQADEVKLQI
FT                   RCGRCQITAQSFAEIKFHLLHVHGEEIQGRLQEMILPGSRSDAPHQKQYTERRKQMKPY
FT                   ASLEDSPAFPRVKRLPAPHQNREEALVGSEGGQWGMAGSQHPAKLLWSHTGFNCLLCAQ
FT                   MLGRKEDLLLHWVHKHNCEDPSRLWALLGKFSKQGAPELHSESRL"
FT   gene            complement(2392224..2405821)
FT                   /locus_tag="mCG_147792"
FT                   /note="gene_id=mCG147792.0"
FT   mRNA            complement(join(2392224..2394592,2405705..2405821))
FT                   /locus_tag="mCG_147792"
FT                   /product="mCG147792"
FT                   /note="gene_id=mCG147792.0 transcript_id=mCT188055.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2393064..2393309)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147792"
FT                   /product="mCG147792"
FT                   /note="gene_id=mCG147792.0 transcript_id=mCT188055.0
FT                   protein_id=mCP108703.0"
FT                   /protein_id="EDL23042.1"
FT                   /translation="MWLVGPWVPSFICSVWCGCKWVSMVQPVPCSGVQVCGWHGGWQVY
FT                   ICLPPPELCYLDLISLDWILGVLGTKQLWPPYQASS"
FT   gene            complement(2610077..2626844)
FT                   /locus_tag="mCG_147789"
FT                   /note="gene_id=mCG147789.0"
FT   mRNA            complement(join(2610077..2611004,2626721..2626844))
FT                   /locus_tag="mCG_147789"
FT                   /product="mCG147789"
FT                   /note="gene_id=mCG147789.0 transcript_id=mCT188052.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2610388..2610510)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147789"
FT                   /product="mCG147789"
FT                   /note="gene_id=mCG147789.0 transcript_id=mCT188052.0
FT                   protein_id=mCP108700.0"
FT                   /protein_id="EDL23041.1"
FT                   /translation="MPVPGKHRSGCSQSAIGWNTGSPMEELEKVPKELKGSATL"
FT   gene            2647404..2686531
FT                   /locus_tag="mCG_144719"
FT                   /note="gene_id=mCG144719.0"
FT   mRNA            join(2647404..2647743,2685040..2685176,2685399..2686531)
FT                   /locus_tag="mCG_144719"
FT                   /product="mCG144719"
FT                   /note="gene_id=mCG144719.0 transcript_id=mCT184143.0
FT                   created on 05-JUN-2003"
FT   CDS             2686140..2686397
FT                   /codon_start=1
FT                   /locus_tag="mCG_144719"
FT                   /product="mCG144719"
FT                   /note="gene_id=mCG144719.0 transcript_id=mCT184143.0
FT                   protein_id=mCP106197.0"
FT                   /protein_id="EDL23040.1"
FT                   /translation="MEMSVRSHLFSMEDKKMHADFENGICVRSRLVLGKISLASNKKLT
FT                   LTQFPGNVMAVLSVCVGHMSPVPFTRSPFLAGLEDKLHWR"
FT   gene            <2749282..2820313
FT                   /gene="Zfhx1a"
FT                   /locus_tag="mCG_12663"
FT                   /note="gene_id=mCG12663.2"
FT   mRNA            join(<2749282..2749482,2792933..2793094,2803811..2804013,
FT                   2806174..2806279,2811067..2812871,2815230..2815410,
FT                   2817275..2820313)
FT                   /gene="Zfhx1a"
FT                   /locus_tag="mCG_12663"
FT                   /product="zinc finger homeobox 1a"
FT                   /note="gene_id=mCG12663.2 transcript_id=mCT13571.1 created
FT                   on 19-SEP-2002"
FT   CDS             join(<2749284..2749482,2792933..2793094,2803811..2804013,
FT                   2806174..2806279,2811067..2812871,2815230..2815410,
FT                   2817275..2817912)
FT                   /codon_start=1
FT                   /gene="Zfhx1a"
FT                   /locus_tag="mCG_12663"
FT                   /product="zinc finger homeobox 1a"
FT                   /note="gene_id=mCG12663.2 transcript_id=mCT13571.1
FT                   protein_id=mCP23112.1"
FT                   /protein_id="EDL23039.1"
FT                   /translation="TNYNTVVEANSDSDDEDKLHIVEEESITDAADCEGGMPDDELPAD
FT                   QTVLPGGSDRGGGAKNCWQDNVKDNECDSDAENEQNHDPNVEEFLQQQDTAVIYPEAPE
FT                   EDQRQGTPEASSHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNFSCS
FT                   LCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLRIH
FT                   SGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVNGRPRSGLKTSQCSSPSLSTSPG
FT                   SPTRPQIRQKIENKPLQEPLSVNQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSSGGQ
FT                   LQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLETNQASLASK
FT                   EQEAVSASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKEIPA
FT                   PTNSCKSEKLPEDLTVKSETDKSFEGARDDSTCLLCEDCPGDLNALPELKHYDPECPAQ
FT                   PPPPAPATEKPESSASSAGNGDLSPSQPPLKNLLSLLKAYYALNAQPSTEELSKIADSV
FT                   NLPLDGVKKWFEKMQAGQIPGQSPDPPSPGTGSVNIPTKTDEQPQPADGNEPQEDSTRG
FT                   QSPVKIRSSPVLPVGSAMNGSRSCTSSPSPLNLCSARNPQGYSCVAEGAQEEPQVEPLD
FT                   LSLPKQQGELLERSTVSSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTDSEPVVNVVPP
FT                   SANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSATVSPAVQ
FT                   EPPVKVIQPNGNQDERQDTSSEGVSTVEDQNDSDSTPPKKKTRKTENGMYACDLCDKIF
FT                   QKSSSLLRHKYEHTGKRPHECGICRKAFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHS
FT                   GSYSQHMNHRYSYCKRGAEDRDAMEQEDAGPEVLPEVLATEHVGARASPSQADSDERES
FT                   LTREEDEDSEKEEEEEDKEMEELQEGKECENPQGEEEEEEEEEEEEEEEEEEEVEADEA
FT                   EHEAAAKTDGTVEVGAAQQAGSLEQKASESEMESESESEQLSEEKTNEA"
FT   gene            complement(3070270..3182072)
FT                   /gene="Arhgap12"
FT                   /locus_tag="mCG_12659"
FT                   /note="gene_id=mCG12659.1"
FT   mRNA            complement(join(3070270..3072539,3073384..3073486,
FT                   3073769..3073903,3074003..3074080,3077539..3077637,
FT                   3078950..3079066,3080259..3080361,3082827..3082925,
FT                   3085163..3085264,3095087..3095168,3098672..3098733,
FT                   3103327..3103401,3107657..3107782,3110151..3110231,
FT                   3111515..3111655,3115641..3115901,3157770..3158524,
FT                   3161897..3161933,3181934..3182072))
FT                   /gene="Arhgap12"
FT                   /locus_tag="mCG_12659"
FT                   /product="Rho GTPase activating protein 12, transcript
FT                   variant mCT13568"
FT                   /note="gene_id=mCG12659.1 transcript_id=mCT13568.2 created
FT                   on 19-SEP-2002"
FT   mRNA            complement(join(3071021..3072539,3073384..3073486,
FT                   3073769..3073903,3074003..3074080,3077539..3077637,
FT                   3078950..3079066,3080259..3080361,3082827..3082925,
FT                   3085163..3085264,3095087..3095168,3098672..3098733,
FT                   3103327..3103401,3107657..3107782,3110151..3110231,
FT                   3111515..3111655,3115641..3115901,3157770..3158524,
FT                   3161897..3161933,3181920..>3182060))
FT                   /gene="Arhgap12"
FT                   /locus_tag="mCG_12659"
FT                   /product="Rho GTPase activating protein 12, transcript
FT                   variant mCT191811"
FT                   /note="gene_id=mCG12659.1 transcript_id=mCT191811.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3071027..3072539,3073384..3073486,
FT                   3073769..3073903,3074003..3074080,3077539..3077637,
FT                   3078950..3079066,3080259..3080361,3082827..3082925,
FT                   3085163..3085264,3095087..3095168,3098672..3098733,
FT                   3107657..3107782,3110151..3110231,3111515..3111655,
FT                   3115641..3115901,3157770..3158524,3161897..3161933,
FT                   3181920..>3182014))
FT                   /gene="Arhgap12"
FT                   /locus_tag="mCG_12659"
FT                   /product="Rho GTPase activating protein 12, transcript
FT                   variant mCT191810"
FT                   /note="gene_id=mCG12659.1 transcript_id=mCT191810.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3072365..3072539,3073384..3073486,
FT                   3073769..3073903,3074003..3074080,3077539..3077637,
FT                   3078950..3079066,3080259..3080361,3082827..3082925,
FT                   3085163..3085264,3095087..3095168,3098672..3098733,
FT                   3107657..3107782,3110151..3110231,3111515..3111655,
FT                   3115641..3115901,3157770..>3158453))
FT                   /codon_start=1
FT                   /gene="Arhgap12"
FT                   /locus_tag="mCG_12659"
FT                   /product="Rho GTPase activating protein 12, isoform CRA_b"
FT                   /note="gene_id=mCG12659.1 transcript_id=mCT191810.0
FT                   protein_id=mCP112767.0 isoform=CRA_b"
FT                   /protein_id="EDL23037.1"
FT                   /translation="VEMAERSGKITAGQAYIEVEYDYEYDAKDRKIVIRQGERYLLVKK
FT                   TNDDWWQVRPDENSKAFYVPAQYVKEVTRKALMPPVKQATGLPNNSMKTIQSMHLQRST
FT                   ENVNKMPELSSFGKPSSSVQGTGLIRDANQNFGSNYNSGQTLNLSLDLTHNNGKFNSDS
FT                   HSPKVSSQNRTRLFGHFPGPEFLDIEKTSFSQEQSCDSAGEGSERIQQDSESGDELSSS
FT                   STEQMRATTPPNQGRPDSPVYANLQELKISQSALPPLPGSPAIQVNGEWETHKDSSGRC
FT                   YYYNRTTQERTWKPPRWARDVSTSRDFQSPGEQEPLSSEENYHSSCFSQSDSQCGSPPR
FT                   GWSEELDERGHTLYTSDYTKEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQRE
FT                   IIKSRSLDRRLQEPIVLTKWRHSTIVLDSNDKGQEKYGLLNVTKITENGKKVRKNWLSS
FT                   WAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGAVIEMASKDKSSKKNVFELKTR
FT                   QGTELLIQSDNDAVINDWFKVLSSTINNQVAEADEAAEEETPDSPGVEKHDKEKDQKEL
FT                   KKLRSMKGSSMDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGSNLANLCQREN
FT                   GTVPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHV
FT                   ITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVTAVKDLIRQLPKPNQDTMQILF
FT                   RHLKRVIENGEKNRMTYQSIAIVFGPTLLKPERETGNIAVHTVYQNQIVELILLELSTV
FT                   FGR"
FT   CDS             complement(join(3072365..3072539,3073384..3073486,
FT                   3073769..3073903,3074003..3074080,3077539..3077637,
FT                   3078950..3079066,3080259..3080361,3082827..3082925,
FT                   3085163..3085264,3095087..3095168,3098672..3098733,
FT                   3103327..3103401,3107657..3107782,3110151..3110231,
FT                   3111515..3111655,3115641..3115901,3157770..>3158453))
FT                   /codon_start=1
FT                   /gene="Arhgap12"
FT                   /locus_tag="mCG_12659"
FT                   /product="Rho GTPase activating protein 12, isoform CRA_c"
FT                   /note="gene_id=mCG12659.1 transcript_id=mCT191811.0
FT                   protein_id=mCP112768.0 isoform=CRA_c"
FT                   /protein_id="EDL23038.1"
FT                   /translation="VEMAERSGKITAGQAYIEVEYDYEYDAKDRKIVIRQGERYLLVKK
FT                   TNDDWWQVRPDENSKAFYVPAQYVKEVTRKALMPPVKQATGLPNNSMKTIQSMHLQRST
FT                   ENVNKMPELSSFGKPSSSVQGTGLIRDANQNFGSNYNSGQTLNLSLDLTHNNGKFNSDS
FT                   HSPKVSSQNRTRLFGHFPGPEFLDIEKTSFSQEQSCDSAGEGSERIQQDSESGDELSSS
FT                   STEQMRATTPPNQGRPDSPVYANLQELKISQSALPPLPGSPAIQVNGEWETHKDSSGRC
FT                   YYYNRTTQERTWKPPRWARDVSTSRDFQSPGEQEPLSSEENYHSSCFSQSDSQCGSPPR
FT                   GWSEELDERGHTLYTSDYTKEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQRE
FT                   IIKSRSLDRRLQEPIVLTKWRHSTIVLDSNDKDSPTTTKLCLPENESPPTSSKHQDPGQ
FT                   EKYGLLNVTKITENGKKVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVD
FT                   LKGAVIEMASKDKSSKKNVFELKTRQGTELLIQSDNDAVINDWFKVLSSTINNQVAEAD
FT                   EAAEEETPDSPGVEKHDKEKDQKELKKLRSMKGSSMDSSEQKKTKKNLKKFLTRRPTLQ
FT                   AVREKGYIKDQVFGSNLANLCQRENGTVPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVI
FT                   QKLRFAVNHDEKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPR
FT                   QRVTAVKDLIRQLPKPNQDTMQILFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPERE
FT                   TGNIAVHTVYQNQIVELILLELSTVFGR"
FT   CDS             complement(join(3072365..3072539,3073384..3073486,
FT                   3073769..3073903,3074003..3074080,3077539..3077637,
FT                   3078950..3079066,3080259..3080361,3082827..3082925,
FT                   3085163..3085264,3095087..3095168,3098672..3098733,
FT                   3103327..3103401,3107657..3107782,3110151..3110231,
FT                   3111515..3111655,3115641..3115901,3157770..3158447))
FT                   /codon_start=1
FT                   /gene="Arhgap12"
FT                   /locus_tag="mCG_12659"
FT                   /product="Rho GTPase activating protein 12, isoform CRA_a"
FT                   /note="gene_id=mCG12659.1 transcript_id=mCT13568.2
FT                   protein_id=mCP23117.2 isoform=CRA_a"
FT                   /protein_id="EDL23036.1"
FT                   /translation="MAERSGKITAGQAYIEVEYDYEYDAKDRKIVIRQGERYLLVKKTN
FT                   DDWWQVRPDENSKAFYVPAQYVKEVTRKALMPPVKQATGLPNNSMKTIQSMHLQRSTEN
FT                   VNKMPELSSFGKPSSSVQGTGLIRDANQNFGSNYNSGQTLNLSLDLTHNNGKFNSDSHS
FT                   PKVSSQNRTRLFGHFPGPEFLDIEKTSFSQEQSCDSAGEGSERIQQDSESGDELSSSST
FT                   EQMRATTPPNQGRPDSPVYANLQELKISQSALPPLPGSPAIQVNGEWETHKDSSGRCYY
FT                   YNRTTQERTWKPPRWARDVSTSRDFQSPGEQEPLSSEENYHSSCFSQSDSQCGSPPRGW
FT                   SEELDERGHTLYTSDYTKEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREII
FT                   KSRSLDRRLQEPIVLTKWRHSTIVLDSNDKDSPTTTKLCLPENESPPTSSKHQDPGQEK
FT                   YGLLNVTKITENGKKVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLK
FT                   GAVIEMASKDKSSKKNVFELKTRQGTELLIQSDNDAVINDWFKVLSSTINNQVAEADEA
FT                   AEEETPDSPGVEKHDKEKDQKELKKLRSMKGSSMDSSEQKKTKKNLKKFLTRRPTLQAV
FT                   REKGYIKDQVFGSNLANLCQRENGTVPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVIQK
FT                   LRFAVNHDEKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQR
FT                   VTAVKDLIRQLPKPNQDTMQILFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPERETG
FT                   NIAVHTVYQNQIVELILLELSTVFGR"
FT   gene            complement(3074380..3076248)
FT                   /pseudo
FT                   /locus_tag="mCG_12658"
FT                   /note="gene_id=mCG12658.1"
FT   mRNA            complement(3074380..3076248)
FT                   /pseudo
FT                   /locus_tag="mCG_12658"
FT                   /note="gene_id=mCG12658.1 transcript_id=mCT13567.1 created
FT                   on 02-JUN-2002"
FT   gene            complement(3247912..3288910)
FT                   /gene="Kif5b"
FT                   /locus_tag="mCG_118617"
FT                   /note="gene_id=mCG118617.1"
FT   mRNA            complement(join(3247912..3250591,3255323..3255471,
FT                   3256136..3256352,3257836..3257940,3258160..3258231,
FT                   3258328..3258388,3259653..3259754,3260323..3260428,
FT                   3260525..3260590,3261106..3261223,3261648..3261836,
FT                   3263359..3263502,3263877..3264083,3267360..3267428,
FT                   3267938..3268131,3269855..3270003,3270682..3270827,
FT                   3271107..3271211,3272454..3272578,3272733..3272820,
FT                   3272904..3272959,3273518..3273566,3274000..3274104,
FT                   3274724..3274797,3281951..3282038,3288118..3288910))
FT                   /gene="Kif5b"
FT                   /locus_tag="mCG_118617"
FT                   /product="kinesin family member 5B"
FT                   /note="gene_id=mCG118617.1 transcript_id=mCT119774.1
FT                   created on 19-SEP-2002"
FT   CDS             complement(join(3255341..3255471,3256136..3256352,
FT                   3257836..3257940,3258160..3258231,3258328..3258388,
FT                   3259653..3259754,3260323..3260428,3260525..3260590,
FT                   3261106..3261223,3261648..3261836,3263359..3263502,
FT                   3263877..3264083,3267360..3267428,3267938..3268131,
FT                   3269855..3270003,3270682..3270827,3271107..3271211,
FT                   3272454..3272578,3272733..3272820,3272904..3272959,
FT                   3273518..3273566,3274000..3274104,3274724..3274797,
FT                   3281951..3282038,3288118..3288243))
FT                   /codon_start=1
FT                   /gene="Kif5b"
FT                   /locus_tag="mCG_118617"
FT                   /product="kinesin family member 5B"
FT                   /note="gene_id=mCG118617.1 transcript_id=mCT119774.1
FT                   protein_id=mCP69640.1"
FT                   /protein_id="EDL23035.1"
FT                   /translation="MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKP
FT                   YAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEG
FT                   MGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVP
FT                   YVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQK
FT                   LSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSK
FT                   MTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQW
FT                   KKKYEKEKEKNKTLRNTIQWLENELNRWRNGETVPIDEQFDKEKANLEAFTADKDIAIT
FT                   SDKPAAAVGMAGSFTDAERRKCEEELAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEE
FT                   LLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYE
FT                   LLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQ
FT                   PEGTGMIDEEFTVARLYISKMKSEVKTMVKRCKQLESTQTESNKKMEENEKELAACQLR
FT                   ISQHEAKIKSLTEYLQNVEQKKRQLEESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTA
FT                   NEVKATVEQQIQSHRETHQKQISSLRDEVEAKEKLITDLQDQNQKMVLEQERLRVEHER
FT                   LKATDQEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQTLHNLRKLFVQDLATRVK
FT                   KSAEVDSDDTGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATA
FT                   ERVKALESALKEAKENASRDRKRYQQEVDRIKEAVRSKNMARRGHSAQIAKPIRPGQHP
FT                   AASPTHPGTVRGGGSFVQNNQPVGLRGGGGKQS"
FT   gene            <3287948..3315584
FT                   /locus_tag="mCG_145996"
FT                   /note="gene_id=mCG145996.0"
FT   mRNA            join(<3287948..3288299,3314952..3315026,3315487..3315584)
FT                   /locus_tag="mCG_145996"
FT                   /product="mCG145996"
FT                   /note="gene_id=mCG145996.0 transcript_id=mCT186104.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<3287996..3288299,3314952..3315026,3315487..3315509)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145996"
FT                   /product="mCG145996"
FT                   /note="gene_id=mCG145996.0 transcript_id=mCT186104.0
FT                   protein_id=mCP107735.0"
FT                   /protein_id="EDL23034.1"
FT                   /translation="TRKPGSGERALPAPSGLCDRPCPRAHRPARPHVTWGQGPLTAIIT
FT                   VSSPWNLATYLSPRFTSDSLRGLKRHITLMLHSAGSAIFLEAGTAGRAPLQAAQSWGWG
FT                   RSWAAHVEVRGQLSEVNSLLLQSPASRSV"
FT   gene            3379892..3380365
FT                   /locus_tag="mCG_15532"
FT                   /note="gene_id=mCG15532.1"
FT   mRNA            3379892..3380365
FT                   /locus_tag="mCG_15532"
FT                   /product="mCG15532"
FT                   /note="gene_id=mCG15532.1 transcript_id=mCT17948.1 created
FT                   on 19-SEP-2002"
FT   CDS             3379933..3380343
FT                   /codon_start=1
FT                   /locus_tag="mCG_15532"
FT                   /product="mCG15532"
FT                   /note="gene_id=mCG15532.1 transcript_id=mCT17948.1
FT                   protein_id=mCP23101.1"
FT                   /db_xref="GOA:Q5BLJ9"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018262"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BLJ9"
FT                   /protein_id="EDL23033.1"
FT                   /translation="MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAG
FT                   IDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDP
FT                   ALKRKARREAKVKFEERYKTGKNKWFFQKLRF"
FT   gene            complement(3483186..3563509)
FT                   /gene="Epc1"
FT                   /locus_tag="mCG_15534"
FT                   /note="gene_id=mCG15534.1"
FT   mRNA            complement(join(3483186..3484540,3486825..3487188,
FT                   3487282..3487423,3488355..3488476,3496133..3496485,
FT                   3497297..3497445,3497525..3497614,3497694..3497867,
FT                   3499461..3499620,3500737..3500885,3501415..3501621,
FT                   3502417..3502562,3510059..3510218,3563287..3563509))
FT                   /gene="Epc1"
FT                   /locus_tag="mCG_15534"
FT                   /product="enhancer of polycomb homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG15534.1 transcript_id=mCT17950.1 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(3484468..3484540,3486825..3487188,
FT                   3487282..3487423,3488355..3488476,3496133..3496485,
FT                   3497297..3497445,3497525..3497614,3497694..3497867,
FT                   3499461..3499620,3500737..3500885,3501415..3501621,
FT                   3502417..3502562,3510059..3510218,3563287..3563289))
FT                   /codon_start=1
FT                   /gene="Epc1"
FT                   /locus_tag="mCG_15534"
FT                   /product="enhancer of polycomb homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG15534.1 transcript_id=mCT17950.1
FT                   protein_id=mCP23102.1"
FT                   /protein_id="EDL23031.1"
FT                   /translation="MEHHLQRAISAQQVYGEKRDNMVIPVPEAESNIAYYESIYPGEFR
FT                   MPKQLIHIQPFSLDAEQPDYDLDSEDEVFVNKLKKKMDICPLQFEEMIDRLEKGSGQQP
FT                   VSLQEAKLLLKEDDELIREVYEYWIKKRKTCRGSSLIPLVKQEKRDGSSTNDPYVAFRR
FT                   RTEKMQTRKNRKNDEASYEKMLKLRRDLSRAVTILEMIKRREKSKRELLHLTLEIMEKR
FT                   YNLGDYSGEIMSEVMAQRQPVKPTYAIPIIPITNSSQFKHQDATDSKEFKVNKQDKADL
FT                   IRPKRKYEKKPKVLPPSAAAPQQQSPAALPGFSAKDLNQYDFPSSDEEPLSQVLSGSSE
FT                   AEEENDPDGPFAFRRKAGCQYYAPHLDQTGNWPWTSPKDGGLGDVRYRYCLTTLTVPQR
FT                   CLGFARRRVGRGGRVVLDRAHSDYDSMFHHLDLDMLSSPQPSPVNQFANTSEPNTSDRS
FT                   SSKDLSQILVDIKSCRWRHFRPRTPSLPDSDSGELSSRKLHRSISRAGAAQPGAHTCST
FT                   STQNRSSSGSAHCAFTAEQYQQHQQQLALMQQQQLAQTQQQQQANSSSSAAAQQGFVSK
FT                   TLDSASAQFAASALMTSEQLLGFKVKDDVVLGLGVNGVLPASGVYKGLHLSSTTPTALV
FT                   HTSPSTAGSTLLQPSNITQTSGSHSSLSHQVTAASSATTQVLFGNNIRLTVPSSVPTVN
FT                   SVTPINARHIPRTLSAVPPSALKLAAAANCQVSKVPSSSSVDSVPRENHESEKPALNNI
FT                   ADNTVAMEVT"
FT   gene            complement(3536515..3538149)
FT                   /locus_tag="mCG_147788"
FT                   /note="gene_id=mCG147788.0"
FT   mRNA            complement(join(3536515..3536709,3537842..3538149))
FT                   /locus_tag="mCG_147788"
FT                   /product="mCG147788"
FT                   /note="gene_id=mCG147788.0 transcript_id=mCT188051.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(3536677..3536709,3537842..3537994))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147788"
FT                   /product="mCG147788"
FT                   /note="gene_id=mCG147788.0 transcript_id=mCT188051.0
FT                   protein_id=mCP108699.0"
FT                   /db_xref="GOA:Q6PBH3"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="InterPro:IPR024943"
FT                   /db_xref="MGI:MGI:1278322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PBH3"
FT                   /protein_id="EDL23032.1"
FT                   /translation="MSKLSFRARALDASKPLPVFRCEDLPDLHEYASINRAVPQMPTGM
FT                   EKEEESVQPLIQGAVC"
FT   gene            3666901..3686570
FT                   /locus_tag="mCG_15536"
FT                   /note="gene_id=mCG15536.1"
FT   mRNA            join(3666901..3667008,3667702..3667843,3671064..3671122,
FT                   3671552..3671651,3673921..3674129,3677084..3677294,
FT                   3677656..3677768,3683418..3683547,3686202..3686570)
FT                   /locus_tag="mCG_15536"
FT                   /product="mCG15536"
FT                   /note="gene_id=mCG15536.1 transcript_id=mCT17952.2 created
FT                   on 20-SEP-2002"
FT   CDS             join(3666977..3667008,3667702..3667843,3671064..3671122,
FT                   3671552..3671651,3673921..3674129,3677084..3677294,
FT                   3677656..3677768,3683418..3683547,3686202..3686522)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15536"
FT                   /product="mCG15536"
FT                   /note="gene_id=mCG15536.1 transcript_id=mCT17952.2
FT                   protein_id=mCP23111.2"
FT                   /db_xref="GOA:Q9D5T2"
FT                   /db_xref="InterPro:IPR021885"
FT                   /db_xref="MGI:MGI:1918151"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5T2"
FT                   /protein_id="EDL23030.1"
FT                   /translation="MNGTLSQSDVKFASQEEQLPFGNMESLRFERQRSPQKLDVTLTGI
FT                   CPWIETEAKTWNELRGSLAMLKAAKKMRCRIQRIELENSNLVVTIEKQAREMKALGEKL
FT                   LNTGISVVEAAPEGEPGATREDVAASWSQMELMELTSELAKARMQNDSCKMEVQKYKEL
FT                   YLKELRSNNALLSRLQNRTCKCPEQSCSNHGEEMRWKTSSMVALVGPHPECPQVPYLTR
FT                   STMEPQGNVPQPSQCPEARCEFMENPRSWSEDKEKGWLELISSIRFLHCALHQETRRTK
FT                   ELQKELAEMKKIFNMPPQEGRGHEGRRHSCREVSKVSQAEMGVPVAMLRLEGEATTAEN
FT                   LVCIHKTPTASFLTQMELEMKSIKSAIAEVSTQECLVKRELEVMKHLYRGELEHIDSVS
FT                   AIGSEYVNGERGGTEREPGPFYKSRASENPAHDSRRLQK"
FT   gene            3779618..3834554
FT                   /gene="Rab18"
FT                   /locus_tag="mCG_15535"
FT                   /note="gene_id=mCG15535.2"
FT   mRNA            join(3779618..3779861,3815781..3815836,3824220..3824281,
FT                   3828845..3828917,3830295..3830413,3830664..3830730,
FT                   3834205..3834554)
FT                   /gene="Rab18"
FT                   /locus_tag="mCG_15535"
FT                   /product="RAB18, member RAS oncogene family, transcript
FT                   variant mCT173383"
FT                   /note="gene_id=mCG15535.2 transcript_id=mCT173383.0 created
FT                   on 16-SEP-2002"
FT   gene            complement(3805814..3806683)
FT                   /pseudo
FT                   /locus_tag="mCG_15531"
FT                   /note="gene_id=mCG15531.2"
FT   mRNA            complement(3805814..3806683)
FT                   /pseudo
FT                   /locus_tag="mCG_15531"
FT                   /note="gene_id=mCG15531.2 transcript_id=mCT17947.2 created
FT                   on 20-MAR-2003"
FT   mRNA            join(3810872..3811059,3815781..3815836,3824220..3824281,
FT                   3828845..3828917,3830295..3830413,3830664..3830730,
FT                   3834205..3834554)
FT                   /gene="Rab18"
FT                   /locus_tag="mCG_15535"
FT                   /product="RAB18, member RAS oncogene family, transcript
FT                   variant mCT17951"
FT                   /note="gene_id=mCG15535.2 transcript_id=mCT17951.1 created
FT                   on 16-SEP-2002"
FT   CDS             join(3810992..3811059,3815781..3815836,3824220..3824281,
FT                   3828845..3828917,3830295..3830413,3830664..3830730,
FT                   3834205..3834380)
FT                   /codon_start=1
FT                   /gene="Rab18"
FT                   /locus_tag="mCG_15535"
FT                   /product="RAB18, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG15535.2 transcript_id=mCT17951.1
FT                   protein_id=mCP23103.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q0PD38"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:102790"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD38"
FT                   /protein_id="EDL23028.1"
FT                   /translation="MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDF
FT                   KVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLN
FT                   ELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFE
FT                   ELVEKIIQTPGLWESENQNKGVKLSHREESRGGGACGGYCSVL"
FT   CDS             join(3830387..3830413,3830664..3830730,3834205..3834380)
FT                   /codon_start=1
FT                   /gene="Rab18"
FT                   /locus_tag="mCG_15535"
FT                   /product="RAB18, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG15535.2 transcript_id=mCT173383.0
FT                   protein_id=mCP96302.0 isoform=CRA_b"
FT                   /protein_id="EDL23029.1"
FT                   /translation="MLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAF
FT                   EELVEKIIQTPGLWESENQNKGVKLSHREESRGGGACGGYCSVL"
FT   gene            complement(3980428..>4049729)
FT                   /gene="Mkx"
FT                   /locus_tag="mCG_144718"
FT                   /note="gene_id=mCG144718.0"
FT   mRNA            complement(join(3980428..3982482,3982596..3982629,
FT                   4037015..4037350,4037755..4037911,4045570..4045729,
FT                   4047334..4047600,4049593..>4049729))
FT                   /gene="Mkx"
FT                   /locus_tag="mCG_144718"
FT                   /product="mohawk"
FT                   /note="gene_id=mCG144718.0 transcript_id=mCT184142.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3982293..3982482,3982596..3982629,
FT                   4037015..4037350,4037755..4037911,4045570..4045729,
FT                   4047334..4047600,4049593..>4049729))
FT                   /codon_start=1
FT                   /gene="Mkx"
FT                   /locus_tag="mCG_144718"
FT                   /product="mohawk"
FT                   /note="gene_id=mCG144718.0 transcript_id=mCT184142.0
FT                   protein_id=mCP106199.0"
FT                   /protein_id="EDL23027.1"
FT                   /translation="VNKAETTPVAPVNASEPEPRTCGGDGSVPSPETGVSAAGCRFRGH
FT                   RTRALLRSSWWTPRLCRKAARPCQPPIMNTIVFNKLGGAVLFEDRGTPDRERGSRTFSG
FT                   FLDNPHTGPEVGIPDGPPLKDNLSLRHRRTGARQNGGKVRHKRQALQDMARPLKQWLYK
FT                   HRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQPDLSWALRIKLYNKYV
FT                   QGNAERLSVSSDGDSCSEDGENPPRNHMNEEGYSTPAHHTVIKGESSAIKAGGRPESRA
FT                   AEDYVSPPKYKSSLLNRYLNDSLRHVMATSTAMMGKTRRRNHSGSFSSNEFEEELVSPS
FT                   SSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYWKEINAAMALTNLAQGKDEVQG
FT                   TTTSCIIQKSSHIAEVKTVKLPLVQRF"
FT   gene            complement(4133779..4343830)
FT                   /locus_tag="mCG_119484"
FT                   /note="gene_id=mCG119484.0"
FT   mRNA            complement(join(4133779..4134112,4173022..4173243,
FT                   4175209..4175397,4227511..4227625,4257174..4257416,
FT                   4260344..4260498,4262710..4262820,4263523..4263765,
FT                   4268321..4268530,4269305..4269451,4310928..4311075,
FT                   4312810..4312908,4314327..4314514,4319086..4319202,
FT                   4331239..4331375,4331578..4331684,4332553..4332739,
FT                   4334376..4334533,4340280..4340516,4342841..4342947,
FT                   4343798..4343830))
FT                   /locus_tag="mCG_119484"
FT                   /product="mCG119484"
FT                   /note="gene_id=mCG119484.0 transcript_id=mCT120658.0
FT                   created on 19-SEP-2002"
FT   CDS             complement(join(4133999..4134112,4173022..4173243,
FT                   4175209..4175397,4227511..4227625,4257174..4257416,
FT                   4260344..4260498,4262710..4262820,4263523..4263765,
FT                   4268321..4268530,4269305..4269451,4310928..4311075,
FT                   4312810..4312908,4314327..4314514,4319086..4319202,
FT                   4331239..4331375,4331578..4331684,4332553..4332739,
FT                   4334376..4334533,4340280..4340503))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119484"
FT                   /product="mCG119484"
FT                   /note="gene_id=mCG119484.0 transcript_id=mCT120658.0
FT                   protein_id=mCP69571.1"
FT                   /db_xref="GOA:B2RY50"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR026959"
FT                   /db_xref="MGI:MGI:1922184"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2RY50"
FT                   /protein_id="EDL23026.1"
FT                   /translation="MGVALTRLAQWTAAGYETGTLEITPLNESILNEITKFVESFSYKY
FT                   PQEAKFVFVEPLEWKTYLEPSAFELGYVVSATTAESEETGKDGQPLLFLSVPYIKVRSF
FT                   GQLSQLLSIATDSKLQEAQACIEANRDPVVKILGPDYNEMKEDPTRLTLLDTIIKDKET
FT                   YMKRKVAILLKQLDLHLLNHSLKYISLEISLNPGTFKKDIELLKRFSGKGEQTVLESIE
FT                   YTSDYEFSNGCRAPPWRQIQGEICYVLVKPHDMETLCLTCSTEGVFLNGGKTEEEGEIN
FT                   YERKGEIYKDLVTCLKDKSPVFSENMSKHEIRFTEEQQKDNQIFEKPKTEDGHSSVAGS
FT                   EKSKIEKISFGKSPMTKRLEPSLNWRVTVDYKDHKSSIKDSQEEKQGKLEKSSSVSVAP
FT                   SRAQSHRKGGEKVEETVSESSSESEEDEEPPDHRQEANADLPSEYWQIQKLVKYLKGGN
FT                   QTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHN
FT                   PQIRRNIVDLGGLPIMVNILDSPHKSLKCLSAETIANVAKFKRARRAVRQHGGITKLVA
FT                   LLDCGQNSTEPTQPSLYETRDVEVARCGALALWSCSKSHSNKEAIRKAGGIPLLARLLK
FT                   TSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCA
FT                   EDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVIKFREYKAIET
FT                   LVGLLTDQPEEVLVNVVGALGECCQEYENRVLVRKCGGIQPLVNLLVGINQALLVNVTK
FT                   AVGACAVEPESMAIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIENAKDAGEMVRS
FT                   FVGGLELVVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNDK
FT                   LRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADN
FT                   CITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKARYN"
FT   gene            complement(4393503..>4674355)
FT                   /locus_tag="mCG_5292"
FT                   /note="gene_id=mCG5292.3"
FT   mRNA            complement(join(4393503..4396683,4398693..4398836,
FT                   4400557..4400665,4401681..4401774,4425306..4425386,
FT                   4449683..4449853,4486107..4486171,4486621..4486817,
FT                   4486970..4487044,4488091..4488176,4489331..4489412,
FT                   4490512..4490643,4505470..4505550,4508176..4508253,
FT                   4559481..4559599,4608647..4608793,4674221..4674323))
FT                   /locus_tag="mCG_5292"
FT                   /product="mCG5292, transcript variant mCT4544"
FT                   /note="gene_id=mCG5292.3 transcript_id=mCT4544.2 created on
FT                   19-SEP-2002"
FT   CDS             complement(join(4396504..4396683,4398693..4398836,
FT                   4400557..4400665,4401681..4401774,4425306..4425386,
FT                   4449683..4449853,4486107..4486171,4486621..4486817,
FT                   4486970..4487044,4488091..4488176,4489331..4489412,
FT                   4490512..4490643,4505470..4505550,4508176..4508253,
FT                   4559481..4559599,4608647..4608683))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5292"
FT                   /product="mCG5292, isoform CRA_d"
FT                   /note="gene_id=mCG5292.3 transcript_id=mCT4544.2
FT                   protein_id=mCP23099.2 isoform=CRA_d"
FT                   /db_xref="GOA:G5E8S8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004172"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR014775"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1922989"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8S8"
FT                   /protein_id="EDL23024.1"
FT                   /translation="MPALATGSACDMGLYELLAALPAQLQPHVDSQEDLTFLWDVFGEK
FT                   SLHSLVKIHEKLHCYEKQNPLPILHGAAALADDLTEELQNKLPNSEIRELLKLLSKPNV
FT                   KALLSVHDTVAQKSYDPVLPPVPDDIDDEEDSVKIIRLVKNSEPLGATIKKDEQTGAIT
FT                   VARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIKILSQSKGAITFKIIPSTKE
FT                   ETPSKEGKIFIKALFDYDPKEDKAIPCKEAGLSFRKGDILQIMSQDDVTWWQAKHEGDA
FT                   NPRAGLIPSKHFQERRLALRRPEIVVQPLKLSNTKSSGFRRSFRLSRKNKKINKSMYEC
FT                   KKSEQYDTADVPTYEEVTPYRRQIHDKYRLIVLVGPVGVGLNELKRKLLMSDAQHYGVI
FT                   VPHTTRARRSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAK
FT                   NKVCLLDVQPHTVKHLRTLEFKPYVIFIKPPSIERLRETRKNAKIISSRDDQGTAKPFT
FT                   EEDFQEMIKSAQIMESQYGHLFDKIIINDDLTVAFNELKTTFDKLETDTHWVPVSWLHS
FT                   "
FT   mRNA            complement(join(4424966..4425386,4449683..4449853,
FT                   4486107..4486171,4486621..4486817,4486970..4487044,
FT                   4488091..4488176,4489331..4489412,4490512..4490643,
FT                   4505470..4505550,4508176..4508253,4559481..4559599,
FT                   4608647..4608793,4674225..>4674355))
FT                   /locus_tag="mCG_5292"
FT                   /product="mCG5292, transcript variant mCT191817"
FT                   /note="gene_id=mCG5292.3 transcript_id=mCT191817.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4425226..4425386,4449683..4449853,
FT                   4486107..4486171,4486621..4486817,4486970..4487044,
FT                   4488091..4488176,4489331..4489412,4490512..4490643,
FT                   4505470..4505550,4508176..4508253,4559481..4559599,
FT                   4608647..>4608725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5292"
FT                   /product="mCG5292, isoform CRA_c"
FT                   /note="gene_id=mCG5292.3 transcript_id=mCT191817.0
FT                   protein_id=mCP112777.0 isoform=CRA_c"
FT                   /protein_id="EDL23023.1"
FT                   /translation="DKRVEGGHISAACIMPALATGSACDMGLYELLAALPAQLQPHVDS
FT                   QEDLTFLWDVFGEKSLHSLVKIHEKLHCYEKQNPLPILHGAAALADDLTEELQNKLPNS
FT                   EIRELLKLLSKPNVKALLSVHDTVAQKSYDPVLPPVPDDIDDEEDSVKIIRLVKNSEPL
FT                   GATIKKDEQTGAITVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIKILSQS
FT                   KGAITFKIIPSTKEETPSKEGKIFIKALFDYDPKEDKAIPCKEAGLSFRKGDILQIMSQ
FT                   DDVTWWQAKHEGDANPRAGLIPSKHFQERRLALRRPEIVVQPLKLSNTKSSGFRRSFRL
FT                   SRKNKKINKSMYECKKSEQYDTADVPTYEEVTPYRRQIHDKYRLIVLVGPVGVGLNELK
FT                   RKLLMSDAQHYGVIVPREFSGPWWFSEDISKLSEQLKKLTLC"
FT   mRNA            complement(join(4445640..4447935,4449683..4449853,
FT                   4486107..4486171,4486621..4486817,4486970..4487044,
FT                   4488091..4488176,4489331..4489412,4490512..4490643,
FT                   4505470..4505550,4508176..4508253,4559481..4559599,
FT                   4608647..4608793,4674221..>4674322))
FT                   /locus_tag="mCG_5292"
FT                   /product="mCG5292, transcript variant mCT191816"
FT                   /note="gene_id=mCG5292.3 transcript_id=mCT191816.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(4447880..4447935,4449683..4449853,
FT                   4486107..4486171,4486621..4486817,4486970..4487044,
FT                   4488091..4488176,4489331..4489412,4490512..4490643,
FT                   4505470..4505550,4508176..4508253,4559481..4559599,
FT                   4608647..>4608725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5292"
FT                   /product="mCG5292, isoform CRA_b"
FT                   /note="gene_id=mCG5292.3 transcript_id=mCT191816.0
FT                   protein_id=mCP112776.0 isoform=CRA_b"
FT                   /protein_id="EDL23022.1"
FT                   /translation="DKRVEGGHISAACIMPALATGSACDMGLYELLAALPAQLQPHVDS
FT                   QEDLTFLWDVFGEKSLHSLVKIHEKLHCYEKQNPLPILHGAAALADDLTEELQNKLPNS
FT                   EIRELLKLLSKPNVKALLSVHDTVAQKSYDPVLPPVPDDIDDEEDSVKIIRLVKNSEPL
FT                   GATIKKDEQTGAITVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIKILSQS
FT                   KGAITFKIIPSTKEETPSKEGKIFIKALFDYDPKEDKAIPCKEAGLSFRKGDILQIMSQ
FT                   DDVTWWQAKHEGDANPRAGLIPSKHFQERRLALRRPEIVVQPLKLSNTKSSGFRRSFRL
FT                   SRKNKKINKSMYECKKSEQYDTADVPTYEEVTPYRRQIHDKYRLIVLVALSTRRVAQVE
FT                   NLTSALR"
FT   mRNA            complement(join(4482611..4483961,4484479..4484570,
FT                   4486107..4486171,4486621..4486817,4486970..4487044,
FT                   4488091..4488176,4489331..4489412,4490512..4490643,
FT                   4505470..4505550,4508176..4508253,4559481..4559599,
FT                   4608647..4608793,4619562..4619749,4651308..4651417,
FT                   4654732..4654859))
FT                   /locus_tag="mCG_5292"
FT                   /product="mCG5292, transcript variant mCT171390"
FT                   /note="gene_id=mCG5292.3 transcript_id=mCT171390.0 created
FT                   on 19-SEP-2002"
FT   CDS             complement(join(4484557..4484570,4486107..4486171,
FT                   4486621..4486817,4486970..4487044,4488091..4488176,
FT                   4489331..4489412,4490512..4490643,4505470..4505550,
FT                   4508176..4508253,4559481..4559599,4608647..4608683))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5292"
FT                   /product="mCG5292, isoform CRA_a"
FT                   /note="gene_id=mCG5292.3 transcript_id=mCT171390.0
FT                   protein_id=mCP94309.0 isoform=CRA_a"
FT                   /protein_id="EDL23021.1"
FT                   /translation="MPALATGSACDMGLYELLAALPAQLQPHVDSQEDLTFLWDVFGEK
FT                   SLHSLVKIHEKLHCYEKQNPLPILHGAAALADDLTEELQNKLPNSEIRELLKLLSKPNV
FT                   KALLSVHDTVAQKSYDPVLPPVPDDIDDEEDSVKIIRLVKNSEPLGATIKKDEQTGAIT
FT                   VARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIKILSQSKGAITFKIIPSTKE
FT                   ETPSKEGKIFIKALFDYDPKEDKAIPCKEAGLSFRKGDILQIMSQDDVTWWQAKHEGDA
FT                   NPRAGLIPSKHFQERRLALRRPEIVVQPLKLSNTKSFPFT"
FT   gene            4628403..4629062
FT                   /locus_tag="mCG_5289"
FT                   /note="gene_id=mCG5289.0"
FT   mRNA            4628403..4629062
FT                   /locus_tag="mCG_5289"
FT                   /product="mCG5289"
FT                   /note="gene_id=mCG5289.0 transcript_id=mCT4542.0 created on
FT                   10-JUN-2002"
FT   CDS             4628437..4628844
FT                   /codon_start=1
FT                   /locus_tag="mCG_5289"
FT                   /product="mCG5289"
FT                   /note="gene_id=mCG5289.0 transcript_id=mCT4542.0
FT                   protein_id=mCP23106.1"
FT                   /protein_id="EDL23025.1"
FT                   /translation="MASLKDLEGKWRLLESHSFEEYMKELGVGLALRKMAAMAKSDCII
FT                   ICDGNNITFKTESTVKTTVFSCTLGEKFDETTADGRKTETVCTFQDGALIQHQQWEGKE
FT                   STVTGNLKDAKMTVERVTNNATCTRLYEKVQ"
FT   gene            complement(4915105..>4916191)
FT                   /locus_tag="mCG_1031532"
FT                   /note="gene_id=mCG1031532.1"
FT   mRNA            complement(join(4915105..4915828,4915897..>4916191))
FT                   /locus_tag="mCG_1031532"
FT                   /product="mCG1031532"
FT                   /note="gene_id=mCG1031532.1 transcript_id=mCT149236.1
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(4915672..4915828,4915897..>4916189))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031532"
FT                   /product="mCG1031532"
FT                   /note="gene_id=mCG1031532.1 transcript_id=mCT149236.1
FT                   protein_id=mCP69600.1"
FT                   /protein_id="EDL23020.1"
FT                   /translation="RTPPSTNLGSLPPSSSSAAWAPRPATRQALPVAAFLARESGHSRS
FT                   TLGVIVLRSLREASPGASGLRRVGATFGKRTVGREGRHLGLNAERRELRVRPEKAHNWS
FT                   ARTVVAEPRRAATEVTLGGPGEPRTAAGAATQQRRPRACGIGHGT"
FT   gene            4915909..4974680
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /note="gene_id=mCG119388.1"
FT   mRNA            join(4915909..4916168,4917154..4917190,4918712..4918907,
FT                   4948658..4948764,4952562..4952677,4953094..4953206,
FT                   4957678..4957986,4963214..4963459,4964715..4964837,
FT                   4965595..4965743,4967294..4967412,4968584..4968770,
FT                   4969018..4969145,4973232..4974680)
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   transcript variant mCT173369"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT173369.0
FT                   created on 19-SEP-2002"
FT   mRNA            join(<4915938..4916168,4917154..4917190,4918712..4918907,
FT                   4948658..4948764,4952562..4952677,4953094..4953206,
FT                   4963214..4963459,4964727..4964837,4965595..4965743,
FT                   4967294..4967412,4968584..4968770,4969018..4969145,
FT                   4973232..4973652)
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   transcript variant mCT191820"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT191820.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<4916110..4916168,4917154..4917190,4918712..4918907,
FT                   4948658..4948764,4952562..4952677,4953094..4953206,
FT                   4963214..4963459,4964727..4964837,4965595..4965743,
FT                   4967294..4967412,4968584..4968770,4969018..4969145,
FT                   4973232..4973301)
FT                   /codon_start=1
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT191820.0
FT                   protein_id=mCP112766.0 isoform=CRA_b"
FT                   /protein_id="EDL23017.1"
FT                   /translation="RVAGRGAQAAEEEEGGSEPSCHDRRGDSQPFQALKYSSKSHPSSG
FT                   DHRHEKMRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERDGGTSYSPQ
FT                   ENSHNHSALHSSNSHSSNPSNNPSKTSDAPYDSADDWSEHISSSGKKYYYNCRTEVSQW
FT                   EKPKEWLEREQRQKEANKLAVNSFPKDRDYRREVMQATATSGFTSGKSAPGDKSISHSC
FT                   TTPSTSSASGLNPTSAPPTSASAVPVSPVPQSTIPPLLQDPNLFRQLLPALQATLQLNN
FT                   SNVDISKINEAVTQASLQSIIHKFLTAGPSAFNITSLISQAAQLSTQAQPSNQSPMSLT
FT                   SDASSPRSYVSPRISTPQTNTVPMKPLISTPPVSSQPKVSTPVVKQGPVSHSATQQPVT
FT                   ADKQQSHDPVSPRSLQRLSSQRSPSPGPNHTCSSNASTATVVPQNASARPACSLTPTLA
FT                   AHFNDNLIKHVQGWPADHAEKQASRLREEAHNMGSVHMSEICTELKNLRSLVRVCEIQA
FT                   TLREQRILFLRQQIKELEKLKNQNSFMV"
FT   mRNA            join(4916316..4916459,4916661..4916778,4917154..4917190,
FT                   4918712..4918907,4948658..4948764,4952562..4952677,
FT                   4953094..4953206,4957678..4957986,4963214..4963459,
FT                   4964715..4964837,4965595..4965743,4967294..4967412,
FT                   4968584..4968770,4969018..4969145,4973232..4974680)
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   transcript variant mCT120562"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT120562.1
FT                   created on 19-SEP-2002"
FT   mRNA            join(4916661..4916740,4917154..4917190,4918712..4918907,
FT                   4948658..4948764,4952562..4952677,4953094..4953206,
FT                   4957678..4957986,4963214..4963459,4964715..4964837,
FT                   4965595..4965743,4967294..4967412,4968584..4968770,
FT                   4969018..4969145,4973232..4973652)
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   transcript variant mCT173371"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT173371.0
FT                   created on 19-SEP-2002"
FT   CDS             join(4916738..4916778,4917154..4917190,4918712..4918907,
FT                   4948658..4948764,4952562..4952677,4953094..4953206,
FT                   4957678..4957986,4963214..4963459,4964715..4964837,
FT                   4965595..4965743,4967294..4967412,4968584..4968770,
FT                   4969018..4969145,4973232..4973301)
FT                   /codon_start=1
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT120562.1
FT                   protein_id=mCP69607.1 isoform=CRA_c"
FT                   /protein_id="EDL23018.1"
FT                   /translation="MVMYARKQQRLSDGCHDRRGDSQPFQALKYSSKSHPSSGDHRHEK
FT                   MRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERDGGTSYSPQENSHNH
FT                   SALHSSNSHSSNPSNNPSKTSDAPYDSADDWSEHISSSGKKYYYNCRTEVSQWEKPKEW
FT                   LEREQRQKEANKLAVNSFPKDRDYRREVMQATATSGFTSGMEDKHSSDASSLLPQNILS
FT                   QTSRHNDKDYRLPRAETHSSSTPVQHPIKPVVHPTATPSTVPSSPFTLQSDHQPKKSFD
FT                   ANGASTLSKLPTPTASLPAQKTERKESAPGDKSISHSCTTPSTSSASGLNPTSAPPTSA
FT                   SAVPVSPVPQSTIPPLLQDPNLFRQLLPALQATLQLNNSNVDISKINEVLTAAVTQASL
FT                   QSIIHKFLTAGPSAFNITSLISQAAQLSTQAQPSNQSPMSLTSDASSPRSYVSPRISTP
FT                   QTNTVPMKPLISTPPVSSQPKVSTPVVKQGPVSHSATQQPVTADKQQSHDPVSPRSLQR
FT                   LSSQRSPSPGPNHTCSSNASTATVVPQNASARPACSLTPTLAAHFNDNLIKHVQGWPAD
FT                   HAEKQASRLREEAHNMGSVHMSEICTELKNLRSLVRVCEIQATLREQRILFLRQQIKEL
FT                   EKLKNQNSFMV"
FT   mRNA            join(4916900..4917190,4918712..4918907,4948658..4948764,
FT                   4952562..4952677,4953094..4953206,4957678..4957986,
FT                   4963214..4963459,4964715..4964837,4965595..4965743,
FT                   4967294..4967412,4968584..4968770,4969018..4969145,
FT                   4973232..4973652)
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   transcript variant mCT173370"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT173370.0
FT                   created on 19-SEP-2002"
FT   CDS             join(4918769..4918907,4948658..4948764,4952562..4952677,
FT                   4953094..4953206,4957678..4957986,4963214..4963459,
FT                   4964715..4964837,4965595..4965743,4967294..4967412,
FT                   4968584..4968770,4969018..4969145,4973232..4973301)
FT                   /codon_start=1
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT173369.0
FT                   protein_id=mCP96290.0 isoform=CRA_a"
FT                   /protein_id="EDL23015.1"
FT                   /translation="MRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERD
FT                   GGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTSDAPYDSADDWSEHISSSGKKYYYN
FT                   CRTEVSQWEKPKEWLEREQRQKEANKLAVNSFPKDRDYRREVMQATATSGFTSGMEDKH
FT                   SSDASSLLPQNILSQTSRHNDKDYRLPRAETHSSSTPVQHPIKPVVHPTATPSTVPSSP
FT                   FTLQSDHQPKKSFDANGASTLSKLPTPTASLPAQKTERKESAPGDKSISHSCTTPSTSS
FT                   ASGLNPTSAPPTSASAVPVSPVPQSTIPPLLQDPNLFRQLLPALQATLQLNNSNVDISK
FT                   INEVLTAAVTQASLQSIIHKFLTAGPSAFNITSLISQAAQLSTQAQPSNQSPMSLTSDA
FT                   SSPRSYVSPRISTPQTNTVPMKPLISTPPVSSQPKVSTPVVKQGPVSHSATQQPVTADK
FT                   QQSHDPVSPRSLQRLSSQRSPSPGPNHTCSSNASTATVVPQNASARPACSLTPTLAAHF
FT                   NDNLIKHVQGWPADHAEKQASRLREEAHNMGSVHMSEICTELKNLRSLVRVCEIQATLR
FT                   EQRILFLRQQIKELEKLKNQNSFMV"
FT   CDS             join(4918769..4918907,4948658..4948764,4952562..4952677,
FT                   4953094..4953206,4957678..4957986,4963214..4963459,
FT                   4964715..4964837,4965595..4965743,4967294..4967412,
FT                   4968584..4968770,4969018..4969145,4973232..4973301)
FT                   /codon_start=1
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT173371.0
FT                   protein_id=mCP96289.0 isoform=CRA_a"
FT                   /protein_id="EDL23016.1"
FT                   /translation="MRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERD
FT                   GGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTSDAPYDSADDWSEHISSSGKKYYYN
FT                   CRTEVSQWEKPKEWLEREQRQKEANKLAVNSFPKDRDYRREVMQATATSGFTSGMEDKH
FT                   SSDASSLLPQNILSQTSRHNDKDYRLPRAETHSSSTPVQHPIKPVVHPTATPSTVPSSP
FT                   FTLQSDHQPKKSFDANGASTLSKLPTPTASLPAQKTERKESAPGDKSISHSCTTPSTSS
FT                   ASGLNPTSAPPTSASAVPVSPVPQSTIPPLLQDPNLFRQLLPALQATLQLNNSNVDISK
FT                   INEVLTAAVTQASLQSIIHKFLTAGPSAFNITSLISQAAQLSTQAQPSNQSPMSLTSDA
FT                   SSPRSYVSPRISTPQTNTVPMKPLISTPPVSSQPKVSTPVVKQGPVSHSATQQPVTADK
FT                   QQSHDPVSPRSLQRLSSQRSPSPGPNHTCSSNASTATVVPQNASARPACSLTPTLAAHF
FT                   NDNLIKHVQGWPADHAEKQASRLREEAHNMGSVHMSEICTELKNLRSLVRVCEIQATLR
FT                   EQRILFLRQQIKELEKLKNQNSFMV"
FT   CDS             join(4918769..4918907,4948658..4948764,4952562..4952677,
FT                   4953094..4953206,4957678..4957986,4963214..4963459,
FT                   4964715..4964837,4965595..4965743,4967294..4967412,
FT                   4968584..4968770,4969018..4969145,4973232..4973301)
FT                   /codon_start=1
FT                   /gene="Wac"
FT                   /locus_tag="mCG_119388"
FT                   /product="WW domain containing adaptor with coiled-coil,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG119388.1 transcript_id=mCT173370.0
FT                   protein_id=mCP96288.0 isoform=CRA_a"
FT                   /protein_id="EDL23019.1"
FT                   /translation="MRDAADPSPPNKMLRRSNSPENKYSDSTGHNKAKNVHTQRVRERD
FT                   GGTSYSPQENSHNHSALHSSNSHSSNPSNNPSKTSDAPYDSADDWSEHISSSGKKYYYN
FT                   CRTEVSQWEKPKEWLEREQRQKEANKLAVNSFPKDRDYRREVMQATATSGFTSGMEDKH
FT                   SSDASSLLPQNILSQTSRHNDKDYRLPRAETHSSSTPVQHPIKPVVHPTATPSTVPSSP
FT                   FTLQSDHQPKKSFDANGASTLSKLPTPTASLPAQKTERKESAPGDKSISHSCTTPSTSS
FT                   ASGLNPTSAPPTSASAVPVSPVPQSTIPPLLQDPNLFRQLLPALQATLQLNNSNVDISK
FT                   INEVLTAAVTQASLQSIIHKFLTAGPSAFNITSLISQAAQLSTQAQPSNQSPMSLTSDA
FT                   SSPRSYVSPRISTPQTNTVPMKPLISTPPVSSQPKVSTPVVKQGPVSHSATQQPVTADK
FT                   QQSHDPVSPRSLQRLSSQRSPSPGPNHTCSSNASTATVVPQNASARPACSLTPTLAAHF
FT                   NDNLIKHVQGWPADHAEKQASRLREEAHNMGSVHMSEICTELKNLRSLVRVCEIQATLR
FT                   EQRILFLRQQIKELEKLKNQNSFMV"
FT   gene            5098105..5098990
FT                   /locus_tag="mCG_3585"
FT                   /note="gene_id=mCG3585.0"
FT   mRNA            5098105..5098990
FT                   /locus_tag="mCG_3585"
FT                   /product="mCG3585"
FT                   /note="gene_id=mCG3585.0 transcript_id=mCT3149.0 created on
FT                   10-JUN-2002"
FT   CDS             5098111..5098584
FT                   /codon_start=1
FT                   /locus_tag="mCG_3585"
FT                   /product="mCG3585"
FT                   /note="gene_id=mCG3585.0 transcript_id=mCT3149.0
FT                   protein_id=mCP2577.1"
FT                   /protein_id="EDL23014.1"
FT                   /translation="MAPGPKKHLKHVSAPKHWMLDKLTGVFAPRPSTGPHKLRECLPPI
FT                   IFLRNRLKYALTGDEVKEICMQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYD
FT                   TKGRFAVHRITPEEAKYKLCKVRKIFVGTKGILHLVTHMMLVLFDTLFPHQGE"
FT   gene            complement(5270685..5271790)
FT                   /pseudo
FT                   /locus_tag="mCG_3589"
FT                   /note="gene_id=mCG3589.2"
FT   mRNA            complement(5270685..5271790)
FT                   /pseudo
FT                   /locus_tag="mCG_3589"
FT                   /note="gene_id=mCG3589.2 transcript_id=mCT3142.2 created on
FT                   10-JUN-2002"
FT   gene            5458360..>5459287
FT                   /locus_tag="mCG_14526"
FT                   /note="gene_id=mCG14526.0"
FT   mRNA            5458360..>5459287
FT                   /locus_tag="mCG_14526"
FT                   /product="mCG14526"
FT                   /note="gene_id=mCG14526.0 transcript_id=mCT18228.0 created
FT                   on 10-JUN-2002"
FT   CDS             5458532..5459287
FT                   /codon_start=1
FT                   /locus_tag="mCG_14526"
FT                   /product="mCG14526"
FT                   /note="gene_id=mCG14526.0 transcript_id=mCT18228.0
FT                   protein_id=mCP22541.1"
FT                   /protein_id="EDL23013.1"
FT                   /translation="MAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRPREGAA
FT                   RPTLPSAQMSSHLGATLPIGQHAAGDHEVRKQMLPPPRCPGRELFDDPSYVNIQNLDKA
FT                   RQAGGGAGPPNPSLNGSAPRDLFDMKPFEDTLRVPSPLQSMFMAEQLQGEPWFHGKLSR
FT                   REAKALLQLNGDFLVRESTTTPGQYVLTDLQSGQPKHLLLVDPEGVVRTKDHCFESVSH
FT                   LISYHMDNHLPIISAGSELCLQQPVDRKV"
FT   gene            6252569..6256094
FT                   /gene="Fzd8"
FT                   /locus_tag="mCG_14527"
FT                   /note="gene_id=mCG14527.2"
FT   mRNA            6252569..6256094
FT                   /gene="Fzd8"
FT                   /locus_tag="mCG_14527"
FT                   /product="frizzled homolog 8 (Drosophila)"
FT                   /note="gene_id=mCG14527.2 transcript_id=mCT18229.2 created
FT                   on 16-SEP-2002"
FT   CDS             6253327..6255384
FT                   /codon_start=1
FT                   /gene="Fzd8"
FT                   /locus_tag="mCG_14527"
FT                   /product="frizzled homolog 8 (Drosophila)"
FT                   /note="gene_id=mCG14527.2 transcript_id=mCT18229.2
FT                   protein_id=mCP22542.1"
FT                   /db_xref="GOA:Q61091"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:108460"
FT                   /db_xref="PDB:1IJY"
FT                   /db_xref="PDB:4F0A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61091"
FT                   /protein_id="EDL23012.1"
FT                   /translation="MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKG
FT                   IGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPL
FT                   PPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSP
FT                   PRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGA
FT                   APCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLW
FT                   SVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGG
FT                   APGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFL
FT                   LVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALS
FT                   SVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGG
FT                   PTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQA
FT                   RRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSG
FT                   PGGSGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV"
FT   gene            complement(6314430..6318632)
FT                   /gene="9430022F06Rik"
FT                   /locus_tag="mCG_62251"
FT                   /note="gene_id=mCG62251.2"
FT   mRNA            complement(join(6314430..6316834,6318377..6318632))
FT                   /gene="9430022F06Rik"
FT                   /locus_tag="mCG_62251"
FT                   /product="RIKEN cDNA 9430022F06"
FT                   /note="gene_id=mCG62251.2 transcript_id=mCT62434.2 created
FT                   on 18-MAR-2003"
FT   CDS             complement(join(6315804..6316834,6318377..6318440))
FT                   /codon_start=1
FT                   /gene="9430022F06Rik"
FT                   /locus_tag="mCG_62251"
FT                   /product="RIKEN cDNA 9430022F06"
FT                   /note="gene_id=mCG62251.2 transcript_id=mCT62434.2
FT                   protein_id=mCP42496.1"
FT                   /protein_id="EDL23011.1"
FT                   /translation="MEKLNLLGFLIITLNCNVTIMGMIWLIVEVLLRMLVVVLAGSPIY
FT                   EDEQERFICNTLQPGCANVCYDLFSPVSPLRFWLVQSLALLLPSVVFGTYTLHRGAKLA
FT                   AVGGACRPQVPDLSTAYLVHLLLRMLLEAGLAFLHYFLFGFSVPARVSCSHVPCSGAVD
FT                   CYVSRPTEKSLLILFFWAVSALSFLLSLADLLWILPRRKTLRTTQWVNGEARPVCEVPA
FT                   PPPCLLQNPQGYLSQGQVDQEDRQEEQVVPEFPCMWTAGQSDNSNVGQACVSGLLEHSD
FT                   QDASEATSSAGDRLTVAHTAHELRFHRETSLDLGGKNTQADELSLATQSHLARHSSASK
FT                   PQAPGRLTTSGSAPHLRTKKSEWV"
FT   gene            complement(6348465..6486609)
FT                   /gene="5730405I09Rik"
FT                   /locus_tag="mCG_2295"
FT                   /note="gene_id=mCG2295.2"
FT   mRNA            complement(join(6348465..6352593,6352738..6352829,
FT                   6355566..6355728,6368982..6369148,6381386..6381505,
FT                   6381606..6381663,6385580..6385615,6389476..6389576,
FT                   6413865..6413899,6422806..6422880,6486005..6486345,
FT                   6486532..6486609))
FT                   /gene="5730405I09Rik"
FT                   /locus_tag="mCG_2295"
FT                   /product="RIKEN cDNA 5730405I09, transcript variant
FT                   mCT1780"
FT                   /note="gene_id=mCG2295.2 transcript_id=mCT1780.2 created on
FT                   18-SEP-2002"
FT   mRNA            complement(join(6348465..6352829,6355566..6355728,
FT                   6368982..6369148,6381386..6381505,6381606..6381663,
FT                   6385580..6385615,6389476..6389576,6413865..6413899,
FT                   6486005..6486345,6486532..6486599))
FT                   /gene="5730405I09Rik"
FT                   /locus_tag="mCG_2295"
FT                   /product="RIKEN cDNA 5730405I09, transcript variant
FT                   mCT173386"
FT                   /note="gene_id=mCG2295.2 transcript_id=mCT173386.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(6352476..6352593,6352738..6352829,
FT                   6355566..6355728,6368982..6369148,6381386..6381505,
FT                   6381606..6381663,6385580..6385615,6389476..6389576,
FT                   6413865..6413899,6422806..6422880,6486005..6486158))
FT                   /codon_start=1
FT                   /gene="5730405I09Rik"
FT                   /locus_tag="mCG_2295"
FT                   /product="RIKEN cDNA 5730405I09, isoform CRA_b"
FT                   /note="gene_id=mCG2295.2 transcript_id=mCT1780.2
FT                   protein_id=mCP22543.2 isoform=CRA_b"
FT                   /protein_id="EDL23010.1"
FT                   /translation="MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHIS
FT                   DRENIDDLNMEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQTSRKYSSCSTI
FT                   FLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDK
FT                   HNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIVLGAILL
FT                   ASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRSL
FT                   AEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRKPMRKRSASADNLILPSLIEAAF
FT                   SPPPHLVGARRAALRDVKSVFRKLGVKPSRPS"
FT   CDS             complement(join(6352713..6352829,6355566..6355728,
FT                   6368982..6369148,6381386..6381505,6381606..6381663,
FT                   6385580..6385615,6389476..6389576,6413865..6413899,
FT                   6486005..6486158))
FT                   /codon_start=1
FT                   /gene="5730405I09Rik"
FT                   /locus_tag="mCG_2295"
FT                   /product="RIKEN cDNA 5730405I09, isoform CRA_a"
FT                   /note="gene_id=mCG2295.2 transcript_id=mCT173386.0
FT                   protein_id=mCP96306.0 isoform=CRA_a"
FT                   /protein_id="EDL23009.1"
FT                   /translation="MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHIS
FT                   DRENIDVREKRKSLFINHHPPGQTSRKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYY
FT                   HIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAEC
FT                   AIVTLVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVE
FT                   DMNELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAHKLEAIS
FT                   RLCEDKYKDLRKPMRKRSASADNLILPRWSPAIIS"
FT   gene            complement(6645047..6649392)
FT                   /gene="Cetn1"
FT                   /locus_tag="mCG_22360"
FT                   /note="gene_id=mCG22360.1"
FT   mRNA            complement(join(6645047..6645369,6648090..6649392))
FT                   /gene="Cetn1"
FT                   /locus_tag="mCG_22360"
FT                   /product="centrin 1"
FT                   /note="gene_id=mCG22360.1 transcript_id=mCT21912.2 created
FT                   on 17-JUN-2003"
FT   CDS             complement(6648435..6648953)
FT                   /codon_start=1
FT                   /gene="Cetn1"
FT                   /locus_tag="mCG_22360"
FT                   /product="centrin 1"
FT                   /note="gene_id=mCG22360.1 transcript_id=mCT21912.2
FT                   protein_id=mCP11253.1"
FT                   /protein_id="EDL23008.1"
FT                   /translation="MASTFRKSNVASTSYKRKVGPKPELTEDQKQEVREAFDLFDSDGS
FT                   GTIDVKELKVAMRALGFEPRKEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKE
FT                   EILKAFRLFDDDETGKISFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFL
FT                   KIMKKTNLY"
FT   gene            6658765..6660274
FT                   /pseudo
FT                   /locus_tag="mCG_117493"
FT                   /note="gene_id=mCG117493.1"
FT   mRNA            6658765..6660274
FT                   /pseudo
FT                   /locus_tag="mCG_117493"
FT                   /note="gene_id=mCG117493.1 transcript_id=mCT118630.1
FT                   created on 10-JUN-2002"
FT   gene            6737731..6907476
FT                   /gene="Colec12"
FT                   /locus_tag="mCG_22355"
FT                   /note="gene_id=mCG22355.2"
FT   mRNA            join(6737731..6737828,6750963..6751013,6869708..6869830,
FT                   6876249..6876347,6877566..6878612,6887970..6888458,
FT                   6889262..6889398,6896240..6896349,6904301..6904446,
FT                   6906500..6907476)
FT                   /gene="Colec12"
FT                   /locus_tag="mCG_22355"
FT                   /product="collectin sub-family member 12"
FT                   /note="gene_id=mCG22355.2 transcript_id=mCT21907.2 created
FT                   on 16-SEP-2002"
FT   CDS             join(6737822..6737828,6750963..6751013,6869708..6869830,
FT                   6876249..6876347,6877566..6878612,6887970..6888458,
FT                   6889262..6889398,6896240..6896349,6904301..6904446,
FT                   6906500..6906519)
FT                   /codon_start=1
FT                   /gene="Colec12"
FT                   /locus_tag="mCG_22355"
FT                   /product="collectin sub-family member 12"
FT                   /note="gene_id=mCG22355.2 transcript_id=mCT21907.2
FT                   protein_id=mCP11277.2"
FT                   /protein_id="EDL23007.1"
FT                   /translation="MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIVLLYI
FT                   LCALLTITVAILGYKVVEKMDNVTDGMETSHQTYDNKLTAVESDLKKLGDQAGKKALST
FT                   NSELSTFRSDILDLRQQLQEITEKTSKNKDTLEKLQANGDSLVDRQSQLKETLQNNSFL
FT                   ITTVNKTLQAYNGYVTNLQQDTSVLQGNLQSQMYSQSVVIMNLNNLNLTQVQQRNLISN
FT                   LQQSVDDTSLAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANND
FT                   TLEDMNSQLSSFTGQMDNITTISQANEQSLKDLQDLHKDTENRTAVKFSQLEERFQVFE
FT                   TDIVNIISNISYTAHHLRTLTSNLNDVRTTCTDTLTRHTDDLTSLNNTLVNIRLDSISL
FT                   RMQQDMMRSKLDTEVANLSVVMEEMKLVDSKHGQLIKNFTILQGPPGPRGPKGDRGSQG
FT                   PPGPTGNKGQKGEKGEPGPPGPAGERGTIGPVGPPGERGSKGSKGSQGPKGSRGSPGKP
FT                   GPQGPSGDPGPPGPPGKDGLPGPQGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGP
FT                   KGPPGPPGPSGAMEPLALQNEPTPASEVNGCPPHWKNFTDKCYYFSLEKEIFEDAKLFC
FT                   EDKSSHLVFINSREEQQWIKKHTVGRESHWIGLTDSEQESEWKWLDGSPVDYKNWKAGQ
FT                   PDNWGSGHGPGEDCAGLIYAGQWNDFQCDEINNFICEKEREAVPSSIL"
FT   gene            6986999..7024843
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /note="gene_id=mCG22356.2"
FT   mRNA            join(6986999..6987656,6988508..6988581,6988665..6988725,
FT                   6989896..6989962,6991783..6991901,6992673..6992721,
FT                   6993233..6993328,6998161..6998243,6999665..6999738,
FT                   7005009..7005117,7007305..7007436,7013793..7013893,
FT                   7015648..7015714,7015912..7015962,7016050..7016120,
FT                   7016429..7016524,7016958..7017029,7019050..7019133,
FT                   7021487..7021634,7022191..7022266,7022680..7023989)
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /product="THO complex 1, transcript variant mCT21909"
FT                   /note="gene_id=mCG22356.2 transcript_id=mCT21909.2 created
FT                   on 18-SEP-2002"
FT   mRNA            join(6987418..6987656,6988508..6988581,6988665..6988725,
FT                   6989896..6989962,6991783..6991901,6992673..6992721,
FT                   6993233..6993328,6998161..6998243,6999665..6999738,
FT                   7005009..7005117,7007305..7007436,7013793..7013893,
FT                   7015648..7015962,7016050..7016120,7016429..7016524,
FT                   7016958..7017029,7019052..7019133,7021487..7021634,
FT                   7022191..7022266,7022680..7023083)
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /product="THO complex 1, transcript variant mCT173385"
FT                   /note="gene_id=mCG22356.2 transcript_id=mCT173385.0 created
FT                   on 18-SEP-2002"
FT   mRNA            join(<6987588..6987656,6988508..6988581,6988665..6988725,
FT                   6989896..6989962,6991783..6991901,6992673..6992721,
FT                   6993233..6993328,6998161..6998243,6999665..6999738,
FT                   7005009..7005117,7007305..7007436,7013793..7013893,
FT                   7015648..7015714,7015912..7015962,7016050..7016120,
FT                   7016429..7016524,7016958..7017029,7019052..7019133,
FT                   7021487..7021634,7022191..7022266,7022680..7024843)
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /product="THO complex 1, transcript variant mCT191813"
FT                   /note="gene_id=mCG22356.2 transcript_id=mCT191813.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<6987588..6987656,6988508..6988581,6988665..6988725,
FT                   6989896..6989962,6991783..6991901,6992673..6992721,
FT                   6993233..6993328,6998161..6998243,6999665..6999738,
FT                   7005009..7005117,7007305..7007436,7013793..7013893,
FT                   7015648..7015714,7015912..7015962,7016050..7016120,
FT                   7016429..7016524,7016958..7017029,7019052..7019082)
FT                   /codon_start=1
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /product="THO complex 1, isoform CRA_c"
FT                   /note="gene_id=mCG22356.2 transcript_id=mCT191813.0
FT                   protein_id=mCP112773.0 isoform=CRA_c"
FT                   /protein_id="EDL23005.1"
FT                   /translation="ARATKMSPTPALFSLPEARTRFTKSTREALNNKNIKPLLTAFSQL
FT                   PGSENEKKCTLDQAFRGVLEEEIINHSACENVLAIISLAIGGVTESVCTASTPFVLLGD
FT                   VLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGR
FT                   IQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEM
FT                   GDDEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKL
FT                   DDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQ
FT                   VKFKSSNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNE
FT                   GCPSFVKERASDTKPTRVVRKRAAPEDFLGKGPNKKILIGNEELTRLWNLCPDNMEACK
FT                   SETRQVIHANFGGVL"
FT   CDS             join(6987603..6987656,6988508..6988581,6988665..6988725,
FT                   6989896..6989962,6991783..6991901,6992673..6992721,
FT                   6993233..6993328,6998161..6998243,6999665..6999738,
FT                   7005009..7005117,7007305..7007436,7013793..7013893,
FT                   7015648..7015714,7015912..7015962,7016050..7016120,
FT                   7016429..7016524,7016958..7017029,7019050..7019133,
FT                   7021487..7021634,7022191..7022266,7022680..7022975)
FT                   /codon_start=1
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /product="THO complex 1, isoform CRA_d"
FT                   /note="gene_id=mCG22356.2 transcript_id=mCT21909.2
FT                   protein_id=mCP11285.2 isoform=CRA_d"
FT                   /protein_id="EDL23006.1"
FT                   /translation="MSPTPALFSLPEARTRFTKSTREALNNKNIKPLLTAFSQLPGSEN
FT                   EKKCTLDQAFRGVLEEEIINHSACENVLAIISLAIGGVTESVCTASTPFVLLGDVLDCL
FT                   PLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFL
FT                   ARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDDEA
FT                   PTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQA
FT                   SRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKS
FT                   SNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSF
FT                   VKERASDTKPTRVVRKRAAPEDFLGKGPNKKILIGNEELTRLWNLCPDNMEACKSETRQ
FT                   VEYMPTLEEFFEEAIEQADPENMVESEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQF
FT                   KSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESPDVRRDKPITGEQI
FT                   ESFANKLGEQWKILAPYLEIKDSDIRQIECDSEDMKMRAKQLLVAWQDQEGVHATTDNL
FT                   ISALNKSGLSDLAESLTNDTETNS"
FT   CDS             join(6987603..6987656,6988508..6988581,6988665..6988725,
FT                   6989896..6989962,6991783..6991901,6992673..6992721,
FT                   6993233..6993328,6998161..6998243,6999665..6999738,
FT                   7005009..7005117,7007305..7007436,7013793..7013893,
FT                   7015648..7015762)
FT                   /codon_start=1
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /product="THO complex 1, isoform CRA_a"
FT                   /note="gene_id=mCG22356.2 transcript_id=mCT173385.0
FT                   protein_id=mCP96304.0 isoform=CRA_a"
FT                   /protein_id="EDL23003.1"
FT                   /translation="MSPTPALFSLPEARTRFTKSTREALNNKNIKPLLTAFSQLPGSEN
FT                   EKKCTLDQAFRGVLEEEIINHSACENVLAIISLAIGGVTESVCTASTPFVLLGDVLDCL
FT                   PLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFL
FT                   ARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDDEA
FT                   PTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQA
FT                   SRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKS
FT                   SNYVLTDEQSLWIEDTTKSVYQVSPTCNKPMIEKMEI"
FT   mRNA            join(<6993214..6993328,6998161..6998243,6999665..6999738,
FT                   7005009..7005117,7007305..7007436,7013793..7013893,
FT                   7015648..7015962,7016050..7016120,7016429..7016524,
FT                   7016958..7017029,7019052..7019133,7021487..7021634,
FT                   7022191..7022266,7022680..7023083)
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /product="THO complex 1, transcript variant mCT191812"
FT                   /note="gene_id=mCG22356.2 transcript_id=mCT191812.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<6993223..6993328,6998161..6998243,6999665..6999738,
FT                   7005009..7005117,7007305..7007436,7013793..7013893,
FT                   7015648..7015762)
FT                   /codon_start=1
FT                   /gene="Thoc1"
FT                   /locus_tag="mCG_22356"
FT                   /product="THO complex 1, isoform CRA_b"
FT                   /note="gene_id=mCG22356.2 transcript_id=mCT191812.0
FT                   protein_id=mCP112772.0 isoform=CRA_b"
FT                   /protein_id="EDL23004.1"
FT                   /translation="TLLDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNL
FT                   ENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDDEAPTTCSIPIDYNLYRKFWSLQ
FT                   DYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQASRKKMEELKTGGEHVYFAKF
FT                   LTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSV
FT                   YQVSPTCNKPMIEKMEI"
FT   gene            complement(7024948..7059586)
FT                   /gene="Usp14"
FT                   /locus_tag="mCG_22359"
FT                   /note="gene_id=mCG22359.3"
FT   mRNA            complement(join(7024948..7025607,7026532..7026639,
FT                   7027076..7027133,7029854..7029982,7031130..7031222,
FT                   7031727..7031792,7034257..7034371,7034991..7035076,
FT                   7037128..7037208,7039313..7039443,7041574..7041632,
FT                   7046014..7046117,7052294..7052326,7054010..7054155,
FT                   7059389..>7059543))
FT                   /gene="Usp14"
FT                   /locus_tag="mCG_22359"
FT                   /product="ubiquitin specific peptidase 14, transcript
FT                   variant mCT191815"
FT                   /note="gene_id=mCG22359.3 transcript_id=mCT191815.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(7024950..7025607,7026532..7026639,
FT                   7027076..7027133,7029854..7029982,7031130..7031222,
FT                   7031727..7031792,7034257..7034371,7034991..7035076,
FT                   7037128..7037208,7039313..7039443,7041574..7041632,
FT                   7046014..7046117,7047466..7047570,7052294..7052326,
FT                   7054010..7054155,7059389..7059586))
FT                   /gene="Usp14"
FT                   /locus_tag="mCG_22359"
FT                   /product="ubiquitin specific peptidase 14, transcript
FT                   variant mCT21911"
FT                   /note="gene_id=mCG22359.3 transcript_id=mCT21911.2 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(7025456..7025607,7026532..7026639,
FT                   7027076..7027133,7029854..7029982,7031130..7031222,
FT                   7031727..7031792,7034257..7034371,7034991..7035076,
FT                   7037128..7037208,7039313..7039443,7041574..7041632,
FT                   7046014..7046117,7052294..7052326,7054010..7054155,
FT                   7059389..>7059533))
FT                   /codon_start=1
FT                   /gene="Usp14"
FT                   /locus_tag="mCG_22359"
FT                   /product="ubiquitin specific peptidase 14, isoform CRA_a"
FT                   /note="gene_id=mCG22359.3 transcript_id=mCT191815.0
FT                   protein_id=mCP112774.0 isoform=CRA_a"
FT                   /protein_id="EDL23001.1"
FT                   /translation="GLSHRSCRLHLASTPAASTSCFVFLGCPCQTQPPAPFLPSCLAMP
FT                   LYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNI
FT                   KMKNMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAA
FT                   LRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQK
FT                   LEAIEDDSGRETDSSSAPAVTPSKKKSLIDQYFGVEFETTMKCTESEEEEVTKGKENQL
FT                   QLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFF
FT                   YKEKESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDK
FT                   NSPPKEIKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVRRKQDEWIKFD
FT                   DDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ"
FT   CDS             complement(join(7025456..7025607,7026532..7026639,
FT                   7027076..7027133,7029854..7029982,7031130..7031222,
FT                   7031727..7031792,7034257..7034371,7034991..7035076,
FT                   7037128..7037208,7039313..7039443,7041574..7041632,
FT                   7046014..7046117,7047466..7047570,7052294..7052326,
FT                   7054010..7054155,7059389..7059404))
FT                   /codon_start=1
FT                   /gene="Usp14"
FT                   /locus_tag="mCG_22359"
FT                   /product="ubiquitin specific peptidase 14, isoform CRA_b"
FT                   /note="gene_id=mCG22359.3 transcript_id=mCT21911.2
FT                   protein_id=mCP11302.2 isoform=CRA_b"
FT                   /protein_id="EDL23002.1"
FT                   /translation="MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQK
FT                   VMVKGGTLKDDDWGNIKMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLATAMELP
FT                   CGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSM
FT                   DKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDS
FT                   GRETDSSSAPAVTPSKKKSLIDQYFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQ
FT                   EVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVN
FT                   AKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSPPKEIK
FT                   YEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVRRKQDEWIKFDDDKVSIVT
FT                   PEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ"
FT   gene            complement(7094534..7211725)
FT                   /locus_tag="mCG_117485"
FT                   /note="gene_id=mCG117485.1"
FT   mRNA            complement(join(7094534..7096178,7097598..7097805,
FT                   7100345..7100606,7100748..7100826,7102958..7103046,
FT                   7103241..7103311,7109241..7109400,7110477..7110665,
FT                   7113248..7113336,7114444..7114537,7120939..7121104,
FT                   7122255..7122349,7123987..7124056,7125492..7125676,
FT                   7127562..7127722,7129336..7129486,7131001..7131107,
FT                   7134137..7134383,7134481..7134572,7136385..7136520,
FT                   7142274..7142322,7146704..7146792,7149815..7149875,
FT                   7152539..7152698,7159235..7159326,7161460..7161598,
FT                   7162058..7162202,7164346..7164430,7166026..7166201,
FT                   7170106..7170243,7170718..7170818,7180165..7180246,
FT                   7211158..7211725))
FT                   /locus_tag="mCG_117485"
FT                   /product="mCG117485"
FT                   /note="gene_id=mCG117485.1 transcript_id=mCT118626.1
FT                   created on 16-SEP-2002"
FT   CDS             complement(join(7096175..7096178,7097598..7097805,
FT                   7100345..7100606,7100748..7100826,7102958..7103046,
FT                   7103241..7103311,7109241..7109400,7110477..7110665,
FT                   7113248..7113336,7114444..7114537,7120939..7121104,
FT                   7122255..7122349,7123987..7124056,7125492..7125676,
FT                   7127562..7127722,7129336..7129486,7131001..7131107,
FT                   7134137..7134383,7134481..7134572,7136385..7136520,
FT                   7142274..7142322,7146704..7146792,7149815..7149875,
FT                   7152539..7152698,7159235..7159326,7161460..7161598,
FT                   7162058..7162202,7164346..7164430,7166026..7166201,
FT                   7170106..7170243,7170718..7170818,7180165..7180246,
FT                   7211158..7211250))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117485"
FT                   /product="mCG117485"
FT                   /note="gene_id=mCG117485.1 transcript_id=mCT118626.1
FT                   protein_id=mCP69526.1"
FT                   /protein_id="EDL23000.1"
FT                   /translation="MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPA
FT                   LRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAM
FT                   KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVN
FT                   LMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMK
FT                   MNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYAD
FT                   SLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKN
FT                   DQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTY
FT                   YSNRRYLPSANASENRSSSNVDKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNL
FT                   KLDKIMKELDEEGNQRRNLESAVSQIEKEKMLLQHRINEYQRKVEQENEKRRNIENEVS
FT                   TLKDQLEDLRKASQTSQLANEKLTQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSIS
FT                   QLESLNRELQERNRILENSKSQADKDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQ
FT                   EEVKHLKHNLERVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVT
FT                   KARLTDKHQSIEEAKSVAMCEMEKKLKEEREAREKAENRVVETEKQCSMLDVDLKQSQQ
FT                   KLEHLTENKERMEDEVKNLALQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQEIN
FT                   TLLEAKRLLEFELAQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEEKN
FT                   RENLRKIQELQSEKETLSTQLDLAETKAESEQLARGILEEQYFELTQESKKAASRNRQE
FT                   ITDKDHTVSRLEETNSVLTKDIEMLRKENEELNERMRTAEEEYKLKKEEEINNLKAAFE
FT                   KNISTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKF
FT                   NQMVVKHQKELNDMQAQLVEECTHRNELQMQLASKESDIEQLRAKLLDLSDSTSVASFP
FT                   SADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSSPSM
FT                   VLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDIEVEPVQQGEKTNFQN
FT                   HKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLISPCK
FT                   VSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSGFVRASPRTLSTRSTANQSFR
FT                   KVVKNTSGKTS"
FT   gene            7266253..7267624
FT                   /pseudo
FT                   /locus_tag="mCG_49414"
FT                   /note="gene_id=mCG49414.2"
FT   mRNA            7266253..7267624
FT                   /pseudo
FT                   /locus_tag="mCG_49414"
FT                   /note="gene_id=mCG49414.2 transcript_id=mCT49597.2 created
FT                   on 04-JUN-2002"
FT   gene            7292000..7293078
FT                   /pseudo
FT                   /locus_tag="mCG_22361"
FT                   /note="gene_id=mCG22361.2"
FT   mRNA            7292000..7293078
FT                   /pseudo
FT                   /locus_tag="mCG_22361"
FT                   /note="gene_id=mCG22361.2 transcript_id=mCT21913.2 created
FT                   on 21-AUG-2002"
FT   gene            7354956..7590685
FT                   /locus_tag="mCG_14672"
FT                   /note="gene_id=mCG14672.2"
FT   mRNA            join(7354956..7355066,7479251..7479357,7487541..7487700,
FT                   7487897..7488094,7498663..7498839,7503540..7503716,
FT                   7505987..7506109,7528268..7528384,7529201..7529320,
FT                   7532475..7532660,7538400..7538726,7539945..7540073,
FT                   7540646..7540780,7544511..7544708,7551406..7551586,
FT                   7552525..7552717,7558552..7558682,7561771..7562110,
FT                   7566040..7566155,7567108..7567352,7570907..7571166,
FT                   7571319..7571421,7573423..7573578,7573845..7573984,
FT                   7577730..7577891,7578001..7578205,7583806..7583971,
FT                   7584924..7585151,7585986..7586127,7587328..7587531,
FT                   7590206..7590685)
FT                   /locus_tag="mCG_14672"
FT                   /product="mCG14672"
FT                   /note="gene_id=mCG14672.2 transcript_id=mCT19331.2 created
FT                   on 20-MAR-2003"
FT   CDS             join(7487544..7487700,7487897..7488094,7498663..7498839,
FT                   7503540..7503716,7505987..7506109,7528268..7528384,
FT                   7529201..7529320,7532475..7532660,7538400..7538726,
FT                   7539945..7540073,7540646..7540780,7544511..7544708,
FT                   7551406..7551586,7552525..7552717,7558552..7558682,
FT                   7561771..7562110,7566040..7566155,7567108..7567352,
FT                   7570907..7571166,7571319..7571421,7573423..7573578,
FT                   7573845..7573984,7577730..7577891,7578001..7578205,
FT                   7583806..7583971,7584924..7585151,7585986..7586127,
FT                   7587328..7587531,7590206..7590373)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14672"
FT                   /product="mCG14672"
FT                   /note="gene_id=mCG14672.2 transcript_id=mCT19331.2
FT                   protein_id=mCP11291.2"
FT                   /protein_id="EDL22999.1"
FT                   /translation="MGNSYAGQLKSARFEEALHNSIEASLRCSTAVPRPIFSQLYLDPD
FT                   QHPFSTADVKPKVEDLDKDLVHPYTQNGSVDFSHNVAMNEMEDDEDEEEMSDSNSPPIP
FT                   YSQKPAPEGSCTTDGFCQAGKDLRLVSLCMEQIDIPAGFLLVGAKSPNLPEHILVCAVD
FT                   KRFLPDDHGKNALLGFSGNCIGCGERGFRYFTEFSNHINLKLTTQPKKQKHLKYYLVRT
FT                   SQGVLSKGPLICWKECRSRQSSALCHSTKPISSVSSAVAPENGTANGYKAGFTVTEAAN
FT                   GTSGHGGKSSSCSSTPSRPGNYSLSPRPTFTSVDQANMFISGPPKKRHRGWYPGSPVSQ
FT                   SALVVPAPTVRPLSRTGYGTLPYFYGNVGDIVVSPLLVNCYKIPQLENKDLEQLGLTST
FT                   HLLSVENMILLTIQYLVRLGPDQIPLREEFEQIMLTAMQEFSVRERALPLGAPCAPMSP
FT                   AQLPWLARLAASVSQDLVHVIVTQNSLAEGISETLRLLSEMKHYQRLPDYVVAICASKI
FT                   RGNEFCVVVLGQHQSRALAESMLTTSEFLKEISYELITGKVSFLASHFKTTSLGDDLDK
FT                   LLEKMQQRRGDSVVTPFNGDLDECVSPQEAAAMIPTQNLDVDNETFQIYQPQLTVARRL
FT                   LSQVCAIADSGSQSLDLGHFSKVDFIIIVPRSEVLVQQTLQRVRQSGVLVDLGLEESGL
FT                   AHQRAERYVVRLDNEIQSKFEVFMRRVKQNPYTLFVLVHDNSHVELTSVISGSLSHGEP
FT                   THGLADRVINCREVLEAFNLLVLQVSSFPYTLQTQQSRISSSNEVHWIQLDTMEDAGCE
FT                   KLYFGLDEYSKSLQWGITSPLLRCDETFEKMVSTLLERYPRLHSMVVRCYLLIQQYSEA
FT                   LMALTTMASLRDHSTPETLSIMDDLITSPGKNKSGKGHMLVIRVPSVQLAMLAKERLQE
FT                   VRDKLGLQYRFEIILGSPASELTVETHFVTRLKTWRGNDQDEWIPRTYQDLEGLPCIVI
FT                   LTGKDPLGETFPRSLKYCDLRLIDSSYLTRTALEQEVGLACCYVSKEVIRGPAAALDLS
FT                   AKEAERVPASENDSEELLIDLERPQSNSSAVTGTSAAYSLLGSQKGGRLPSSSSLLPHA
FT                   DVAWVSSLRPGLHKDMSSEEQSLYYRQWTSARQHHADYSNQPDPISGARTLHPRRLLLT
FT                   GPPQVGKTGSYLQFLRILFRMLIRLLEVDVYNEEEINTDHSDDSELSQSEGEPWPDIET
FT                   FSKMPFDVSVHDPKYRLMSLVYSEKLAGIKQEVIKEYKVEEPRQRETMSMMLTQYAAYN
FT                   TFHHCEQCQQYMAFTPASQMSDSTLHAFTFSSSMLGEEVQLYFIIPKSKESHFVFSKQG
FT                   RHLESMRLPLVSDKNLNAVKSPIFTPSSGRHEHGLLNLFHAMEGISHLHLLVVKEYEMP
FT                   LYRKYWPNHIMLVLPGMFNNAGVGAARFLIKELSYHNLELERNRLEELGVKRQCVWPFI
FT                   VVMDDSCVLWNIHSVQEQTSQPTEAGISSKNVSLKSVLQHIEATPKIIHYAILGIQKWN
FT                   SKLTSQSLKAPFSRCHVHDFILLNIDLTQNVQYDFNRYFCEDVDFNLRTNSSGLLICRF
FT                   NNFSLMKKHVQVGGQRDFIIKPKLMVSENVVPILPLQYVCAPDSEHTLLAAPAQFLLEK
FT                   FLQHASYKLFPKAIHNFKSPVLAIDCYLNIGQEVQGATLCVICQDRSSLRQTIVRLELE
FT                   DEWQFRLRDEFQTANSSDDKPLYFLTGRHV"
FT   gene            complement(7511985..7512867)
FT                   /pseudo
FT                   /locus_tag="mCG_14670"
FT                   /note="gene_id=mCG14670.0"
FT   mRNA            complement(7511985..7512867)
FT                   /pseudo
FT                   /locus_tag="mCG_14670"
FT                   /note="gene_id=mCG14670.0 transcript_id=mCT19328.0 created
FT                   on 20-MAR-2003"
FT   gene            complement(7596413..7640154)
FT                   /locus_tag="mCG_14668"
FT                   /note="gene_id=mCG14668.1"
FT   mRNA            complement(join(7596413..7597550,7601898..7602085,
FT                   7604818..7604961,7606944..7607033,7611998..7612129,
FT                   7614196..7614310,7615980..7616043,7626339..7626441,
FT                   7640026..7640154))
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, transcript variant mCT173379"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT173379.0 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(7596413..7597550,7601898..7602085,
FT                   7604818..7604961,7606944..7607033,7607581..7607702,
FT                   7611998..7612129,7614196..7614310,7615980..7616043,
FT                   7618441..7618552,7626339..7626441,7640026..7640154))
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, transcript variant mCT19329"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT19329.2 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(7596413..7597550,7601898..7602085,
FT                   7604818..7604961,7606944..7607033,7611998..7612129,
FT                   7614196..7614310,7615980..7616043,7618441..7618552,
FT                   7625676..7625875,7626339..7626441,7640026..7640107))
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, transcript variant mCT173381"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT173381.0 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(7596413..7597550,7601898..7602085,
FT                   7604818..7604961,7606944..7607033,7611998..7612129,
FT                   7614196..7614310,7615980..7616043,7625676..7625875,
FT                   7626339..7626441,7640026..7640068))
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, transcript variant mCT173380"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT173380.0 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(7596507..7597550,7601898..7602085,
FT                   7604818..7604961,7606944..7607033,7607581..7607702,
FT                   7611998..7612129,7614196..7614310,7615980..7616043,
FT                   7618441..7618552,7623746..7624055))
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, transcript variant mCT173378"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT173378.0 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(7597403..7597550,7601898..7602085,
FT                   7604818..7604961,7606944..7607033,7611998..7612129,
FT                   7614196..7614310,7615980..7616043,7625676..7625754))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, isoform CRA_b"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT173380.0
FT                   protein_id=mCP96300.0 isoform=CRA_b"
FT                   /protein_id="EDL22995.1"
FT                   /translation="MLQIHQHPVAVDFRRKNFSEILSKQTGSAPNQQHSVLSDEASINR
FT                   KNRDVPPNHSQLKHDSHLEITIPKSLKLKDSEKVDEKQLVIDAGHKRFGAVSCNICGML
FT                   YTASNPEDETQHLLFHNQFISAVKYVGWKKERILAEYPDGRIIMVLPEDPKYALKKVDE
FT                   IREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRS
FT                   EEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLS
FT                   KEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNTT"
FT   CDS             complement(join(7597403..7597550,7601898..7602085,
FT                   7604818..7604961,7606944..7607033,7611998..7612081))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, isoform CRA_d"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT173379.0
FT                   protein_id=mCP96297.0 isoform=CRA_d"
FT                   /protein_id="EDL22997.1"
FT                   /translation="MLYTASNPEDETQHLLFHNQFISAVKYVGWKKERILAEYPDGRII
FT                   MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHI
FT                   QWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASR
FT                   MIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNTT"
FT   CDS             complement(join(7597403..7597550,7601898..7602085,
FT                   7604818..7604961,7606944..7607033,7611998..7612081))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, isoform CRA_d"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT173381.0
FT                   protein_id=mCP96299.0 isoform=CRA_d"
FT                   /protein_id="EDL22998.1"
FT                   /translation="MLYTASNPEDETQHLLFHNQFISAVKYVGWKKERILAEYPDGRII
FT                   MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHI
FT                   QWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASR
FT                   MIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNTT"
FT   CDS             complement(join(7607592..7607702,7611998..7612129,
FT                   7614196..7614310,7615980..7616043,7618441..7618552,
FT                   7626339..7626380))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, isoform CRA_c"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT19329.2
FT                   protein_id=mCP11269.2 isoform=CRA_c"
FT                   /protein_id="EDL22996.1"
FT                   /translation="MVAETSVLSCGKRTNFSICSASEVETNPLENTAAASTLLSQAKID
FT                   EDRTFPGSAPNQQHSVLSDEASINRKNRDVPPNHSQLKHDSHLEITIPKSLKLKDSEKV
FT                   DEKQLVIDAGHKRFGAVSCNICGMLYTASNPEDETQHLLFHNQFISAVKYVVLLINHHE
FT                   CGSEEEFITSLFLSMSNFRYTQRSLLPY"
FT   CDS             complement(join(7607592..7607702,7611998..7612129,
FT                   7614196..7614310,7615980..7616043,7618441..7618552,
FT                   7623746..7623991))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14668"
FT                   /product="mCG14668, isoform CRA_a"
FT                   /note="gene_id=mCG14668.1 transcript_id=mCT173378.0
FT                   protein_id=mCP96298.0 isoform=CRA_a"
FT                   /protein_id="EDL22994.1"
FT                   /translation="MPHPVSQSTFLEMKAHGNVTCQRDKMKGIKSEEVKINNIAIEINK
FT                   ATKRDPGNCNLDNHIKPSPDSSLDNQMKLSCESAPDQNFSICSASEVETNPLENTAAAS
FT                   TLLSQAKIDEDRTFPGSAPNQQHSVLSDEASINRKNRDVPPNHSQLKHDSHLEITIPKS
FT                   LKLKDSEKVDEKQLVIDAGHKRFGAVSCNICGMLYTASNPEDETQHLLFHNQFISAVKY
FT                   VVLLINHHECGSEEEFITSLFLSMSNFRYTQRSLLPY"
FT   gene            <7647793..7670054
FT                   /locus_tag="mCG_14669"
FT                   /note="gene_id=mCG14669.2"
FT   mRNA            join(<7647793..7647924,7653626..7653702,7656821..7657012,
FT                   7657789..7658144)
FT                   /locus_tag="mCG_14669"
FT                   /product="mCG14669, transcript variant mCT19327"
FT                   /note="gene_id=mCG14669.2 transcript_id=mCT19327.1 created
FT                   on 18-SEP-2002"
FT   mRNA            join(7647862..7647924,7653626..7653702,7669529..7670054)
FT                   /locus_tag="mCG_14669"
FT                   /product="mCG14669, transcript variant mCT173382"
FT                   /note="gene_id=mCG14669.2 transcript_id=mCT173382.0 created
FT                   on 18-SEP-2002"
FT   CDS             join(<7647866..7647924,7653626..7653702,7656821..7657012,
FT                   7657789..7657865)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14669"
FT                   /product="mCG14669, isoform CRA_b"
FT                   /note="gene_id=mCG14669.2 transcript_id=mCT19327.1
FT                   protein_id=mCP11270.0 isoform=CRA_b"
FT                   /protein_id="EDL22993.1"
FT                   /translation="NSVNSRARRENCVARMKLVRFLMKLSHETVTIELKNGTQVHGTIT
FT                   GVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKS
FT                   KKREAVAGRGRGRGRGRGRGRGRGRGGPRR"
FT   CDS             join(7647911..7647924,7653626..7653702,7669529..7669734)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14669"
FT                   /product="mCG14669, isoform CRA_a"
FT                   /note="gene_id=mCG14669.2 transcript_id=mCT173382.0
FT                   protein_id=mCP96301.0 isoform=CRA_a"
FT                   /protein_id="EDL22992.1"
FT                   /translation="MKLVRFLMKLSHETVTIELKNGTQVHGTITEARREIWIPWNMEIW
FT                   IPWNMEIWTPWNMEIWTPWNMEIWTPWNMEIWIPWNMEIWTPWNCRRMSCCVC"
FT   gene            complement(7674410..>7736731)
FT                   /gene="Abhd3"
FT                   /locus_tag="mCG_14675"
FT                   /note="gene_id=mCG14675.2"
FT   mRNA            complement(join(7674410..7675232,7677722..7677887,
FT                   7677966..7678014,7682183..7682356,7688775..7688887,
FT                   7712063..7712108,7734542..7734724,7735995..7736158,
FT                   7736524..>7736731))
FT                   /gene="Abhd3"
FT                   /locus_tag="mCG_14675"
FT                   /product="abhydrolase domain containing 3"
FT                   /note="gene_id=mCG14675.2 transcript_id=mCT19335.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(7675054..7675232,7677722..7677887,
FT                   7677966..7678014,7682183..7682356,7688775..7688887,
FT                   7712063..7712108,7734542..7734724,7735995..7736158,
FT                   7736524..>7736730))
FT                   /codon_start=1
FT                   /gene="Abhd3"
FT                   /locus_tag="mCG_14675"
FT                   /product="abhydrolase domain containing 3"
FT                   /note="gene_id=mCG14675.2 transcript_id=mCT19335.2
FT                   protein_id=mCP11260.2"
FT                   /protein_id="EDL22991.1"
FT                   /translation="APASWPPLQLSRARTMQRLAMDLRVLSRELALYLEHQVRVGFFGS
FT                   GVGLSLILGFSVAYACYYLSSIAKKPQLVIGGESFSRFLQDHCPVVTETYYPTVWCWES
FT                   RGQTLLRPFITSKPPVQYRNELIKTADGGQISLDWFDNNNSAYYVDASTRPTILLLPGL
FT                   TGTSKESYILHMIHLSEELGYRCVVFNNRGVAGESLLTPRTYCCANTEDLEAVVHHVHS
FT                   LYPGAPFLAAGVSMGGMLLLNYLGKIGSKTPLMAAATFSVGWNTFACSESLERPLNWLL
FT                   FNYYLTTCLQSSVKKHRHMFVEQIDMDQVMKAKSIREFDKRFTAVMFGYRTLDDYYTDA
FT                   SPNRRLKSVGIPVLCLNATDDVFSPSHAIPIETAKQNPNVALVLTAYGGHIGFLEGIWP
FT                   RQCTYMDRVFKQFVQAMVEHGHELSNM"
FT   gene            <7736853..7741824
FT                   /locus_tag="mCG_144720"
FT                   /note="gene_id=mCG144720.0"
FT   mRNA            join(<7736853..7738198,7740504..7740558,7741672..7741824)
FT                   /locus_tag="mCG_144720"
FT                   /product="mCG144720"
FT                   /note="gene_id=mCG144720.0 transcript_id=mCT184144.0
FT                   created on 05-JUN-2003"
FT   CDS             <7736855..7737169
FT                   /codon_start=1
FT                   /locus_tag="mCG_144720"
FT                   /product="mCG144720"
FT                   /note="gene_id=mCG144720.0 transcript_id=mCT184144.0
FT                   protein_id=mCP106200.0"
FT                   /protein_id="EDL22990.1"
FT                   /translation="DASWTARRPWTPSVPSEPGESGRARRKQAGPPLDLELVDSAQLGR
FT                   PQFAEGPHLLQNPKQTRKESLHNAGRVSSVPLELASLGRLFKEKNIPSIARHAGLSISR
FT                   "
FT   gene            <7756297..7842145
FT                   /gene="Mib1"
FT                   /locus_tag="mCG_14676"
FT                   /note="gene_id=mCG14676.1"
FT   mRNA            join(<7756297..7756525,7770974..7771145,7773260..7773389,
FT                   7777347..7777451,7779314..7779380,7781814..7782018,
FT                   7785499..7785682,7790799..7790943,7793184..7793317,
FT                   7798118..7798225,7805513..7805710,7808133..7808284,
FT                   7822879..7823011,7824462..7824548,7825674..7825835,
FT                   7828336..7828517,7830040..7830232,7832245..7832323,
FT                   7834671..7834784,7838018..7838118,7841969..7842145)
FT                   /gene="Mib1"
FT                   /locus_tag="mCG_14676"
FT                   /product="mindbomb homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG14676.1 transcript_id=mCT19332.2 created
FT                   on 18-MAR-2003"
FT   CDS             join(7756297..7756525,7770974..7771145,7773260..7773389,
FT                   7777347..7777451,7779314..7779380,7781814..7782018,
FT                   7785499..7785682,7790799..7790943,7793184..7793317,
FT                   7798118..7798225,7805513..7805710,7808133..7808284,
FT                   7822879..7823011,7824462..7824548,7825674..7825835,
FT                   7828336..7828517,7830040..7830232,7832245..7832323,
FT                   7834671..7834784,7838018..7838118,7841969..7842109)
FT                   /codon_start=1
FT                   /gene="Mib1"
FT                   /locus_tag="mCG_14676"
FT                   /product="mindbomb homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG14676.1 transcript_id=mCT19332.2
FT                   protein_id=mCP11267.2"
FT                   /protein_id="EDL22989.1"
FT                   /translation="MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESP
FT                   EEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECT
FT                   NYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDW
FT                   QWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAK
FT                   GGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTT
FT                   TGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQ
FT                   VCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSK
FT                   VAPAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDV
FT                   NGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLH
FT                   RGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRD
FT                   DILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTA
FT                   LHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDI
FT                   QDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAA
FT                   SIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISND
FT                   SETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKIEECVVCSD
FT                   KKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRVPFITCCGGKSSEDPSDEISSGN
FT                   IPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRM
FT                   SECPICRKAIERRILLY"
FT   gene            complement(8034555..>8075935)
FT                   /locus_tag="mCG_144721"
FT                   /note="gene_id=mCG144721.0"
FT   mRNA            complement(join(8034555..8035461,8036904..8037248,
FT                   8038113..8038245,8066256..8066346,8074811..8074934,
FT                   8075715..>8075935))
FT                   /locus_tag="mCG_144721"
FT                   /product="mCG144721"
FT                   /note="gene_id=mCG144721.0 transcript_id=mCT184145.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(8037008..8037248,8038113..>8038120))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144721"
FT                   /product="mCG144721"
FT                   /note="gene_id=mCG144721.0 transcript_id=mCT184145.0
FT                   protein_id=mCP106201.0"
FT                   /protein_id="EDL22988.1"
FT                   /translation="FHMKDALSNRKWVFSATRSLRVQNSAFECSYKMHNWRQLTGNILL
FT                   ELKGAGSDSLCSYCLQIPTAVILVCEQQPLTYLLCQL"
FT   gene            complement(8076359..>8079840)
FT                   /locus_tag="mCG_145997"
FT                   /note="gene_id=mCG145997.1"
FT   mRNA            complement(join(8076359..8078093,8078530..>8078762))
FT                   /locus_tag="mCG_145997"
FT                   /product="mCG145997, transcript variant mCT191814"
FT                   /note="gene_id=mCG145997.1 transcript_id=mCT191814.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(8076489..>8076851)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145997"
FT                   /product="mCG145997, isoform CRA_b"
FT                   /note="gene_id=mCG145997.1 transcript_id=mCT191814.0
FT                   protein_id=mCP112771.0 isoform=CRA_b"
FT                   /protein_id="EDL22987.1"
FT                   /translation="LESFCSEPFRPKEQTLRKKADSRALPVPLCSFIWSGPNHHLPFKS
FT                   SRNTAANRAGGGGSVAKTEEVFGDSMARGFRGAPQIRAWMCIAIHLWPCKLKLITCHFT
FT                   KLLPARTLIQKWGKGC"
FT   mRNA            complement(join(8077203..8077528,8077896..8078093,
FT                   8078530..8078640,8079747..>8079840))
FT                   /locus_tag="mCG_145997"
FT                   /product="mCG145997, transcript variant mCT186105"
FT                   /note="gene_id=mCG145997.1 transcript_id=mCT186105.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(8078062..8078093,8078530..8078640,
FT                   8079747..>8079837))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145997"
FT                   /product="mCG145997, isoform CRA_a"
FT                   /note="gene_id=mCG145997.1 transcript_id=mCT186105.0
FT                   protein_id=mCP107736.0 isoform=CRA_a"
FT                   /protein_id="EDL22986.1"
FT                   /translation="LDSPSPKQTALAEGCQAVGRNCSLQAAGCGAHKRDFFRQAGHWKK
FT                   AARRELNMRNTLVGVDSYRNTPVTVASAWLHL"
FT   gene            8079774..8114742
FT                   /gene="Gata6"
FT                   /locus_tag="mCG_14673"
FT                   /note="gene_id=mCG14673.1"
FT   mRNA            join(8079774..8080015,8081308..8082461,8086325..8086491,
FT                   8091759..8091884,8093251..8093338,8093429..8093532,
FT                   8113370..8114742)
FT                   /gene="Gata6"
FT                   /locus_tag="mCG_14673"
FT                   /product="GATA binding protein 6"
FT                   /note="gene_id=mCG14673.1 transcript_id=mCT19333.2 created
FT                   on 10-JUN-2002"
FT   CDS             join(8081345..8082461,8086325..8086491,8091759..8091884,
FT                   8093251..8093338,8093429..8093532,8113370..8113537)
FT                   /codon_start=1
FT                   /gene="Gata6"
FT                   /locus_tag="mCG_14673"
FT                   /product="GATA binding protein 6"
FT                   /note="gene_id=mCG14673.1 transcript_id=mCT19333.2
FT                   protein_id=mCP11244.2"
FT                   /db_xref="GOA:Q61169"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR008013"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR028437"
FT                   /db_xref="MGI:MGI:107516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61169"
FT                   /protein_id="EDL22985.1"
FT                   /translation="MALTDGGWCLPKRFGAAAADAGDSGPFPAREPSSPLSPISSSSSS
FT                   CSRGGDRGPCGASNCRTPQLDAEAVAGPPGRSLLLSPYASHPFAAAHGAAAPGVAGPGS
FT                   ALSTWEDLLLFTDLDQAATASKLLWSSRGAKLSPFAAEQPEEMYQTLAALSSQGPAAYD
FT                   GAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLSGLPYLQGAGSGPSNHAGGAGAHP
FT                   GWSQASADSPPYGGGGAAGGGAAGPGGAGSATAHASARFPYSPSPPMANGAARDPGGYV
FT                   AAGGTGAGSVSGGGGSLAAMGGREHQYSSLSAARPLNGTYHHHHHHHPTYSPYMAAPLT
FT                   PAWPAGPFETPVLHSLQGRAGAPLPVPRGPSTDLLEDLSESRECVNCGSIQTPLWRRDG
FT                   TGHYLCNACGLYSKMNGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPV
FT                   CNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNINKSKACSGNSSGSVPMTPTSSSSNS
FT                   DDCTKNTSPSTQATTSGVGASVMSAVGENANPENSDLKYSGQDGLYIGVSLSSPAEVTS
FT                   SVRQDSWCALALA"
FT   assembly_gap    35881..36331
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    41347..43545
FT                   /estimated_length=2199
FT                   /gap_type="unknown"
FT   assembly_gap    72926..75182
FT                   /estimated_length=2257
FT                   /gap_type="unknown"
FT   assembly_gap    87267..90893
FT                   /estimated_length=3627
FT                   /gap_type="unknown"
FT   assembly_gap    92572..185316
FT                   /estimated_length=92745
FT                   /gap_type="unknown"
FT   assembly_gap    188269..189290
FT                   /estimated_length=1022
FT                   /gap_type="unknown"
FT   assembly_gap    195699..195947
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    213833..213852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    239328..242290
FT                   /estimated_length=2963
FT                   /gap_type="unknown"
FT   assembly_gap    275836..275855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    277272..281726
FT                   /estimated_length=4455
FT                   /gap_type="unknown"
FT   assembly_gap    283019..283038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    299590..299609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    362178..363165
FT                   /estimated_length=988
FT                   /gap_type="unknown"
FT   assembly_gap    367576..367951
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    383550..383569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    384743..384762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    386123..387298
FT                   /estimated_length=1176
FT                   /gap_type="unknown"
FT   assembly_gap    397033..397214
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    424520..424863
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    437056..437261
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    444562..444581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    452156..452175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    497389..497433
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    544849..544978
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    569082..569101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    595825..595928
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    596286..596505
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    599673..600018
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    607582..607725
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    620022..620041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    640848..640867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    644336..644423
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    648427..648467
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    671797..671816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    674479..675019
FT                   /estimated_length=541
FT                   /gap_type="unknown"
FT   assembly_gap    716067..716122
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    754166..754333
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    762837..762856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    775980..775999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    839193..840077
FT                   /estimated_length=885
FT                   /gap_type="unknown"
FT   assembly_gap    881317..881336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    883866..884074
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    901569..901900
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    912175..912194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    919979..919998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    922294..923006
FT                   /estimated_length=713
FT                   /gap_type="unknown"
FT   assembly_gap    927420..928312
FT                   /estimated_length=893
FT                   /gap_type="unknown"
FT   assembly_gap    955365..956194
FT                   /estimated_length=830
FT                   /gap_type="unknown"
FT   assembly_gap    958560..958579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    981088..981458
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    1008006..1008160
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    1009620..1009839
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    1057133..1057169
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    1068714..1076241
FT                   /estimated_length=7528
FT                   /gap_type="unknown"
FT   assembly_gap    1112072..1112352
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    1155986..1156081
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    1160364..1160383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1168531..1168617
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1213447..1213587
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    1218719..1219648
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    1226928..1226947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1230923..1230981
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    1247502..1247609
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    1260283..1260427
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1269519..1269538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1270794..1271090
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    1274832..1274851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1295767..1295786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1352905..1353045
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    1396460..1399288
FT                   /estimated_length=2829
FT                   /gap_type="unknown"
FT   assembly_gap    1442523..1442542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1451115..1451134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1459158..1459177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1486754..1487003
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    1494488..1494557
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1508422..1508665
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    1512156..1513618
FT                   /estimated_length=1463
FT                   /gap_type="unknown"
FT   assembly_gap    1527115..1527455
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    1556382..1556435
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    1570141..1570235
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1579078..1582808
FT                   /estimated_length=3731
FT                   /gap_type="unknown"
FT   assembly_gap    1612790..1612809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1614602..1614684
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    1621196..1621769
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    1669202..1669376
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    1700389..1700408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1704703..1706961
FT                   /estimated_length=2259
FT                   /gap_type="unknown"
FT   assembly_gap    1721110..1721129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1743405..1743424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1788814..1789180
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    1801135..1801154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1805892..1805911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1807431..1807450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1845359..1846204
FT                   /estimated_length=846
FT                   /gap_type="unknown"
FT   assembly_gap    1848055..1848074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1858517..1858596
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1860573..1860803
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    1889249..1889268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1926489..1926508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1938079..1938098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1946745..1946764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1984014..1984033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1986999..1987093
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1992423..1993704
FT                   /estimated_length=1282
FT                   /gap_type="unknown"
FT   assembly_gap    1998495..1998583
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    2010604..2010623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2044479..2044685
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    2049101..2049739
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    2071156..2071231
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    2072439..2072754
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    2073631..2073768
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    2090810..2090829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2097579..2097633
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    2102746..2102836
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    2110517..2110825
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    2130809..2133688
FT                   /estimated_length=2880
FT                   /gap_type="unknown"
FT   assembly_gap    2153006..2153025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2189831..2190158
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    2214272..2216320
FT                   /estimated_length=2049
FT                   /gap_type="unknown"
FT   assembly_gap    2224316..2224520
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    2231935..2231954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2244179..2244439
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    2313595..2313614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2319007..2319249
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    2326124..2326143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2342169..2342940
FT                   /estimated_length=772
FT                   /gap_type="unknown"
FT   assembly_gap    2348211..2348410
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    2365768..2366704
FT                   /estimated_length=937
FT                   /gap_type="unknown"
FT   assembly_gap    2391751..2391770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2421494..2421587
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    2450283..2450302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2459628..2459738
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    2471003..2471747
FT                   /estimated_length=745
FT                   /gap_type="unknown"
FT   assembly_gap    2476626..2476674
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    2479874..2481190
FT                   /estimated_length=1317
FT                   /gap_type="unknown"
FT   assembly_gap    2490292..2490340
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    2491457..2491476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2503548..2503652
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    2540866..2540885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2597736..2597855
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    2620248..2623173
FT                   /estimated_length=2926
FT                   /gap_type="unknown"
FT   assembly_gap    2624190..2624610
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    2626120..2626522
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    2635528..2636159
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    2669949..2669968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2671588..2671607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2717510..2717529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2795435..2803149
FT                   /estimated_length=7715
FT                   /gap_type="unknown"
FT   assembly_gap    2833986..2834330
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    2843463..2843482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2847475..2847494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2868774..2869096
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    2884372..2884431
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    2886545..2886899
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    2889379..2889398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2894805..2894824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2910393..2910518
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    2923968..2924606
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    2939690..2943349
FT                   /estimated_length=3660
FT                   /gap_type="unknown"
FT   assembly_gap    2972612..2972859
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    2978220..2978325
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    2997921..2997940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3002087..3002634
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    3007597..3007889
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    3050165..3050197
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    3052974..3052993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3056526..3056545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3070200..3070219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3127333..3128698
FT                   /estimated_length=1366
FT                   /gap_type="unknown"
FT   assembly_gap    3131020..3131039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3133632..3133836
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    3136352..3136455
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    3158849..3158868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3175252..3175271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3192902..3192921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3203166..3203946
FT                   /estimated_length=781
FT                   /gap_type="unknown"
FT   assembly_gap    3217554..3217573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3254826..3254845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3289542..3289567
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    3306224..3306556
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    3311928..3311947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3334749..3334922
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    3362152..3362374
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    3394393..3396745
FT                   /estimated_length=2353
FT                   /gap_type="unknown"
FT   assembly_gap    3397803..3401103
FT                   /estimated_length=3301
FT                   /gap_type="unknown"
FT   assembly_gap    3432379..3432398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3494842..3494900
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    3512385..3512550
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    3538150..3538608
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    3572653..3572743
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    3577290..3577309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3584532..3584551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3589774..3590135
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    3609463..3609538
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    3674544..3674563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3711557..3711576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3713964..3714935
FT                   /estimated_length=972
FT                   /gap_type="unknown"
FT   assembly_gap    3717062..3717081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3730528..3731258
FT                   /estimated_length=731
FT                   /gap_type="unknown"
FT   assembly_gap    3734247..3734266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3751596..3751615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3757017..3757089
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    3791627..3791646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3847237..3848292
FT                   /estimated_length=1056
FT                   /gap_type="unknown"
FT   assembly_gap    3878653..3878672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3901239..3902398
FT                   /estimated_length=1160
FT                   /gap_type="unknown"
FT   assembly_gap    3907896..3907915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3909111..3909130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3994725..3994744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4018979..4018998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4020451..4020470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4024176..4024195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4026201..4026220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4066022..4066149
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    4115979..4116457
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   assembly_gap    4119918..4120107
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    4138313..4139358
FT                   /estimated_length=1046
FT                   /gap_type="unknown"
FT   assembly_gap    4152041..4152060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4197635..4197722
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    4300802..4301566
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   assembly_gap    4326893..4327786
FT                   /estimated_length=894
FT                   /gap_type="unknown"
FT   assembly_gap    4370066..4370085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4418678..4419032
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    4438491..4438709
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    4443032..4443051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4457188..4457207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4516530..4516744
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    4536830..4538060
FT                   /estimated_length=1231
FT                   /gap_type="unknown"
FT   assembly_gap    4541566..4543949
FT                   /estimated_length=2384
FT                   /gap_type="unknown"
FT   assembly_gap    4547094..4547343
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    4552536..4552780
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    4565858..4566442
FT                   /estimated_length=585
FT                   /gap_type="unknown"
FT   assembly_gap    4571244..4571315
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    4576056..4580376
FT                   /estimated_length=4321
FT                   /gap_type="unknown"
FT   assembly_gap    4654607..4654626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4655730..4657381
FT                   /estimated_length=1652
FT                   /gap_type="unknown"
FT   assembly_gap    4659446..4659512
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    4676047..4677187
FT                   /estimated_length=1141
FT                   /gap_type="unknown"
FT   assembly_gap    4700313..4700623
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    4745847..4745866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4797878..4797963
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    4803323..4803342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4829759..4835049
FT                   /estimated_length=5291
FT                   /gap_type="unknown"
FT   assembly_gap    4859946..4860060
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    4915829..4915896
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    4916460..4916660
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    4980844..4980863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4990216..4990235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5058473..5058505
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    5060509..5064929
FT                   /estimated_length=4421
FT                   /gap_type="unknown"
FT   assembly_gap    5106383..5106402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5121537..5121556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5181683..5181702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5181981..5182081
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5186682..5186701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5211321..5211340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5212765..5214405
FT                   /estimated_length=1641
FT                   /gap_type="unknown"
FT   assembly_gap    5231746..5231800
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5276744..5277252
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    5281584..5281603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5293838..5293857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5297226..5297245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5327232..5327251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5341547..5341634
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    5387413..5387795
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    5398939..5399062
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    5419749..5419873
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    5444343..5444362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5498618..5498637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5572861..5572880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5582639..5582658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5628144..5628163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5637616..5637718
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    5649476..5650999
FT                   /estimated_length=1524
FT                   /gap_type="unknown"
FT   assembly_gap    5653804..5653823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5661303..5661322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5681297..5681316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5682349..5682702
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    5715797..5715816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5737991..5741205
FT                   /estimated_length=3215
FT                   /gap_type="unknown"
FT   assembly_gap    5766677..5770254
FT                   /estimated_length=3578
FT                   /gap_type="unknown"
FT   assembly_gap    5771536..5774689
FT                   /estimated_length=3154
FT                   /gap_type="unknown"
FT   assembly_gap    5793630..5793677
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    5826360..5827082
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    5830335..5830354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5833020..5833039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5880033..5880217
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    5886041..5886060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5888977..5894666
FT                   /estimated_length=5690
FT                   /gap_type="unknown"
FT   assembly_gap    5895489..5895577
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    5916783..5916914
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    5919263..5920769
FT                   /estimated_length=1507
FT                   /gap_type="unknown"
FT   assembly_gap    5980569..5980611
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    5994401..5994767
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    6021030..6021495
FT                   /estimated_length=466
FT                   /gap_type="unknown"
FT   assembly_gap    6078081..6078100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6082640..6082925
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    6084992..6085313
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    6137994..6138593
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    6155444..6158185
FT                   /estimated_length=2742
FT                   /gap_type="unknown"
FT   assembly_gap    6177373..6177392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6194821..6195024
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    6203294..6203322
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    6205297..6205316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6217347..6217518
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    6218298..6219853
FT                   /estimated_length=1556
FT                   /gap_type="unknown"
FT   assembly_gap    6224526..6224545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6226093..6226125
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    6247451..6247470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6281018..6281037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6290518..6290537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6302875..6303435
FT                   /estimated_length=561
FT                   /gap_type="unknown"
FT   assembly_gap    6304587..6304606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6308248..6308320
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    6327340..6327811
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    6364362..6364497
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    6388402..6388642
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    6458635..6459119
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    6459961..6460157
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    6467515..6467769
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    6486346..6486531
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    6490831..6490850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6492517..6492536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6493529..6496391
FT                   /estimated_length=2863
FT                   /gap_type="unknown"
FT   assembly_gap    6533602..6533621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6554488..6554507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6570504..6571142
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    6572051..6572752
FT                   /estimated_length=702
FT                   /gap_type="unknown"
FT   assembly_gap    6577093..6589588
FT                   /estimated_length=12496
FT                   /gap_type="unknown"
FT   assembly_gap    6647581..6647603
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    6666253..6666272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6670527..6670765
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    6706022..6706041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6707988..6708007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6709082..6709101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6710688..6718759
FT                   /estimated_length=8072
FT                   /gap_type="unknown"
FT   assembly_gap    6746662..6746681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6769340..6769359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6789512..6789555
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    6809374..6809749
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    6819062..6819247
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    6842498..6843184
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    6856482..6856619
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    6895086..6895245
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    6910878..6911956
FT                   /estimated_length=1079
FT                   /gap_type="unknown"
FT   assembly_gap    6945295..6945314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7007009..7007028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7013222..7013241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7042893..7042912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7059724..7059869
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    7065468..7065487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7087920..7087944
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    7123472..7123491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7133908..7133927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7137712..7137746
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    7214453..7214665
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    7225565..7226058
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    7237130..7237149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7330980..7330999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7333139..7333309
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    7341413..7341432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7367204..7367223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7380798..7380886
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    7382510..7382529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7393149..7393168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7405174..7405463
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    7575961..7575980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7588610..7588950
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    7599983..7600002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7883351..7883370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7906652..7911394
FT                   /estimated_length=4743
FT                   /gap_type="unknown"
FT   assembly_gap    7938169..7938188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7976440..7976459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8021136..8021185
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    8024910..8024929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8072861..8072880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8089793..8089812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8121223..8121242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8199156..8216621
FT                   /estimated_length=17466
FT                   /gap_type="unknown"
FT   assembly_gap    8219293..8219585
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    8247819..8248349
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    8305074..8305093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8328772..8331333
FT                   /estimated_length=2562
FT                   /gap_type="unknown"
FT   assembly_gap    8362665..8362684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8410405..8411738
FT                   /estimated_length=1334
FT                   /gap_type="unknown"
FT   assembly_gap    8413256..8419827
FT                   /estimated_length=6572
FT                   /gap_type="unknown"
FT   assembly_gap    8438952..8438971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8518669..8518788
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    8594760..8594779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8609979..8609998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8652622..8655776
FT                   /estimated_length=3155
FT                   /gap_type="unknown"
FT   assembly_gap    8656882..8657002
FT                   /estimated_length=121
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01136092.1:1..35880),gap(451),
CO   complement(AAHY01136093.1:1..5015),gap(2199),
CO   complement(AAHY01136094.1:1..29380),gap(2257),
CO   complement(AAHY01136095.1:1..12084),gap(3627),
CO   complement(AAHY01136096.1:1..1678),gap(92745),
CO   complement(AAHY01136097.1:1..2952),gap(1022),
CO   complement(AAHY01136098.1:1..6408),gap(249),AAHY01136099.1:1..17885,
CO   gap(20),complement(AAHY01136100.1:1..25475),gap(2963),
CO   complement(AAHY01136101.1:1..33545),gap(20),
CO   complement(AAHY01136102.1:1..1416),gap(4455),
CO   complement(AAHY01136103.1:1..1292),gap(20),AAHY01136104.1:1..16551,gap(20),
CO   complement(AAHY01136105.1:1..62568),gap(988),
CO   complement(AAHY01136106.1:1..4410),gap(376),AAHY01136107.1:1..15598,
CO   gap(20),AAHY01136108.1:1..1173,gap(20),AAHY01136109.1:1..1360,gap(1176),
CO   complement(AAHY01136110.1:1..9734),gap(182),AAHY01136111.1:1..27305,
CO   gap(344),AAHY01136112.1:1..12192,gap(206),
CO   complement(AAHY01136113.1:1..7300),gap(20),
CO   complement(AAHY01136114.1:1..7574),gap(20),
CO   complement(AAHY01136115.1:1..45213),gap(45),
CO   complement(AAHY01136116.1:1..47415),gap(130),
CO   complement(AAHY01136117.1:1..24103),gap(20),
CO   complement(AAHY01136118.1:1..26723),gap(104),AAHY01136119.1:1..357,
CO   gap(220),complement(AAHY01136120.1:1..3167),gap(346),
CO   complement(AAHY01136121.1:1..7563),gap(144),
CO   complement(AAHY01136122.1:1..12296),gap(20),
CO   complement(AAHY01136123.1:1..20806),gap(20),
CO   complement(AAHY01136124.1:1..3468),gap(88),AAHY01136125.1:1..4003,gap(41),
CO   complement(AAHY01136126.1:1..23329),gap(20),
CO   complement(AAHY01136127.1:1..2662),gap(541),
CO   complement(AAHY01136128.1:1..41047),gap(56),
CO   complement(AAHY01136129.1:1..38043),gap(168),
CO   complement(AAHY01136130.1:1..8503),gap(20),AAHY01136131.1:1..13123,gap(20),
CO   complement(AAHY01136132.1:1..63193),gap(885),
CO   complement(AAHY01136133.1:1..41239),gap(20),
CO   complement(AAHY01136134.1:1..2529),gap(209),
CO   complement(AAHY01136135.1:1..17494),gap(332),
CO   complement(AAHY01136136.1:1..10274),gap(20),
CO   complement(AAHY01136137.1:1..7784),gap(20),
CO   complement(AAHY01136138.1:1..2295),gap(713),
CO   complement(AAHY01136139.1:1..4413),gap(893),
CO   complement(AAHY01136140.1:1..27052),gap(830),
CO   complement(AAHY01136141.1:1..2365),gap(20),
CO   complement(AAHY01136142.1:1..22508),gap(371),
CO   complement(AAHY01136143.1:1..26547),gap(155),
CO   complement(AAHY01136144.1:1..1459),gap(220),
CO   complement(AAHY01136145.1:1..47293),gap(37),
CO   complement(AAHY01136146.1:1..11544),gap(7528),
CO   complement(AAHY01136147.1:1..35830),gap(281),
CO   complement(AAHY01136148.1:1..43633),gap(96),AAHY01136149.1:1..4282,gap(20),
CO   complement(AAHY01136150.1:1..8147),gap(87),
CO   complement(AAHY01136151.1:1..44829),gap(141),
CO   complement(AAHY01136152.1:1..5131),gap(930),
CO   complement(AAHY01136153.1:1..7279),gap(20),AAHY01136154.1:1..3975,gap(59),
CO   complement(AAHY01136155.1:1..16520),gap(108),AAHY01136156.1:1..12673,
CO   gap(145),complement(AAHY01136157.1:1..9091),gap(20),
CO   complement(AAHY01136158.1:1..1255),gap(297),
CO   complement(AAHY01136159.1:1..3741),gap(20),
CO   complement(AAHY01136160.1:1..20915),gap(20),
CO   complement(AAHY01136161.1:1..57118),gap(141),AAHY01136162.1:1..43414,
CO   gap(2829),AAHY01136163.1:1..43234,gap(20),AAHY01136164.1:1..8572,gap(20),
CO   AAHY01136165.1:1..8023,gap(20),AAHY01136166.1:1..27576,gap(250),
CO   complement(AAHY01136167.1:1..7484),gap(70),
CO   complement(AAHY01136168.1:1..13864),gap(244),
CO   complement(AAHY01136169.1:1..3490),gap(1463),
CO   complement(AAHY01136170.1:1..13496),gap(341),
CO   complement(AAHY01136171.1:1..28926),gap(54),AAHY01136172.1:1..13705,
CO   gap(95),complement(AAHY01136173.1:1..8842),gap(3731),
CO   complement(AAHY01136174.1:1..29981),gap(20),
CO   complement(AAHY01136175.1:1..1792),gap(83),
CO   complement(AAHY01136176.1:1..6511),gap(574),AAHY01136177.1:1..47432,
CO   gap(175),AAHY01136178.1:1..31012,gap(20),
CO   complement(AAHY01136179.1:1..4294),gap(2259),
CO   complement(AAHY01136180.1:1..14148),gap(20),
CO   complement(AAHY01136181.1:1..22275),gap(20),
CO   complement(AAHY01136182.1:1..45389),gap(367),
CO   complement(AAHY01136183.1:1..11954),gap(20),AAHY01136184.1:1..4737,gap(20),
CO   complement(AAHY01136185.1:1..1519),gap(20),AAHY01136186.1:1..37908,
CO   gap(846),AAHY01136187.1:1..1850,gap(20),
CO   complement(AAHY01136188.1:1..10442),gap(80),
CO   complement(AAHY01136189.1:1..1976),gap(231),AAHY01136190.1:1..28445,
CO   gap(20),complement(AAHY01136191.1:1..37220),gap(20),
CO   complement(AAHY01136192.1:1..11570),gap(20),AAHY01136193.1:1..8646,gap(20),
CO   complement(AAHY01136194.1:1..37249),gap(20),AAHY01136195.1:1..2965,gap(95),
CO   AAHY01136196.1:1..5329,gap(1282),AAHY01136197.1:1..4790,gap(89),
CO   AAHY01136198.1:1..12020,gap(20),complement(AAHY01136199.1:1..33855),
CO   gap(207),complement(AAHY01136200.1:1..4415),gap(639),
CO   complement(AAHY01136201.1:1..21416),gap(76),
CO   complement(AAHY01136202.1:1..1207),gap(316),
CO   complement(AAHY01136203.1:1..876),gap(138),
CO   complement(AAHY01136204.1:1..17041),gap(20),
CO   complement(AAHY01136205.1:1..6749),gap(55),
CO   complement(AAHY01136206.1:1..5112),gap(91),
CO   complement(AAHY01136207.1:1..7680),gap(309),
CO   complement(AAHY01136208.1:1..19983),gap(2880),
CO   complement(AAHY01136209.1:1..19317),gap(20),
CO   complement(AAHY01136210.1:1..36805),gap(328),
CO   complement(AAHY01136211.1:1..24113),gap(2049),
CO   complement(AAHY01136212.1:1..7995),gap(205),
CO   complement(AAHY01136213.1:1..7414),gap(20),AAHY01136214.1:1..12224,
CO   gap(261),complement(AAHY01136215.1:1..69155),gap(20),
CO   complement(AAHY01136216.1:1..5392),gap(243),AAHY01136217.1:1..6874,gap(20),
CO   AAHY01136218.1:1..16025,gap(772),complement(AAHY01136219.1:1..5270),
CO   gap(200),complement(AAHY01136220.1:1..17357),gap(937),
CO   complement(AAHY01136221.1:1..25046),gap(20),AAHY01136222.1:1..29723,
CO   gap(94),AAHY01136223.1:1..28695,gap(20),complement(AAHY01136224.1:1..9325),
CO   gap(111),complement(AAHY01136225.1:1..11264),gap(745),
CO   AAHY01136226.1:1..4878,gap(49),AAHY01136227.1:1..3199,gap(1317),
CO   AAHY01136228.1:1..9101,gap(49),AAHY01136229.1:1..1116,gap(20),
CO   complement(AAHY01136230.1:1..12071),gap(105),AAHY01136231.1:1..37213,
CO   gap(20),complement(AAHY01136232.1:1..56850),gap(120),
CO   complement(AAHY01136233.1:1..22392),gap(2926),
CO   complement(AAHY01136234.1:1..1016),gap(421),
CO   complement(AAHY01136235.1:1..1509),gap(403),AAHY01136236.1:1..9005,
CO   gap(632),complement(AAHY01136237.1:1..33789),gap(20),
CO   complement(AAHY01136238.1:1..1619),gap(20),
CO   complement(AAHY01136239.1:1..45902),gap(20),
CO   complement(AAHY01136240.1:1..77905),gap(7715),
CO   complement(AAHY01136241.1:1..30836),gap(345),AAHY01136242.1:1..9132,
CO   gap(20),complement(AAHY01136243.1:1..3992),gap(20),
CO   complement(AAHY01136244.1:1..21279),gap(323),
CO   complement(AAHY01136245.1:1..15275),gap(60),
CO   complement(AAHY01136246.1:1..2113),gap(355),
CO   complement(AAHY01136247.1:1..2479),gap(20),
CO   complement(AAHY01136248.1:1..5406),gap(20),
CO   complement(AAHY01136249.1:1..15568),gap(126),
CO   complement(AAHY01136250.1:1..13449),gap(639),
CO   complement(AAHY01136251.1:1..15083),gap(3660),
CO   complement(AAHY01136252.1:1..29262),gap(248),
CO   complement(AAHY01136253.1:1..5360),gap(106),
CO   complement(AAHY01136254.1:1..19595),gap(20),
CO   complement(AAHY01136255.1:1..4146),gap(548),AAHY01136256.1:1..4962,
CO   gap(293),complement(AAHY01136257.1:1..42275),gap(33),
CO   complement(AAHY01136258.1:1..2776),gap(20),AAHY01136259.1:1..3532,gap(20),
CO   complement(AAHY01136260.1:1..13654),gap(20),
CO   complement(AAHY01136261.1:1..57113),gap(1366),
CO   complement(AAHY01136262.1:1..2321),gap(20),
CO   complement(AAHY01136263.1:1..2592),gap(205),
CO   complement(AAHY01136264.1:1..2515),gap(104),
CO   complement(AAHY01136265.1:1..22393),gap(20),
CO   complement(AAHY01136266.1:1..16383),gap(20),
CO   complement(AAHY01136267.1:1..17630),gap(20),
CO   complement(AAHY01136268.1:1..10244),gap(781),
CO   complement(AAHY01136269.1:1..13607),gap(20),
CO   complement(AAHY01136270.1:1..37252),gap(20),
CO   complement(AAHY01136271.1:1..34696),gap(26),
CO   complement(AAHY01136272.1:1..16656),gap(333),
CO   complement(AAHY01136273.1:1..5371),gap(20),
CO   complement(AAHY01136274.1:1..22801),gap(174),
CO   complement(AAHY01136275.1:1..27229),gap(223),
CO   complement(AAHY01136276.1:1..32018),gap(2353),AAHY01136277.1:1..1057,
CO   gap(3301),complement(AAHY01136278.1:1..31275),gap(20),
CO   complement(AAHY01136279.1:1..62443),gap(59),
CO   complement(AAHY01136280.1:1..17484),gap(166),
CO   complement(AAHY01136281.1:1..25599),gap(459),
CO   complement(AAHY01136282.1:1..34044),gap(91),AAHY01136283.1:1..4546,gap(20),
CO   AAHY01136284.1:1..7222,gap(20),complement(AAHY01136285.1:1..5222),gap(362),
CO   complement(AAHY01136286.1:1..19327),gap(76),
CO   complement(AAHY01136287.1:1..65005),gap(20),
CO   complement(AAHY01136288.1:1..36993),gap(20),
CO   complement(AAHY01136289.1:1..2387),gap(972),
CO   complement(AAHY01136290.1:1..2126),gap(20),
CO   complement(AAHY01136291.1:1..13446),gap(731),
CO   complement(AAHY01136292.1:1..2988),gap(20),
CO   complement(AAHY01136293.1:1..17329),gap(20),
CO   complement(AAHY01136294.1:1..5401),gap(73),
CO   complement(AAHY01136295.1:1..34537),gap(20),
CO   complement(AAHY01136296.1:1..55590),gap(1056),
CO   complement(AAHY01136297.1:1..30360),gap(20),
CO   complement(AAHY01136298.1:1..22566),gap(1160),
CO   complement(AAHY01136299.1:1..5497),gap(20),
CO   complement(AAHY01136300.1:1..1195),gap(20),
CO   complement(AAHY01136301.1:1..85594),gap(20),AAHY01136302.1:1..24234,
CO   gap(20),AAHY01136303.1:1..1452,gap(20),complement(AAHY01136304.1:1..3705),
CO   gap(20),complement(AAHY01136305.1:1..2005),gap(20),AAHY01136306.1:1..39801,
CO   gap(128),complement(AAHY01136307.1:1..49829),gap(479),
CO   complement(AAHY01136308.1:1..3460),gap(190),
CO   complement(AAHY01136309.1:1..18205),gap(1046),AAHY01136310.1:1..12682,
CO   gap(20),AAHY01136311.1:1..45574,gap(88),
CO   complement(AAHY01136312.1:1..103079),gap(765),
CO   complement(AAHY01136313.1:1..25326),gap(894),
CO   complement(AAHY01136314.1:1..42279),gap(20),
CO   complement(AAHY01136315.1:1..48592),gap(355),
CO   complement(AAHY01136316.1:1..19458),gap(219),
CO   complement(AAHY01136317.1:1..4322),gap(20),
CO   complement(AAHY01136318.1:1..14136),gap(20),AAHY01136319.1:1..59322,
CO   gap(215),AAHY01136320.1:1..20085,gap(1231),
CO   complement(AAHY01136321.1:1..3505),gap(2384),AAHY01136322.1:1..3144,
CO   gap(250),complement(AAHY01136323.1:1..5192),gap(245),
CO   AAHY01136324.1:1..13077,gap(585),complement(AAHY01136325.1:1..4801),
CO   gap(72),complement(AAHY01136326.1:1..4740),gap(4321),
CO   complement(AAHY01136327.1:1..74230),gap(20),AAHY01136328.1:1..1103,
CO   gap(1652),AAHY01136329.1:1..2064,gap(67),AAHY01136330.1:1..16534,gap(1141),
CO   complement(AAHY01136331.1:1..23125),gap(311),
CO   complement(AAHY01136332.1:1..45223),gap(20),
CO   complement(AAHY01136333.1:1..52011),gap(86),
CO   complement(AAHY01136334.1:1..5359),gap(20),
CO   complement(AAHY01136335.1:1..26416),gap(5291),
CO   complement(AAHY01136336.1:1..24896),gap(115),
CO   complement(AAHY01136337.1:1..55768),gap(68),
CO   complement(AAHY01136338.1:1..563),gap(201),
CO   complement(AAHY01136339.1:1..64183),gap(20),
CO   complement(AAHY01136340.1:1..9352),gap(20),
CO   complement(AAHY01136341.1:1..68237),gap(33),
CO   complement(AAHY01136342.1:1..2003),gap(4421),
CO   complement(AAHY01136343.1:1..41453),gap(20),
CO   complement(AAHY01136344.1:1..15134),gap(20),
CO   complement(AAHY01136345.1:1..60126),gap(20),
CO   complement(AAHY01136346.1:1..278),gap(101),
CO   complement(AAHY01136347.1:1..4600),gap(20),
CO   complement(AAHY01136348.1:1..24619),gap(20),
CO   complement(AAHY01136349.1:1..1424),gap(1641),
CO   complement(AAHY01136350.1:1..17340),gap(55),
CO   complement(AAHY01136351.1:1..44943),gap(509),
CO   complement(AAHY01136352.1:1..4331),gap(20),
CO   complement(AAHY01136353.1:1..12234),gap(20),
CO   complement(AAHY01136354.1:1..3368),gap(20),
CO   complement(AAHY01136355.1:1..29986),gap(20),
CO   complement(AAHY01136356.1:1..14295),gap(88),
CO   complement(AAHY01136357.1:1..45778),gap(383),
CO   complement(AAHY01136358.1:1..11143),gap(124),
CO   complement(AAHY01136359.1:1..20686),gap(125),AAHY01136360.1:1..24469,
CO   gap(20),complement(AAHY01136361.1:1..54255),gap(20),
CO   complement(AAHY01136362.1:1..74223),gap(20),
CO   complement(AAHY01136363.1:1..9758),gap(20),
CO   complement(AAHY01136364.1:1..45485),gap(20),
CO   complement(AAHY01136365.1:1..9452),gap(103),
CO   complement(AAHY01136366.1:1..11757),gap(1524),AAHY01136367.1:1..2804,
CO   gap(20),complement(AAHY01136368.1:1..7479),gap(20),
CO   complement(AAHY01136369.1:1..19974),gap(20),
CO   complement(AAHY01136370.1:1..1032),gap(354),
CO   complement(AAHY01136371.1:1..33094),gap(20),
CO   complement(AAHY01136372.1:1..22174),gap(3215),
CO   complement(AAHY01136373.1:1..25471),gap(3578),
CO   complement(AAHY01136374.1:1..1281),gap(3154),
CO   complement(AAHY01136375.1:1..18940),gap(48),
CO   complement(AAHY01136376.1:1..32682),gap(723),
CO   complement(AAHY01136377.1:1..3252),gap(20),
CO   complement(AAHY01136378.1:1..2665),gap(20),
CO   complement(AAHY01136379.1:1..46993),gap(185),
CO   complement(AAHY01136380.1:1..5823),gap(20),AAHY01136381.1:1..2916,
CO   gap(5690),AAHY01136382.1:1..822,gap(89),
CO   complement(AAHY01136383.1:1..21205),gap(132),
CO   complement(AAHY01136384.1:1..2348),gap(1507),
CO   complement(AAHY01136385.1:1..59799),gap(43),
CO   complement(AAHY01136386.1:1..13789),gap(367),
CO   complement(AAHY01136387.1:1..26262),gap(466),
CO   complement(AAHY01136388.1:1..56585),gap(20),
CO   complement(AAHY01136389.1:1..4539),gap(286),
CO   complement(AAHY01136390.1:1..2066),gap(322),
CO   complement(AAHY01136391.1:1..52680),gap(600),
CO   complement(AAHY01136392.1:1..16850),gap(2742),
CO   complement(AAHY01136393.1:1..19187),gap(20),
CO   complement(AAHY01136394.1:1..17428),gap(204),
CO   complement(AAHY01136395.1:1..8269),gap(29),
CO   complement(AAHY01136396.1:1..1974),gap(20),
CO   complement(AAHY01136397.1:1..12030),gap(172),
CO   complement(AAHY01136398.1:1..779),gap(1556),
CO   complement(AAHY01136399.1:1..4672),gap(20),
CO   complement(AAHY01136400.1:1..1547),gap(33),
CO   complement(AAHY01136401.1:1..21325),gap(20),
CO   complement(AAHY01136402.1:1..33547),gap(20),
CO   complement(AAHY01136403.1:1..9480),gap(20),AAHY01136404.1:1..12337,
CO   gap(561),AAHY01136405.1:1..1151,gap(20),complement(AAHY01136406.1:1..3641),
CO   gap(73),complement(AAHY01136407.1:1..19019),gap(472),
CO   complement(AAHY01136408.1:1..36550),gap(136),
CO   complement(AAHY01136409.1:1..23904),gap(241),
CO   complement(AAHY01136410.1:1..69992),gap(485),AAHY01136411.1:1..841,
CO   gap(197),complement(AAHY01136412.1:1..7357),gap(255),
CO   AAHY01136413.1:1..18576,gap(186),complement(AAHY01136414.1:1..4299),
CO   gap(20),complement(AAHY01136415.1:1..1666),gap(20),
CO   complement(AAHY01136416.1:1..992),gap(2863),
CO   complement(AAHY01136417.1:1..37210),gap(20),
CO   complement(AAHY01136418.1:1..20866),gap(20),
CO   complement(AAHY01136419.1:1..15996),gap(639),AAHY01136420.1:1..908,
CO   gap(702),complement(AAHY01136421.1:1..4340),gap(12496),
CO   complement(AAHY01136422.1:1..57992),gap(23),
CO   complement(AAHY01136423.1:1..18649),gap(20),
CO   complement(AAHY01136424.1:1..4254),gap(239),
CO   complement(AAHY01136425.1:1..35256),gap(20),
CO   complement(AAHY01136426.1:1..1946),gap(20),AAHY01136427.1:1..1074,gap(20),
CO   AAHY01136428.1:1..1586,gap(8072),complement(AAHY01136429.1:1..27902),
CO   gap(20),complement(AAHY01136430.1:1..22658),gap(20),
CO   complement(AAHY01136431.1:1..20152),gap(44),AAHY01136432.1:1..19818,
CO   gap(376),complement(AAHY01136433.1:1..9312),gap(186),
CO   complement(AAHY01136434.1:1..23250),gap(687),
CO   complement(AAHY01136435.1:1..13297),gap(138),
CO   complement(AAHY01136436.1:1..38466),gap(160),
CO   complement(AAHY01136437.1:1..15632),gap(1079),
CO   complement(AAHY01136438.1:1..33338),gap(20),
CO   complement(AAHY01136439.1:1..61694),gap(20),AAHY01136440.1:1..6193,gap(20),
CO   complement(AAHY01136441.1:1..29651),gap(20),
CO   complement(AAHY01136442.1:1..16811),gap(146),
CO   complement(AAHY01136443.1:1..5598),gap(20),
CO   complement(AAHY01136444.1:1..22432),gap(25),
CO   complement(AAHY01136445.1:1..35527),gap(20),
CO   complement(AAHY01136446.1:1..10416),gap(20),
CO   complement(AAHY01136447.1:1..3784),gap(35),AAHY01136448.1:1..76706,
CO   gap(213),complement(AAHY01136449.1:1..10899),gap(494),
CO   complement(AAHY01136450.1:1..11071),gap(20),
CO   complement(AAHY01136451.1:1..93830),gap(20),AAHY01136452.1:1..2139,
CO   gap(171),AAHY01136453.1:1..8103,gap(20),
CO   complement(AAHY01136454.1:1..25771),gap(20),AAHY01136455.1:1..13574,
CO   gap(89),complement(AAHY01136456.1:1..1623),gap(20),
CO   complement(AAHY01136457.1:1..10619),gap(20),AAHY01136458.1:1..12005,
CO   gap(290),complement(AAHY01136459.1:1..170497),gap(20),
CO   AAHY01136460.1:1..12629,gap(341),complement(AAHY01136461.1:1..11032),
CO   gap(20),complement(AAHY01136462.1:1..283348),gap(20),
CO   complement(AAHY01136463.1:1..23281),gap(4743),
CO   complement(AAHY01136464.1:1..26774),gap(20),AAHY01136465.1:1..38251,
CO   gap(20),AAHY01136466.1:1..44676,gap(50),AAHY01136467.1:1..3724,gap(20),
CO   AAHY01136468.1:1..47931,gap(20),complement(AAHY01136469.1:1..16912),
CO   gap(20),complement(AAHY01136470.1:1..31410),gap(20),
CO   complement(AAHY01136471.1:1..77913),gap(17466),
CO   complement(AAHY01136472.1:1..2671),gap(293),
CO   complement(AAHY01136473.1:1..28233),gap(531),
CO   complement(AAHY01136474.1:1..56724),gap(20),AAHY01136475.1:1..23678,
CO   gap(2562),complement(AAHY01136476.1:1..31331),gap(20),
CO   complement(AAHY01136477.1:1..47720),gap(1334),
CO   complement(AAHY01136478.1:1..1517),gap(6572),
CO   complement(AAHY01136479.1:1..19124),gap(20),
CO   complement(AAHY01136480.1:1..79697),gap(120),
CO   complement(AAHY01136481.1:1..75971),gap(20),
CO   complement(AAHY01136482.1:1..15199),gap(20),AAHY01136483.1:1..42623,
CO   gap(3155),complement(AAHY01136484.1:1..1105),gap(121),
CO   complement(AAHY01136485.1:1..1178))
//


spacer
spacer