spacer

EBI Dbfetch

ID   CH466588; SV 1; linear; genomic DNA; CON; MUS; 9556451 BP.
XX
AC   CH466588;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009815415 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-9556451
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-9556451
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; f7c3bfe6d97c955113709797faf89536.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000221.
DR   Ensembl-Gn; ENSMUSG00000000078; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021156; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021210; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021214; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044988; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046159; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050244; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052374; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054757; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058258; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061988; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071551; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000093904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021630; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021635; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059270; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062658; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064204; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081326; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110636; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110637; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118663; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118717; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124888; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179857; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9556451
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <2288..11948
FT                   /locus_tag="mCG_1034314"
FT                   /note="gene_id=mCG1034314.1"
FT   mRNA            join(<2288..2496,2876..2976,11584..11948)
FT                   /locus_tag="mCG_1034314"
FT                   /product="mCG1034314"
FT                   /note="gene_id=mCG1034314.1 transcript_id=mCT152018.1
FT                   created on 10-APR-2002"
FT   CDS             join(<2289..2496,2876..2943)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034314"
FT                   /product="mCG1034314"
FT                   /note="gene_id=mCG1034314.1 transcript_id=mCT152018.1
FT                   protein_id=mCP51539.1"
FT                   /protein_id="EDL32212.1"
FT                   /translation="LHCLYWKASYIDGAPHEHDESSCEGTEPSAIQPLFGNFIFLLSLA
FT                   VCYMLPVEWNICRHFKGTALCPTKAPGTTDFGSVGSIWIKSSIVAD"
FT   gene            <80264..109763
FT                   /locus_tag="mCG_1034327"
FT                   /note="gene_id=mCG1034327.1"
FT   mRNA            join(<80264..80392,107525..107669,108311..108482,
FT                   109226..109575,109681..109763)
FT                   /locus_tag="mCG_1034327"
FT                   /product="mCG1034327"
FT                   /note="gene_id=mCG1034327.1 transcript_id=mCT152031.1
FT                   created on 10-APR-2002"
FT   CDS             join(<80320..80392,107525..107669,108311..108482,
FT                   109226..109273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034327"
FT                   /product="mCG1034327"
FT                   /note="gene_id=mCG1034327.1 transcript_id=mCT152031.1
FT                   protein_id=mCP51532.1"
FT                   /protein_id="EDL32213.1"
FT                   /translation="AFICPPKARSFMSGDCYEFVQTKIGPTTGKNLLYEKLKMKEKEVM
FT                   SFLHNLEMEYTEARENNQELKKEINVYRRLLMEKNLIKKKLVILKQESKKVQTDWALIH
FT                   QYLVDLHLSGKDEQEKTSNLETQEHQVSETSRELGLPTAQE"
FT   gene            complement(96060..>96585)
FT                   /locus_tag="mCG_1034340"
FT                   /note="gene_id=mCG1034340.1"
FT   mRNA            complement(join(96060..96191,96321..96411,96486..>96585))
FT                   /locus_tag="mCG_1034340"
FT                   /product="mCG1034340"
FT                   /note="gene_id=mCG1034340.1 transcript_id=mCT152044.1
FT                   created on 10-APR-2002"
FT   CDS             complement(join(96170..96191,96321..96411,96486..>96510))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034340"
FT                   /product="mCG1034340"
FT                   /note="gene_id=mCG1034340.1 transcript_id=mCT152044.1
FT                   protein_id=mCP51601.1"
FT                   /protein_id="EDL32214.1"
FT                   /translation="ERTRQLVALSETYDPRSLGRTLDKIEASIKLPGSRHKVTYAFFSH
FT                   "
FT   gene            complement(110702..111831)
FT                   /pseudo
FT                   /locus_tag="mCG_1034320"
FT                   /note="gene_id=mCG1034320.1"
FT   mRNA            complement(110702..111831)
FT                   /pseudo
FT                   /locus_tag="mCG_1034320"
FT                   /note="gene_id=mCG1034320.1 transcript_id=mCT152024.1
FT                   created on 10-APR-2002"
FT   gene            complement(123799..>126531)
FT                   /locus_tag="mCG_50057"
FT                   /note="gene_id=mCG50057.1"
FT   mRNA            complement(join(123799..125542,125609..>126531))
FT                   /locus_tag="mCG_50057"
FT                   /product="mCG50057"
FT                   /note="gene_id=mCG50057.1 transcript_id=mCT50240.1 created
FT                   on 10-APR-2002"
FT   CDS             complement(125769..>126530)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50057"
FT                   /product="mCG50057"
FT                   /note="gene_id=mCG50057.1 transcript_id=mCT50240.1
FT                   protein_id=mCP28383.1"
FT                   /protein_id="EDL32215.1"
FT                   /translation="CSVPRSSLPCAMDGIVPDIAVGTKQGSDELFSTCVSNGPFIMSSS
FT                   ASAANGNDSKKFKGDNRSAGVPSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGK
FT                   NQAFTEMNTEETANTMVNYYTSVAPVLRGQPIYIQFSNHKELETDSSPNQARAQAALQA
FT                   VNSVHSGNLALAASAAAVDAGMAMAGQSPALRIIVENLFYPVTLDMVHQIFSKFGTVLK
FT                   IITFTKNNQFQALLQYADPVSAQHAKLSLDG"
FT   gene            169923..175371
FT                   /locus_tag="mCG_115718"
FT                   /note="gene_id=mCG115718.0"
FT   mRNA            join(169923..170072,171902..172061,173317..173352,
FT                   173960..174139,174851..175371)
FT                   /locus_tag="mCG_115718"
FT                   /product="mCG115718"
FT                   /note="gene_id=mCG115718.0 transcript_id=mCT116827.1
FT                   created on 10-APR-2002"
FT   CDS             169940..170056
FT                   /codon_start=1
FT                   /locus_tag="mCG_115718"
FT                   /product="mCG115718"
FT                   /note="gene_id=mCG115718.0 transcript_id=mCT116827.1
FT                   protein_id=mCP51528.1"
FT                   /protein_id="EDL32216.1"
FT                   /translation="MFSRLSNLFGRASVDGREARERRKEAGLPSESNEGPRR"
FT   gene            284048..284971
FT                   /locus_tag="mCG_6316"
FT                   /note="gene_id=mCG6316.1"
FT   mRNA            284048..284971
FT                   /locus_tag="mCG_6316"
FT                   /product="mCG6316"
FT                   /note="gene_id=mCG6316.1 transcript_id=mCT5942.2 created on
FT                   10-APR-2002"
FT   CDS             284065..284607
FT                   /codon_start=1
FT                   /locus_tag="mCG_6316"
FT                   /product="mCG6316"
FT                   /note="gene_id=mCG6316.1 transcript_id=mCT5942.2
FT                   protein_id=mCP7921.1"
FT                   /protein_id="EDL32217.1"
FT                   /translation="MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLI
FT                   IFLRNRLKYALTGDEVKEICMQRFIKIDGKIRTGIIYPAGFMDVISIDKTGENFRLIYD
FT                   TKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDALTIRYPDPLIKVNDTIQID
FT                   LETGKITDFIKFDTGNL"
FT   gene            <334911..335236
FT                   /locus_tag="mCG_1034343"
FT                   /note="gene_id=mCG1034343.0"
FT   mRNA            join(<334911..335193,335217..335236)
FT                   /locus_tag="mCG_1034343"
FT                   /product="mCG1034343"
FT                   /note="gene_id=mCG1034343.0 transcript_id=mCT152047.1
FT                   created on 10-APR-2002"
FT   CDS             <334911..335048
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034343"
FT                   /product="mCG1034343"
FT                   /note="gene_id=mCG1034343.0 transcript_id=mCT152047.1
FT                   protein_id=mCP51608.0"
FT                   /protein_id="EDL32218.1"
FT                   /translation="FTDLSSWAASLFLFLLPRCHFIILYLLGWTFSAASEDATSELHTF
FT                   "
FT   gene            <341506..342678
FT                   /locus_tag="mCG_1034315"
FT                   /note="gene_id=mCG1034315.1"
FT   mRNA            <341506..342678
FT                   /locus_tag="mCG_1034315"
FT                   /product="mCG1034315"
FT                   /note="gene_id=mCG1034315.1 transcript_id=mCT152019.1
FT                   created on 10-APR-2002"
FT   CDS             341506..342147
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034315"
FT                   /product="mCG1034315"
FT                   /note="gene_id=mCG1034315.1 transcript_id=mCT152019.1
FT                   protein_id=mCP51585.1"
FT                   /protein_id="EDL32219.1"
FT                   /translation="MGRLEPRTGGARRAQSRRRFAKDDLVLLGFGRPRSAPVALAESVR
FT                   WTTRKGWKRPGQGEQLCSETEENVVRSNEEPLLRKSSRRFVIFPIQYPDIWRMYKQARA
FT                   SFWTGEEVDLSKNLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPET
FT                   HCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKAD"
FT   gene            complement(470510..478460)
FT                   /locus_tag="mCG_148097"
FT                   /note="gene_id=mCG148097.0"
FT   mRNA            complement(join(470510..472277,477310..478460))
FT                   /locus_tag="mCG_148097"
FT                   /product="mCG148097"
FT                   /note="gene_id=mCG148097.0 transcript_id=mCT188360.0
FT                   created on 13-JAN-2004"
FT   gene            470521..490873
FT                   /locus_tag="mCG_148096"
FT                   /note="gene_id=mCG148096.0"
FT   mRNA            join(470521..470632,472189..472281,477332..477503,
FT                   490263..490459,490578..490873)
FT                   /locus_tag="mCG_148096"
FT                   /product="mCG148096"
FT                   /note="gene_id=mCG148096.0 transcript_id=mCT188359.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(477629..477946)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148097"
FT                   /product="mCG148097"
FT                   /note="gene_id=mCG148097.0 transcript_id=mCT188360.0
FT                   protein_id=mCP109196.0"
FT                   /protein_id="EDL32220.1"
FT                   /translation="MTVGLRALLNKNPLAVCSKTVSCEWFGVSPLLSQNVGESSCCGSF
FT                   SAPDIRQDTKGAEYFCCKAQREQSMALRKFLSAFWDIFLPHDAVRLIINFLLINPFFSH
FT                   A"
FT   CDS             490709..490804
FT                   /codon_start=1
FT                   /locus_tag="mCG_148096"
FT                   /product="mCG148096"
FT                   /note="gene_id=mCG148096.0 transcript_id=mCT188359.0
FT                   protein_id=mCP109195.0"
FT                   /protein_id="EDL32221.1"
FT                   /translation="MNRSISLSQFLCVCVVKRSMMKMAHNAFIYY"
FT   gene            <527795..555848
FT                   /gene="Gdi2"
FT                   /locus_tag="mCG_1982"
FT                   /note="gene_id=mCG1982.3"
FT   mRNA            join(<527795..528014,540660..540759,544076..544210,
FT                   545979..546177,546591..546722,549638..549737,
FT                   551510..551681,554183..554327,554502..554556,
FT                   554639..555463)
FT                   /gene="Gdi2"
FT                   /locus_tag="mCG_1982"
FT                   /product="guanosine diphosphate (GDP) dissociation
FT                   inhibitor 2, transcript variant mCT193007"
FT                   /note="gene_id=mCG1982.3 transcript_id=mCT193007.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<527796..528014,540660..540759,544076..544210,
FT                   545979..546177,546591..546722,549638..549737,
FT                   551510..551681,554183..554327,554502..554556,
FT                   554639..554785)
FT                   /codon_start=1
FT                   /gene="Gdi2"
FT                   /locus_tag="mCG_1982"
FT                   /product="guanosine diphosphate (GDP) dissociation
FT                   inhibitor 2, isoform CRA_b"
FT                   /note="gene_id=mCG1982.3 transcript_id=mCT193007.0
FT                   protein_id=mCP113977.0 isoform=CRA_b"
FT                   /protein_id="EDL32223.1"
FT                   /translation="PALLFPLRWRPASPPPQLRFSSPRFFPFPPTPGAQSGRTSRSLLY
FT                   GGLRAPACAPFPAMNEEYDVIVLGTGLTLYKRFKLPGQPPASMGRGRDWNVDLIPKFLM
FT                   ANGQLVKMLLFTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFR
FT                   KFLVYVANFDEKDPRTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQ
FT                   PCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEII
FT                   VQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQ
FT                   IIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIE
FT                   QKFVSISDLFVPKDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKR
FT                   KKNDIYGED"
FT   mRNA            join(<527799..528014,538534..538641,540660..540759,
FT                   544076..544210,545979..546177,546591..546722,
FT                   549638..549737,551510..551681,554183..554327,
FT                   554502..554556,554639..555848)
FT                   /gene="Gdi2"
FT                   /locus_tag="mCG_1982"
FT                   /product="guanosine diphosphate (GDP) dissociation
FT                   inhibitor 2, transcript variant mCT1158"
FT                   /note="gene_id=mCG1982.3 transcript_id=mCT1158.1 created on
FT                   10-APR-2002"
FT   mRNA            join(<527799..528014,538534..538641,540660..540759,
FT                   544076..544210,545979..546177,546591..546722,
FT                   549638..549737,549899..550917)
FT                   /gene="Gdi2"
FT                   /locus_tag="mCG_1982"
FT                   /product="guanosine diphosphate (GDP) dissociation
FT                   inhibitor 2, transcript variant mCT193006"
FT                   /note="gene_id=mCG1982.3 transcript_id=mCT193006.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<527799..528014,538534..538641,540660..540759,
FT                   544076..544210,545979..546177,546591..546722,
FT                   549638..549737,549899..549964)
FT                   /codon_start=1
FT                   /gene="Gdi2"
FT                   /locus_tag="mCG_1982"
FT                   /product="guanosine diphosphate (GDP) dissociation
FT                   inhibitor 2, isoform CRA_a"
FT                   /note="gene_id=mCG1982.3 transcript_id=mCT193006.0
FT                   protein_id=mCP113976.0 isoform=CRA_a"
FT                   /protein_id="EDL32222.1"
FT                   /translation="ALLFPLRWRPASPPPQLRFSSPRFFPFPPTPGAQSGRTSRSLLYG
FT                   GLRAPACAPFPAMNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASIT
FT                   PLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFTEVTRYMDFKVIE
FT                   GSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGVDPKK
FT                   TSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQPCCETINRIKLYSESLARYGKSPY
FT                   LYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEVSLGSFRVLI
FT                   QNRSGCNTFVA"
FT   CDS             join(<527940..528014,538534..538641,540660..540759,
FT                   544076..544210,545979..546177,546591..546722,
FT                   549638..549737,551510..551681,554183..554327,
FT                   554502..554556,554639..554785)
FT                   /codon_start=1
FT                   /gene="Gdi2"
FT                   /locus_tag="mCG_1982"
FT                   /product="guanosine diphosphate (GDP) dissociation
FT                   inhibitor 2, isoform CRA_c"
FT                   /note="gene_id=mCG1982.3 transcript_id=mCT1158.1
FT                   protein_id=mCP5141.1 isoform=CRA_c"
FT                   /protein_id="EDL32224.1"
FT                   /translation="RAPACAPFPAMNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQ
FT                   NPYYGGESASITPLEDLYKRFKLPGQPPASMGRGRDWNVDLIPKFLMANGQLVKMLLFT
FT                   EVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEK
FT                   DPRTFEGVDPKKTSMRDVYKKFDLGQDVIDFTGHSLALYRTDDYLDQPCCETINRIKLY
FT                   SESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVVGVKSE
FT                   GEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKS
FT                   DIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLFVP
FT                   KDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED"
FT   gene            complement(556278..>564799)
FT                   /locus_tag="mCG_1986"
FT                   /note="gene_id=mCG1986.2"
FT   mRNA            complement(join(556278..556310,556561..556675,
FT                   557079..557260,558392..558497,559128..559281,
FT                   559952..560077,563126..>564799))
FT                   /locus_tag="mCG_1986"
FT                   /product="mCG1986"
FT                   /note="gene_id=mCG1986.2 transcript_id=mCT1152.2 created on
FT                   10-APR-2002"
FT   CDS             complement(join(556307..556310,556561..556675,
FT                   557079..557260,558392..558497,559128..559281,
FT                   559952..560077,563126..>564799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1986"
FT                   /product="mCG1986"
FT                   /note="gene_id=mCG1986.2 transcript_id=mCT1152.2
FT                   protein_id=mCP5140.1"
FT                   /protein_id="EDL32225.1"
FT                   /translation="NMQTEAVNSALIDKTDVQAYSHPEVSKFVSSSDSAQCTYHAKPVS
FT                   VEPGFQTQEIPVVRMASLLKNIGVELHEEKMDLSATGLQSNSMSAKDEQKTMHVLQDTI
FT                   CEVKEFLNGDVFSQNAHSCQNTVDFSKSISEEPSASFVPEFVDAICGVYKEHTFNESPN
FT                   MVHETKADAETLSRNTEISVNASMFCGPRSGAYVQDSHDCKSCKFDVENLRGNHESQKD
FT                   AVKDSCDSFTSLNNSDDTWACSSKISTLETHIPPRDQETEPRLISPNKCIPRYIQIPDS
FT                   HGIPKTYANFTITKEFKDTTRRLHSLKRHRNLSANCNLLSSWTSTWHVTDDLTQHTLDL
FT                   EYLRFDHKLKQIKKGGSQQSSFPKESLVQISSGTSPSTQTSEASGLHLPPESRSPILVT
FT                   VVRADTRQQSHHRRGCSPSSLDGSSSFWKKKCSQSRNLKNSERSQTVPFHLNKLKYNST
FT                   LKESRNDISLILNEYAEFNKIMMNSKQIVSQDEELNVASAEAVFQEAYQPRQPVSYEDV
FT                   ITDLCATLHVKLKGVVREACKSPFWFYLVETEDKSFLLRTKSILKKGGHIEIELLDFCQ
FT                   AFHRENETLLVIIKNEDIISHLHQIPSLLKLKHFPSVVFAGVDSPEDIVNETYQELFRS
FT                   GGFVVSDDVILESLTLVQLKEILKILEKLNENGKWKWLLHYRESKNLKEDVRVDSIAHK
FT                   KNLILKSYQSVNIIDLLHYHNCDSPSSTKAEIFKCLLNLQIQHISARFAVFLTDKPTVS
FT                   TEIFENNGILVTDVNYFTENIQKIAAPFRSSYW"
FT   gene            complement(<574153..600413)
FT                   /locus_tag="mCG_1984"
FT                   /note="gene_id=mCG1984.2"
FT   mRNA            complement(join(<574153..575030,577860..578096,
FT                   579503..580210,583704..583766,583866..583938,
FT                   585070..585173,586350..586450,589222..589321,
FT                   589407..589426,589509..589632,589762..589904,
FT                   600396..600413))
FT                   /locus_tag="mCG_1984"
FT                   /product="mCG1984"
FT                   /note="gene_id=mCG1984.2 transcript_id=mCT1151.2 created on
FT                   09-MAY-2002"
FT   CDS             complement(join(574153..575030,577860..578096,
FT                   579503..580210,583704..583766,583866..583938,
FT                   585070..585173,586350..586450,589222..589321,
FT                   589407..589426,589509..589534))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1984"
FT                   /product="mCG1984"
FT                   /note="gene_id=mCG1984.2 transcript_id=mCT1151.2
FT                   protein_id=mCP5138.2"
FT                   /protein_id="EDL32226.1"
FT                   /translation="MAAPTSKIILELNKNALISPWKGQFIIQGCLLCDITLWSTYGTVV
FT                   PLQLPRELDFKYVMDVSSLKESLPEAAFRRRSYLEQKVCCQDLCFDLYEVELTNKQGEN
FT                   IDKLMEYVKNKELALIKCLEDKSFFILFTSSALTPEPGFGAEQMGLHGLHLFHAPQTAG
FT                   AKDLKVEDGISLKVIPILPALSYALLEAKKSLSEEGIPPNILVKHSFQELYKVDKSLSL
FT                   MAPPQDGVEDTASTGKLSHAFDLPPPLETCPSESLTHLKCYFSDPAGYTLDLSAALDLL
FT                   AEHPQFPCIADGVCDAGFSLVMTPDPEFLDSEMEIRKTETAEKSGRKLKVKKKAVTPSS
FT                   NQRVQPKRKASTTAVTLPSKRVSLGRPTSKRTVPRTDNRSCNPTLKLVKGQFPQKRKRG
FT                   AEVLAAQIVQKTRLERKKQEASVSKDAPVPTNTKRAKKQEKSPGRIASQSKPPMKKSPQ
FT                   KRKVNVARGRRNTRKQLQPAEKEIALHLQSEISSDGQKDGLNLSTSQQESISMIPKGPP
FT                   ENSVISCDSQALNMLADLALSSAAASIPSCKPRNLPCVSDLPRNNVLLTKENPLLGASD
FT                   HEYHKGVKSQKAVLLPKPYSDEKISSESDLTRSQEENLVPCAQPLPIAQPAPHSEAREL
FT                   SDASQNSVVVEHSYALLLAEQSQKHLHQRKLPSPAFVKNGIKGPEAGTPVGKVMPFRHL
FT                   QNTSPLQKHSEDSLMKHKSLFVSSTLKEFFCSHTVLKCDGSFKITFKCEGEYVFSLDSK
FT                   YTSNPLEKTVLRALHG"
FT   gene            <602484..603179
FT                   /locus_tag="mCG_140073"
FT                   /note="gene_id=mCG140073.0"
FT   mRNA            <602484..603179
FT                   /locus_tag="mCG_140073"
FT                   /product="mCG140073"
FT                   /note="gene_id=mCG140073.0 transcript_id=mCT167903.0
FT                   created on 10-APR-2002"
FT   CDS             <602559..602825
FT                   /codon_start=1
FT                   /locus_tag="mCG_140073"
FT                   /product="mCG140073"
FT                   /note="gene_id=mCG140073.0 transcript_id=mCT167903.0
FT                   protein_id=mCP90804.0"
FT                   /protein_id="EDL32227.1"
FT                   /translation="KPEEKIIASFKAMAYQLYRNTTLRNSLQESLDELIQSQHITPQIA
FT                   LQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRDSAIMFGLLY"
FT   gene            623467..641164
FT                   /gene="Asb13"
FT                   /locus_tag="mCG_1985"
FT                   /note="gene_id=mCG1985.2"
FT   mRNA            join(623467..623558,631497..631684,632907..633057,
FT                   634348..634482,638711..638902,639572..641164)
FT                   /gene="Asb13"
FT                   /locus_tag="mCG_1985"
FT                   /product="ankyrin repeat and SOCS box-containing protein
FT                   13, transcript variant mCT1160"
FT                   /note="gene_id=mCG1985.2 transcript_id=mCT1160.2 created on
FT                   02-JAN-2003"
FT   mRNA            join(623482..623558,634348..634482,638711..638766,
FT                   639572..639897)
FT                   /gene="Asb13"
FT                   /locus_tag="mCG_1985"
FT                   /product="ankyrin repeat and SOCS box-containing protein
FT                   13, transcript variant mCT178275"
FT                   /note="gene_id=mCG1985.2 transcript_id=mCT178275.0 created
FT                   on 02-JAN-2003"
FT   CDS             join(623516..623558,631497..631684,632907..633057,
FT                   634348..634482,638711..638902,639572..639699)
FT                   /codon_start=1
FT                   /gene="Asb13"
FT                   /locus_tag="mCG_1985"
FT                   /product="ankyrin repeat and SOCS box-containing protein
FT                   13, isoform CRA_a"
FT                   /note="gene_id=mCG1985.2 transcript_id=mCT1160.2
FT                   protein_id=mCP5139.1 isoform=CRA_a"
FT                   /protein_id="EDL32228.1"
FT                   /translation="MEPRAGDGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIDSGACV
FT                   NQVTVDSITPLHAASLQGQAQCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLL
FT                   LSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHL
FT                   DCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYT
FT                   WSSSAPAKCFEYYEKTPLSLSQLCRVSLRKATGVRGLEKVAKLNIPPRLIDYLSYN"
FT   CDS             join(623516..623558,634348..634482,638711..638766,
FT                   639572..639607)
FT                   /codon_start=1
FT                   /gene="Asb13"
FT                   /locus_tag="mCG_1985"
FT                   /product="ankyrin repeat and SOCS box-containing protein
FT                   13, isoform CRA_b"
FT                   /note="gene_id=mCG1985.2 transcript_id=mCT178275.0
FT                   protein_id=mCP101197.0 isoform=CRA_b"
FT                   /protein_id="EDL32229.1"
FT                   /translation="MEPRAGDGCFLGDVGSSECVRLLIDVGANLEAHDCHFGTPLHVAC
FT                   AREHLDCVKVLLNAGANVNAAKLHETALHHAAKRHLLASPSSAG"
FT   gene            complement(786630..788051)
FT                   /gene="Calml3"
FT                   /locus_tag="mCG_1733"
FT                   /note="gene_id=mCG1733.0"
FT   mRNA            complement(786630..788051)
FT                   /gene="Calml3"
FT                   /locus_tag="mCG_1733"
FT                   /product="calmodulin-like 3"
FT                   /note="gene_id=mCG1733.0 transcript_id=mCT7776.0 created on
FT                   11-APR-2002"
FT   CDS             complement(787489..787938)
FT                   /codon_start=1
FT                   /gene="Calml3"
FT                   /locus_tag="mCG_1733"
FT                   /product="calmodulin-like 3"
FT                   /note="gene_id=mCG1733.0 transcript_id=mCT7776.0
FT                   protein_id=mCP19315.1"
FT                   /protein_id="EDL32230.1"
FT                   /translation="MADQLTEEQIAEFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPT
FT                   EAELQGMVNEIDKDGNGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAA
FT                   ELRHVMTKLGEKLSDEEVDEMIQAADTDGDGQVNYEEFVHMLVSK"
FT   gene            820901..821777
FT                   /locus_tag="mCG_115710"
FT                   /note="gene_id=mCG115710.1"
FT   mRNA            820901..821777
FT                   /locus_tag="mCG_115710"
FT                   /product="mCG115710"
FT                   /note="gene_id=mCG115710.1 transcript_id=mCT116819.1
FT                   created on 11-APR-2002"
FT   CDS             820997..821443
FT                   /codon_start=1
FT                   /locus_tag="mCG_115710"
FT                   /product="mCG115710"
FT                   /note="gene_id=mCG115710.1 transcript_id=mCT116819.1
FT                   protein_id=mCP51591.1"
FT                   /db_xref="GOA:Q6WEH7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1931464"
FT                   /db_xref="UniProtKB/TrEMBL:Q6WEH7"
FT                   /protein_id="EDL32231.1"
FT                   /translation="MSHGFTKEEVAEFQAAFNRFDKNKDGHISVEELGDVMKQLGKNLP
FT                   EKDLKALISKLDTDGDGKISFEEFLTAIEKYKKGHRAGELRAVFNVLDQNGDGYITVDE
FT                   LKESLSKLGESLSQEELEDMIRVADVDQDGKVKYEEFVRLHIEN"
FT   gene            837148..837577
FT                   /pseudo
FT                   /locus_tag="mCG_140071"
FT                   /note="gene_id=mCG140071.0"
FT   mRNA            837148..837577
FT                   /pseudo
FT                   /locus_tag="mCG_140071"
FT                   /note="gene_id=mCG140071.0 transcript_id=mCT167895.0
FT                   created on 30-MAY-2002"
FT   gene            <838673..866133
FT                   /locus_tag="mCG_1034346"
FT                   /note="gene_id=mCG1034346.0"
FT   mRNA            join(<838673..838833,865661..866133)
FT                   /locus_tag="mCG_1034346"
FT                   /product="mCG1034346"
FT                   /note="gene_id=mCG1034346.0 transcript_id=mCT152050.0
FT                   created on 11-APR-2002"
FT   CDS             join(<838674..838833,865661..865821)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034346"
FT                   /product="mCG1034346"
FT                   /note="gene_id=mCG1034346.0 transcript_id=mCT152050.0
FT                   protein_id=mCP51614.0"
FT                   /protein_id="EDL32232.1"
FT                   /translation="LTADSSWPCKALIFFSRIQLEGFFPDKRWRRKMKGCQGFPTPPPF
FT                   PPPPVHIQVTLLEVTRLWLIRARERIRLSSDPHLSPSGSPSSVKAEGGHFDKAQKATIL
FT                   KL"
FT   gene            complement(867365..905021)
FT                   /locus_tag="mCG_1732"
FT                   /note="gene_id=mCG1732.2"
FT   mRNA            complement(join(867365..869273,869603..869789,
FT                   870847..871017,871337..871594,872170..872246,
FT                   872370..872466,872777..872839,873154..873321,
FT                   873670..873777,894866..894925,899750..899816,
FT                   904843..905021))
FT                   /locus_tag="mCG_1732"
FT                   /product="mCG1732"
FT                   /note="gene_id=mCG1732.2 transcript_id=mCT7775.2 created on
FT                   11-APR-2002"
FT   CDS             complement(join(868870..869273,869603..869789,
FT                   870847..871017,871337..871594,872170..872246,
FT                   872370..872466,872777..872839,873154..873321,
FT                   873670..873777,894866..894925,899750..899816,
FT                   904843..904970))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1732"
FT                   /product="mCG1732"
FT                   /note="gene_id=mCG1732.2 transcript_id=mCT7775.2
FT                   protein_id=mCP19305.2"
FT                   /protein_id="EDL32233.1"
FT                   /translation="MEPEPAAQKQPRPRRRSRRVSMLSEEPAAGLPADTPGPAANERCS
FT                   LRRGSSFTFLTPGPHWDFTLKRKRREKDDDAVSLSSLDLKEPSNKRVRPLARVTSLANL
FT                   ISPVRNGAVRRFGQTIQSFTLRGDHRSPASAQKSFSRSTVPTPTKRRSSALWSEMLDIN
FT                   MKESLTTREIKRQEAIYELSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDL
FT                   DAYIPLHEDLLARIGEATKPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAAKALLDQKK
FT                   QDPRVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHRDVQLLE
FT                   EAILIIQGVLSDINLKKGESECQYYINKLEYLDEKQKDPRIEASKVLLCHGELKNKSGH
FT                   KLYIFLFQDILVLTRPVTRNERHLYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFGN
FT                   SDKAKNIFRVRFQDPSPGHSHTLQANDVFHKQQWFNCIRAAIAPFQRAASPLELQGLPD
FT                   LHEECEENNPSAGNLRAQRRSCVVPGVMQIDEESALDCGSSVQTVEDTRNMKAQRPQPG
FT                   LRRARDKAQSGGKKKETLV"
FT   gene            <914897..>920433
FT                   /locus_tag="mCG_1728"
FT                   /note="gene_id=mCG1728.2"
FT   mRNA            join(<914897..915140,917345..917445,919489..>920433)
FT                   /locus_tag="mCG_1728"
FT                   /product="mCG1728"
FT                   /note="gene_id=mCG1728.2 transcript_id=mCT7770.2 created on
FT                   11-APR-2002"
FT   CDS             join(<914897..915140,917345..917445,919489..920433)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1728"
FT                   /product="mCG1728"
FT                   /note="gene_id=mCG1728.2 transcript_id=mCT7770.2
FT                   protein_id=mCP19339.0"
FT                   /protein_id="EDL32234.1"
FT                   /translation="RECLSIHIGQAGVQIGDACWELYCLEHGIQPDGFILDHQHDNLEN
FT                   PKVEHMNASLDTFFHETRAGKHVPRTLFMDLEPTVIDGIRVGRYHSLFHPEQLVNGKED
FT                   AANTYARGRYSAEQCSGLQGFLIYRSFGGGTGSGFTSLLMERLSVEYCKKIKLEFSVYP
FT                   SPRISTAVVEPYNAILTTHSTIEYSDCAFMVDNEALYDICQHKLGIERPSYASINRLIA
FT                   QVSSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPITALAPIISAEKAYQEQLSVSDV
FT                   TASCFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKSRTSVQFVDWCPTG
FT                   FKVGINYQPPAVVPGGDLARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYI
FT                   TEGMELGEFVEAREDLAALEKDYEEVGLSF"
FT   gene            complement(<928035..>928529)
FT                   /gene="Ucn3"
FT                   /locus_tag="mCG_1034323"
FT                   /note="gene_id=mCG1034323.0"
FT   mRNA            complement(<928035..>928529)
FT                   /gene="Ucn3"
FT                   /locus_tag="mCG_1034323"
FT                   /product="urocortin 3"
FT                   /note="gene_id=mCG1034323.0 transcript_id=mCT152027.0
FT                   created on 11-APR-2002"
FT   CDS             complement(928035..928529)
FT                   /codon_start=1
FT                   /gene="Ucn3"
FT                   /locus_tag="mCG_1034323"
FT                   /product="urocortin 3"
FT                   /note="gene_id=mCG1034323.0 transcript_id=mCT152027.0
FT                   protein_id=mCP51605.0"
FT                   /db_xref="GOA:Q3UFJ9"
FT                   /db_xref="InterPro:IPR024270"
FT                   /db_xref="MGI:MGI:1932970"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UFJ9"
FT                   /protein_id="EDL32235.1"
FT                   /translation="MLMPTYFLLPLLLLLGGPRTSLSHKFYNTGPVFSCLNTALSEVKK
FT                   NKLEDVPLLSKKSFGHLPTQDPSGEEDDNQTHLQIKRTFSGAAGGNGAGSTRYRYQSQA
FT                   QHKGKLYPDKPKSDRGTKFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQIGKK
FT                   K"
FT   gene            1033159..1066811
FT                   /gene="Akr1c14"
FT                   /locus_tag="mCG_1727"
FT                   /note="gene_id=mCG1727.2"
FT   mRNA            join(1033159..1033266,1035341..1035503,1038821..1038957,
FT                   1043664..1043838,1047678..1047845,1049456..1049572,
FT                   1053976..1054053,1055057..1055179,1056610..1056719,
FT                   1056981..1057146,1063229..1063311,1064944..1066811)
FT                   /gene="Akr1c14"
FT                   /locus_tag="mCG_1727"
FT                   /product="aldo-keto reductase family 1, member C14,
FT                   transcript variant mCT7769"
FT                   /note="gene_id=mCG1727.2 transcript_id=mCT7769.2 created on
FT                   11-APR-2002"
FT   mRNA            join(1043699..1043838,1047678..1047754,1057074..1057146,
FT                   1063229..1063311,1064944..1065076)
FT                   /gene="Akr1c14"
FT                   /locus_tag="mCG_1727"
FT                   /product="aldo-keto reductase family 1, member C14,
FT                   transcript variant mCT167896"
FT                   /note="gene_id=mCG1727.2 transcript_id=mCT167896.0 created
FT                   on 11-APR-2002"
FT   CDS             join(1043755..1043838,1047678..1047845,1049456..1049572,
FT                   1053976..1054053,1055057..1055179,1056610..1056719,
FT                   1056981..1057146,1063229..1063311,1064944..1064986)
FT                   /codon_start=1
FT                   /gene="Akr1c14"
FT                   /locus_tag="mCG_1727"
FT                   /product="aldo-keto reductase family 1, member C14, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1727.2 transcript_id=mCT7769.2
FT                   protein_id=mCP19326.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q91WT7"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:2145458"
FT                   /db_xref="UniProtKB/TrEMBL:Q91WT7"
FT                   /protein_id="EDL32237.1"
FT                   /translation="MNSVSPRVVLNDGHFIPALGFGTTVPDKVPKDELIKATKIAIDTG
FT                   FRHFDSAYLYQIEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRSCLEKTLK
FT                   NAQLDYVDLYIIHFPMALQPGDKLFPRDEHGKLLAEAVDLCDTWEAMEKCKDAGLAKSI
FT                   GVSNFNFRQLETILNKPGLKYKPVCNQVECHLYLNQSQMLDYCKSKDIILVSYCTLGSS
FT                   RDKIWVDQKSPVLLDDPVLCAMANKYKQTPALIAIRYQLQRGIVVLTRSFKEKRIKEFM
FT                   KVFEFQLASEDMKVLDGLHRNLRYNTASYFDDHPNHPFTDEY"
FT   CDS             join(1043755..1043838,1047678..1047754,1057074..1057146,
FT                   1063229..1063311,1064944..1064986)
FT                   /codon_start=1
FT                   /gene="Akr1c14"
FT                   /locus_tag="mCG_1727"
FT                   /product="aldo-keto reductase family 1, member C14, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1727.2 transcript_id=mCT167896.0
FT                   protein_id=mCP90806.0 isoform=CRA_a"
FT                   /protein_id="EDL32236.1"
FT                   /translation="MNSVSPRVVLNDGHFIPALGFGTTVPDKVPKDELIKATKIAIDTG
FT                   FRHFDSAYFYQLQRGIVVLTRSFKEKRIKEFMKVFEFQLASEDMKVLDGLHRNLRYNTA
FT                   SYFDDHPNHPFTDEY"
FT   gene            complement(1108606..1126624)
FT                   /gene="Akr1c18"
FT                   /locus_tag="mCG_1734"
FT                   /note="gene_id=mCG1734.2"
FT   mRNA            complement(join(1108606..1108823,1111189..1111271,
FT                   1112596..1112761,1113128..1113237,1118122..1118244,
FT                   1119213..1119290,1120261..1120377,1121177..1121344,
FT                   1126485..1126623))
FT                   /gene="Akr1c18"
FT                   /locus_tag="mCG_1734"
FT                   /product="aldo-keto reductase family 1, member C18,
FT                   transcript variant mCT7777"
FT                   /note="gene_id=mCG1734.2 transcript_id=mCT7777.1 created on
FT                   11-APR-2002"
FT   mRNA            complement(join(1108618..1108823,1111189..1111271,
FT                   1112596..1112761,1113128..1113237,1118122..1118244,
FT                   1120261..1120377,1121177..1121344,1126485..1126624))
FT                   /gene="Akr1c18"
FT                   /locus_tag="mCG_1734"
FT                   /product="aldo-keto reductase family 1, member C18,
FT                   transcript variant mCT167898"
FT                   /note="gene_id=mCG1734.2 transcript_id=mCT167898.0 created
FT                   on 11-APR-2002"
FT   CDS             complement(join(1108781..1108823,1111189..1111271,
FT                   1112596..1112761,1113128..1113237,1118122..1118244,
FT                   1120261..1120377,1121177..1121344,1126485..1126568))
FT                   /codon_start=1
FT                   /gene="Akr1c18"
FT                   /locus_tag="mCG_1734"
FT                   /product="aldo-keto reductase family 1, member C18, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1734.2 transcript_id=mCT167898.0
FT                   protein_id=mCP90802.0 isoform=CRA_b"
FT                   /protein_id="EDL32239.1"
FT                   /translation="MNSKIQKIELNDGHSIPVLGFGTYATEEHLKKKSMESTKIAIDVG
FT                   FCHIDCSHLYQNEEEIGQAILSKIEDGTVKREDIFYTSKLWSTSHRPELVRPSLENSLR
FT                   KLNLDYVDLYLIHFPVSLKAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCN
FT                   QVECHLYLNQSKLLAYCKMNDIVLVAYGALGTQRYKYCINEDTPVLLDDPVLCAMAKKY
FT                   KRTPALIALRYQLDRGIVALAKSFNEERIRENMQVFDFQLASDDMKILDGLDRNLRYFP
FT                   ADMFKAHPNFPFFDEY"
FT   CDS             complement(join(1108781..1108823,1111189..1111271,
FT                   1112596..1112761,1113128..1113237,1118122..1118244,
FT                   1119213..1119290,1120261..1120377,1121177..1121344,
FT                   1126485..1126568))
FT                   /codon_start=1
FT                   /gene="Akr1c18"
FT                   /locus_tag="mCG_1734"
FT                   /product="aldo-keto reductase family 1, member C18, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1734.2 transcript_id=mCT7777.1
FT                   protein_id=mCP19324.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U538"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:2145420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U538"
FT                   /protein_id="EDL32238.1"
FT                   /translation="MNSKIQKIELNDGHSIPVLGFGTYATEEHLKKKSMESTKIAIDVG
FT                   FCHIDCSHLYQNEEEIGQAILSKIEDGTVKREDIFYTSKLWSTSHRPELVRPSLENSLR
FT                   KLNLDYVDLYLIHFPVSLKPGNELLPKDEHGNLIFDTVDLCDTWEAMEKCKDAGLAKSI
FT                   GVSNFNRRQLEMILNKPGLKYKPVCNQVECHLYLNQSKLLAYCKMNDIVLVAYGALGTQ
FT                   RYKYCINEDTPVLLDDPVLCAMAKKYKRTPALIALRYQLDRGIVALAKSFNEERIRENM
FT                   QVFDFQLASDDMKILDGLDRNLRYFPADMFKAHPNFPFFDEY"
FT   gene            complement(1144509..1146864)
FT                   /pseudo
FT                   /locus_tag="mCG_1034324"
FT                   /note="gene_id=mCG1034324.0"
FT   mRNA            complement(join(1144509..1145120,1146124..1146864))
FT                   /pseudo
FT                   /locus_tag="mCG_1034324"
FT                   /note="gene_id=mCG1034324.0 transcript_id=mCT152028.1
FT                   created on 11-APR-2002"
FT   gene            1167106..1181517
FT                   /locus_tag="mCG_1729"
FT                   /note="gene_id=mCG1729.2"
FT   mRNA            join(1167106..1167230,1169954..1170121,1170597..1170713,
FT                   1172353..1172430,1172909..1173031,1173721..1173830,
FT                   1174398..1174563,1179280..1179362,1181254..1181517)
FT                   /locus_tag="mCG_1729"
FT                   /product="mCG1729"
FT                   /note="gene_id=mCG1729.2 transcript_id=mCT7772.2 created on
FT                   28-JUL-2003"
FT   CDS             join(1167147..1167230,1169954..1170121,1170597..1170713,
FT                   1172353..1172430,1172909..1173031,1173721..1173830,
FT                   1174398..1174563,1179280..1179362,1181254..1181296)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1729"
FT                   /product="mCG1729"
FT                   /note="gene_id=mCG1729.2 transcript_id=mCT7772.2
FT                   protein_id=mCP19344.1"
FT                   /protein_id="EDL32240.1"
FT                   /translation="MSSKQHCVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVG
FT                   YRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDLFITTKLWCTCFRPELVKPALEKSLK
FT                   KLQLDYVDLYIMHYPVPMKSGDNDFPVNEQGKSLLDTVDFCDTWERLEECKDAGLVKSI
FT                   GVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQRKLLDYCESKDIVLVAYGALGTQ
FT                   RYKEWVDQNSPVLLNDPVLCDVAKKNKRSPALIALRYLIQRGIVPLAQSFKENEMRENL
FT                   QVFGFQLSPEDMKTLDGLNKNFRYLPAEFLVDHPEYPFVEEY"
FT   gene            1204778..1224426
FT                   /gene="Akr1c19"
FT                   /locus_tag="mCG_114463"
FT                   /note="gene_id=mCG114463.1"
FT   mRNA            join(1204778..1204875,1209801..1209922,1212157..1212324,
FT                   1213104..1213220,1214462..1214539,1215036..1215158,
FT                   1218618..1218727,1218993..1219158,1222870..1222952,
FT                   1224145..1224426)
FT                   /gene="Akr1c19"
FT                   /locus_tag="mCG_114463"
FT                   /product="aldo-keto reductase family 1, member C19"
FT                   /note="gene_id=mCG114463.1 transcript_id=mCT115555.1
FT                   created on 11-APR-2002"
FT   CDS             join(1209839..1209922,1212157..1212324,1213104..1213220,
FT                   1214462..1214539,1215036..1215158,1218618..1218727,
FT                   1218993..1219158,1222870..1222952,1224145..1224187)
FT                   /codon_start=1
FT                   /gene="Akr1c19"
FT                   /locus_tag="mCG_114463"
FT                   /product="aldo-keto reductase family 1, member C19"
FT                   /note="gene_id=mCG114463.1 transcript_id=mCT115555.1
FT                   protein_id=mCP51543.1"
FT                   /db_xref="GOA:G3X9Y6"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:2653678"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9Y6"
FT                   /protein_id="EDL32241.1"
FT                   /translation="MSSKQQCVKLNDGNFIPALGFGTYKPEEVNENKPLEAIHLALEAG
FT                   FRHIDTAYVYQTENHVGQAIRSKIAAGLVKREDIFLTTKLWCTFHRPELVRSNLEKSLK
FT                   NLQLDYADLYLIHYPVQMKPGEDLFPEDEHGKTLFDTVDICATWEAMEKCKDAGLVKSI
FT                   GVSNFNSRQLEKILNKPGLKYKPVCNQVECHLYLNQRKLLNYCKSKDIVLVAYCALGSQ
FT                   RPKRWVDPSSPVLLNDPILCDMAKKHKRSPAQIALRYHLQRGIVVLAQSYKENEIKENI
FT                   QVFEFELPSEDMKILDSLDRNLRYAPAPFGEGHPEYPFSDEF"
FT   gene            1225334..1228914
FT                   /locus_tag="mCG_51722"
FT                   /note="gene_id=mCG51722.2"
FT   mRNA            1225334..1228914
FT                   /locus_tag="mCG_51722"
FT                   /product="mCG51722"
FT                   /note="gene_id=mCG51722.2 transcript_id=mCT51905.3 created
FT                   on 26-FEB-2003"
FT   CDS             1226934..1227143
FT                   /codon_start=1
FT                   /locus_tag="mCG_51722"
FT                   /product="mCG51722"
FT                   /note="gene_id=mCG51722.2 transcript_id=mCT51905.3
FT                   protein_id=mCP39786.2"
FT                   /protein_id="EDL32242.1"
FT                   /translation="MLDLICKNCIEYCCVNVSKGNWSEVVFLSFLSPPPSTRSPTWLLE
FT                   LSFSLSAFAHLPLLEVSARVTPIN"
FT   gene            complement(1246724..1257935)
FT                   /locus_tag="mCG_114465"
FT                   /note="gene_id=mCG114465.2"
FT   mRNA            complement(join(1246724..1246982,1248792..1248874,
FT                   1250827..1250992,1251560..1251669,1252362..1252484,
FT                   1252978..1253055,1254355..1254471,1254860..1255027,
FT                   1257807..1257935))
FT                   /locus_tag="mCG_114465"
FT                   /product="mCG114465, transcript variant mCT115557"
FT                   /note="gene_id=mCG114465.2 transcript_id=mCT115557.2
FT                   created on 28-JUL-2003"
FT   mRNA            complement(join(1246724..1246982,1248792..1248874,
FT                   1250827..1250992,1251560..1251669,1252362..1252484,
FT                   1252978..1253055,1254355..1254471,1254860..1255027,
FT                   1256525..1256669,1257807..1257935))
FT                   /locus_tag="mCG_114465"
FT                   /product="mCG114465, transcript variant mCT167894"
FT                   /note="gene_id=mCG114465.2 transcript_id=mCT167894.1
FT                   created on 28-JUL-2003"
FT   CDS             complement(join(1246940..1246982,1248792..1248874,
FT                   1250827..1250992,1251560..1251669,1252362..1252484,
FT                   1252978..1253055,1254355..1254471,1254860..1255027,
FT                   1257807..1257890))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114465"
FT                   /product="mCG114465, isoform CRA_a"
FT                   /note="gene_id=mCG114465.2 transcript_id=mCT115557.2
FT                   protein_id=mCP51565.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JLI0"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:1351661"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JLI0"
FT                   /protein_id="EDL32243.1"
FT                   /translation="MSSKQHYVKLNDGHLIPALGFGTYKPKEVPKSKSLEAACLALDVG
FT                   YRHVDTAYAYQVEEEIGQAIQSKIKAGVVKREDLFITTKLWCGCFRPELVKPALEKSLK
FT                   SLQLDYVDLYLIHYPVPMKPGDNESPLDENGKFLLDTVDFCDTWERLEECKDAGLVKSI
FT                   GVSNFNHRQLERILNKPGLKYKPVCNQVECHLYLNQSKLLDYCKSKDIVLVAYGALGTQ
FT                   RYKEWVDQNSPVLLNDPVLCDVAKRNKRSPALIALRYLFQRGIVPLAQSFKENEMRENL
FT                   QVFEFQLSPEDMKTLDGLNKNFRYLPAEFLADHPEYPFSEEY"
FT   CDS             complement(join(1256628..1256669,1257807..1257890))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114465"
FT                   /product="mCG114465, isoform CRA_b"
FT                   /note="gene_id=mCG114465.2 transcript_id=mCT167894.1
FT                   protein_id=mCP90810.1 isoform=CRA_b"
FT                   /protein_id="EDL32244.1"
FT                   /translation="MSSKQHYVKLNDGHLIPALGFGTYKPKEGSYQHLTVDVYKN"
FT   gene            1294433..1295626
FT                   /locus_tag="mCG_1730"
FT                   /note="gene_id=mCG1730.0"
FT   mRNA            1294433..1295626
FT                   /locus_tag="mCG_1730"
FT                   /product="mCG1730"
FT                   /note="gene_id=mCG1730.0 transcript_id=mCT7773.0 created on
FT                   12-APR-2002"
FT   CDS             1294458..1294970
FT                   /codon_start=1
FT                   /locus_tag="mCG_1730"
FT                   /product="mCG1730"
FT                   /note="gene_id=mCG1730.0 transcript_id=mCT7773.0
FT                   protein_id=mCP19327.1"
FT                   /protein_id="EDL32245.1"
FT                   /translation="MSLQVSRSLRVVAYNLRTALAFCSPRPCVPSAAAVRSLRTGSALL
FT                   SVRKFTEKHEWITAEEGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVK
FT                   AASELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSELDELMSEEAYEK
FT                   YVKSIEE"
FT   gene            1408729..1432184
FT                   /locus_tag="mCG_9091"
FT                   /note="gene_id=mCG9091.2"
FT   mRNA            join(1408729..1408869,1410675..1410842,1412885..1412903,
FT                   1421369..1421445,1423299..1423408,1423627..1423792,
FT                   1428772..1428854,1432007..1432184)
FT                   /locus_tag="mCG_9091"
FT                   /product="mCG9091, transcript variant mCT167900"
FT                   /note="gene_id=mCG9091.2 transcript_id=mCT167900.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(1408729..1408869,1410675..1410842,1412885..1413001,
FT                   1420666..1420743,1421323..1421445,1423299..1423408,
FT                   1423627..1423792,1428772..1428854,1431462..1431839)
FT                   /locus_tag="mCG_9091"
FT                   /product="mCG9091, transcript variant mCT8946"
FT                   /note="gene_id=mCG9091.2 transcript_id=mCT8946.2 created on
FT                   10-JUN-2003"
FT   mRNA            join(1408729..1408869,1410675..1410842,1412885..1413001,
FT                   1421323..1421445,1423299..1423408,1423627..1423792,
FT                   1428772..1428854,1431462..1431709)
FT                   /locus_tag="mCG_9091"
FT                   /product="mCG9091, transcript variant mCT185677"
FT                   /note="gene_id=mCG9091.2 transcript_id=mCT185677.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(1408729..1408869,1409123..1409441)
FT                   /locus_tag="mCG_9091"
FT                   /product="mCG9091, transcript variant mCT167899"
FT                   /note="gene_id=mCG9091.2 transcript_id=mCT167899.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(1408786..1408869,1410675..1410842,1412885..1412903,
FT                   1421369..1421445,1423299..1423408,1423627..1423792,
FT                   1428772..1428854,1432007..1432019)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9091"
FT                   /product="mCG9091, isoform CRA_b"
FT                   /note="gene_id=mCG9091.2 transcript_id=mCT167900.0
FT                   protein_id=mCP90808.0 isoform=CRA_b"
FT                   /protein_id="EDL32247.1"
FT                   /translation="MDSKQQTVRLSDGHFIPILGFGTYAPQEVPKSKATEATKIAIDAG
FT                   FRHIDSASMYQNEKEVGLAIRSKIADGTVKREDIFYTSKVWCTFHLSNFNRRQLEKILK
FT                   KPGLKYKPVCNQVECHPYLNQGKLLDFCRSKDIVLVAYSALGSHREKQWVDQSSPVLLD
FT                   NPVLGSMAKKYNRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVL
FT                   DDLNKNIRYISGSRSSD"
FT   CDS             join(1408786..1408869,1410675..1410842,1412885..1413001,
FT                   1420666..1420743,1421323..1421445,1423299..1423408,
FT                   1423627..1423792,1428772..1428854,1431462..1431504)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9091"
FT                   /product="mCG9091, isoform CRA_d"
FT                   /note="gene_id=mCG9091.2 transcript_id=mCT8946.2
FT                   protein_id=mCP19319.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q3UEM0"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:1933427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UEM0"
FT                   /protein_id="EDL32249.1"
FT                   /translation="MDSKQQTVRLSDGHFIPILGFGTYAPQEVPKSKATEATKIAIDAG
FT                   FRHIDSASMYQNEKEVGLAIRSKIADGTVKREDIFYTSKVWCTFHRPELVRVCLEQSLK
FT                   QLQLDYVDLYLIHFPMAMKPGENYLPKDENGKLIYDAVDICDTWEAMEKCKDAGLAKSI
FT                   GVSNFNRRQLEKILKKPGLKYKPVCNQVECHPYLNQGKLLDFCRSKDIVLVAYSALGSH
FT                   REKQWVDQSSPVLLDNPVLGSMAKKYNRTPALIALRYQLQRGVVVLAKSFSEKRIKENM
FT                   QVFEFQLTSEDMKVLDDLNKNIRYISGSSFKDHPDFPFWDEY"
FT   CDS             join(1408786..1408869,1410675..1410842,1412885..1413001,
FT                   1421323..1421445,1423299..1423408,1423627..1423792,
FT                   1428772..1428854,1431462..1431504)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9091"
FT                   /product="mCG9091, isoform CRA_c"
FT                   /note="gene_id=mCG9091.2 transcript_id=mCT185677.0
FT                   protein_id=mCP106935.0 isoform=CRA_c"
FT                   /protein_id="EDL32248.1"
FT                   /translation="MDSKQQTVRLSDGHFIPILGFGTYAPQEVPKSKATEATKIAIDAG
FT                   FRHIDSASMYQNEKEVGLAIRSKIADGTVKREDIFYTSKVWCTFHRPELVRVCLEQSLK
FT                   QLQLDYVDLYLIHFPMAMKAMEKCKDAGLAKSIGVSNFNRRQLEKILKKPGLKYKPVCN
FT                   QVECHPYLNQGKLLDFCRSKDIVLVAYSALGSHREKQWVDQSSPVLLDNPVLGSMAKKY
FT                   NRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLDDLNKNIRYIS
FT                   GSSFKDHPDFPFWDEY"
FT   CDS             join(1408786..1408869,1409123..1409146)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9091"
FT                   /product="mCG9091, isoform CRA_a"
FT                   /note="gene_id=mCG9091.2 transcript_id=mCT167899.0
FT                   protein_id=mCP90803.0 isoform=CRA_a"
FT                   /protein_id="EDL32246.1"
FT                   /translation="MDSKQQTVRLSDGHFIPILGFGTYAPQEGEKMKYS"
FT   gene            complement(1456662..1493133)
FT                   /locus_tag="mCG_9092"
FT                   /note="gene_id=mCG9092.1"
FT   mRNA            complement(join(1456662..1457039,1460009..1460091,
FT                   1477460..1477625,1477947..1478056,1479887..1480009,
FT                   1480985..1481062,1482366..1482482,1484041..1484208,
FT                   1493012..1493133))
FT                   /locus_tag="mCG_9092"
FT                   /product="mCG9092, transcript variant mCT8947"
FT                   /note="gene_id=mCG9092.1 transcript_id=mCT8947.2 created on
FT                   02-JAN-2003"
FT   mRNA            complement(join(1456689..1457039,1460009..1460091,
FT                   1477460..1477625,1477947..1478056,1479887..1480009,
FT                   1480985..1481062,1482447..1482482,1484041..1484208,
FT                   1493026..1493094))
FT                   /locus_tag="mCG_9092"
FT                   /product="mCG9092, transcript variant mCT167901"
FT                   /note="gene_id=mCG9092.1 transcript_id=mCT167901.0 created
FT                   on 02-JAN-2003"
FT   CDS             complement(join(1456997..1457039,1460009..1460091,
FT                   1477460..1477625,1477947..1478056,1479887..1480009,
FT                   1480985..1481062,1482366..1482482,1484041..1484208,
FT                   1493012..1493095))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9092"
FT                   /product="mCG9092, isoform CRA_c"
FT                   /note="gene_id=mCG9092.1 transcript_id=mCT8947.2
FT                   protein_id=mCP19329.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q8VC77"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:2151104"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VC77"
FT                   /protein_id="EDL32252.1"
FT                   /translation="MNSKQQTVLLNDGHFIPILGFGTSAPQEVPRSKATEATKIAIDAG
FT                   FRHIDCAAVYQNEKEVGLAIRSKIVDGTVKREDIFCTSKVWQTFHRPELVQVCLEQSLK
FT                   QLQLDYVDLYLIHFPIAMKPGENYFPKDENGKFIYDAVDICDTWEAMEKCKDAGLAKSI
FT                   GVCNFNRRQLEKILSKPGLKYKPVCNQVECHPYLNQRKLLDFCRSKDIVLVAHSALGSN
FT                   RDKEWVDKSFPVLLDDPVLGSMAKKYNRTPALIALRYQVQRGVVVLAKSFIEKRIKENM
FT                   QVFEFQLTSVDMKVLDGLNKNIRYIGSSISEDHPDFPFLDEY"
FT   CDS             complement(join(1456997..1457039,1460009..1460091,
FT                   1477460..1477625,1477947..1478056,1479887..1480009,
FT                   1480985..1481062,1482447..1482482,1484041..1484208,
FT                   1493026..1493064))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9092"
FT                   /product="mCG9092, isoform CRA_a"
FT                   /note="gene_id=mCG9092.1 transcript_id=mCT167901.0
FT                   protein_id=mCP90811.0 isoform=CRA_a"
FT                   /protein_id="EDL32250.1"
FT                   /translation="MMVTSSLYSGLVPVPRSKATEATKIAIDAGFRHIDCAAVYQNEKE
FT                   VGLAIRSKIVDGTVKREDIFCTSKVWQTFHRPELVQPGENYFPKDENGKFIYDAVDICD
FT                   TWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQVECHPYLNQRKLLDF
FT                   CRSKDIVLVAHSALGSNRDKEWVDKSFPVLLDDPVLGSMAKKYNRTPALIALRYQVQRG
FT                   VVVLAKSFIEKRIKENMQVFEFQLTSVDMKVLDGLNKNIRYIGSSISEDHPDFPFLDEY
FT                   "
FT   mRNA            complement(join(1476938..1477625,1477947..1478056,
FT                   1479887..1480009,1480985..1481062,1482447..1482482,
FT                   1484041..1484208,1493012..1493114))
FT                   /locus_tag="mCG_9092"
FT                   /product="mCG9092, transcript variant mCT178286"
FT                   /note="gene_id=mCG9092.1 transcript_id=mCT178286.0 created
FT                   on 02-JAN-2003"
FT   CDS             complement(join(1477436..1477625,1477947..1478056,
FT                   1479887..1480009,1480985..1481062,1482447..1482482,
FT                   1484041..1484208,1493012..1493095))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9092"
FT                   /product="mCG9092, isoform CRA_b"
FT                   /note="gene_id=mCG9092.1 transcript_id=mCT178286.0
FT                   protein_id=mCP101208.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CZU0"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:2151104"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CZU0"
FT                   /protein_id="EDL32251.1"
FT                   /translation="MNSKQQTVLLNDGHFIPILGFGTSAPQEVPRSKATEATKIAIDAG
FT                   FRHIDCAAVYQNEKEVGLAIRSKIVDGTVKREDIFCTSKVWQTFHRPELVQPGENYFPK
FT                   DENGKFIYDAVDICDTWEAMEKCKDAGLAKSIGVCNFNRRQLEKILSKPGLKYKPVCNQ
FT                   VECHPYLNQRKLLDFCRSKDIVLVAHSALGSNRDKEWVDKSFPVLLDDPVLGSMAKKYN
FT                   RTPALIALRYQVQRGVVVLAKSFIEKRIKENMQVMSCFGY"
FT   gene            <1537883..>1538418
FT                   /locus_tag="mCG_1034351"
FT                   /note="gene_id=mCG1034351.0"
FT   mRNA            join(<1537883..1538124,1538195..>1538418)
FT                   /locus_tag="mCG_1034351"
FT                   /product="mCG1034351"
FT                   /note="gene_id=mCG1034351.0 transcript_id=mCT152055.0
FT                   created on 12-APR-2002"
FT   CDS             <1538232..>1538418
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034351"
FT                   /product="mCG1034351"
FT                   /note="gene_id=mCG1034351.0 transcript_id=mCT152055.0
FT                   protein_id=mCP51626.0"
FT                   /protein_id="EDL32253.1"
FT                   /translation="ESSVAGEALLGADYKRCSYRDHQLLKFSGKGTDGCFSYKNLCACD
FT                   YWIHQVTSCSSLEITAR"
FT   gene            1543969..1562533
FT                   /gene="Akr1c21"
FT                   /locus_tag="mCG_9096"
FT                   /note="gene_id=mCG9096.1"
FT   mRNA            join(1543969..1544126,1545051..1545218,1546126..1546242,
FT                   1546965..1547042,1547251..1547373,1550180..1550289,
FT                   1557141..1557306,1559772..1559854,1562330..1562533)
FT                   /gene="Akr1c21"
FT                   /locus_tag="mCG_9096"
FT                   /product="aldo-keto reductase family 1, member C21"
FT                   /note="gene_id=mCG9096.1 transcript_id=mCT8951.1 created on
FT                   12-APR-2002"
FT   CDS             join(1544043..1544126,1545051..1545218,1546126..1546242,
FT                   1546965..1547042,1547251..1547373,1550180..1550289,
FT                   1557141..1557306,1559772..1559854,1562330..1562372)
FT                   /codon_start=1
FT                   /gene="Akr1c21"
FT                   /locus_tag="mCG_9096"
FT                   /product="aldo-keto reductase family 1, member C21"
FT                   /note="gene_id=mCG9096.1 transcript_id=mCT8951.1
FT                   protein_id=mCP19308.2"
FT                   /protein_id="EDL32254.1"
FT                   /translation="MNSKCHCVILNDGNFIPVLGFGTALPVECPKSKAKELTKIAIDAG
FT                   FHHFDSASVYNTEDRVGEAIRSKIADGTVRREDIFYTSKVWCTSLRPELVRASLVRSLQ
FT                   KLQFDYVDLYLIHYPMALKPGEENFPVDEHGKLIFDRVDLCATWEAMEKCKDAGLTKSI
FT                   GVSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQMKLLDFCKSKDIVLVAYGVLGTQ
FT                   RYGGWVDQNSPVLLDEPVLGSMAKKYNRTPALIALRYQLQRGIVVLNTSLKEERIKENM
FT                   QVFEFQLSSEDMKVLDGLNRNMRYIPAAIFKGHPNWPFLDEY"
FT   gene            complement(1571058..1587422)
FT                   /gene="Akr1e1"
FT                   /locus_tag="mCG_9095"
FT                   /note="gene_id=mCG9095.2"
FT   mRNA            complement(join(1571058..1571824,1572088..1572170,
FT                   1573597..1573680,1574186..1574258,1575996..1576093,
FT                   1577281..1577403,1579729..1579806,1581192..1581308,
FT                   1585643..1585810,1587337..1587422))
FT                   /gene="Akr1e1"
FT                   /locus_tag="mCG_9095"
FT                   /product="aldo-keto reductase family 1, member E1,
FT                   transcript variant mCT8950"
FT                   /note="gene_id=mCG9095.2 transcript_id=mCT8950.2 created on
FT                   12-APR-2002"
FT   CDS             complement(join(1571782..1571824,1572088..1572170,
FT                   1573597..1573680,1574186..1574258,1575996..1576093,
FT                   1577281..1577403,1579729..1579806,1581192..1581308,
FT                   1585643..1585810,1587337..1587375))
FT                   /codon_start=1
FT                   /gene="Akr1e1"
FT                   /locus_tag="mCG_9095"
FT                   /product="aldo-keto reductase family 1, member E1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG9095.2 transcript_id=mCT8950.2
FT                   protein_id=mCP19347.2 isoform=CRA_b"
FT                   /protein_id="EDL32256.1"
FT                   /translation="MENIPTVGLGTWKASPGEVTDAVKLAINLGYRHFDCAYLYHNESE
FT                   VGMGISEKIKEGVVKREDLFVVSKLWCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWP
FT                   MGFKPGEKDIPLDRNGKVIPSHTSFLDTWEAMEDLVFEGLVKNLGVSNFNHEQLERLLD
FT                   KPGLRVRPITNQIECHPYLNQKKLIDFCHKRNVSVTAYRPLGGSGGGFHLMDDTVIRKI
FT                   AKKHGKSPAQILIRFQIQRNLIVIPKSVTPSRIRENIQVFDFELTEKDMEELLSLDKNL
FT                   RLATFPTTENHQDYPFHIEY"
FT   mRNA            complement(join(<1573609..1573680,1574186..1574258,
FT                   1575996..1576093,1577281..1577403,1579729..1579806,
FT                   1581192..1581308,1587337..>1587411))
FT                   /gene="Akr1e1"
FT                   /locus_tag="mCG_9095"
FT                   /product="aldo-keto reductase family 1, member E1,
FT                   transcript variant mCT192999"
FT                   /note="gene_id=mCG9095.2 transcript_id=mCT192999.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<1573609..1573680,1574186..1574258,
FT                   1575996..1576093,1577281..1577403,1579729..1579806,
FT                   1581192..1581308,1587337..>1587396))
FT                   /codon_start=1
FT                   /gene="Akr1e1"
FT                   /locus_tag="mCG_9095"
FT                   /product="aldo-keto reductase family 1, member E1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9095.2 transcript_id=mCT192999.0
FT                   protein_id=mCP113978.0 isoform=CRA_a"
FT                   /protein_id="EDL32255.1"
FT                   /translation="AFEQRGTMENIPTVGLGTWKLWCTCHKKSLVKTACTNTLEALNLD
FT                   YLDLYLIHWPMGFKPGEKDIPLDRNGKVIPSHTSFLDTWEAMEDLVFEGLVKNLGVSNF
FT                   NHEQLERLLDKPGLRVRPITNQIECHPYLNQKKLIDFCHKRNVSVTAYRPLGGSGGGFH
FT                   LMDDTVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVTPSRIR"
FT   gene            complement(1587070..>1587375)
FT                   /locus_tag="mCG_140072"
FT                   /note="gene_id=mCG140072.0"
FT   mRNA            complement(1587070..>1587375)
FT                   /locus_tag="mCG_140072"
FT                   /product="mCG140072"
FT                   /note="gene_id=mCG140072.0 transcript_id=mCT167902.0
FT                   created on 12-APR-2002"
FT   CDS             complement(1587085..>1587207)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140072"
FT                   /product="mCG140072"
FT                   /note="gene_id=mCG140072.0 transcript_id=mCT167902.0
FT                   protein_id=mCP90807.0"
FT                   /protein_id="EDL32257.1"
FT                   /translation="GFPPDGLEEKLDSLSCDPKTPCSLRGFKAVRLTLNKAVCC"
FT   gene            1592328..1592955
FT                   /locus_tag="mCG_114459"
FT                   /note="gene_id=mCG114459.0"
FT   mRNA            1592328..1592955
FT                   /locus_tag="mCG_114459"
FT                   /product="mCG114459"
FT                   /note="gene_id=mCG114459.0 transcript_id=mCT115551.0
FT                   created on 12-APR-2002"
FT   CDS             1592355..1592837
FT                   /codon_start=1
FT                   /locus_tag="mCG_114459"
FT                   /product="mCG114459"
FT                   /note="gene_id=mCG114459.0 transcript_id=mCT115551.0
FT                   protein_id=mCP51646.1"
FT                   /protein_id="EDL32258.1"
FT                   /translation="MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKYLRNMHF
FT                   AKTHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGK
FT                   RIQSYMAKGQRLCQPNPKVQIKAGAKAPAKAQASAPAQAPKGAQAPKGTQAPVKAP"
FT   gene            <1618121..1725485
FT                   /locus_tag="mCG_140070"
FT                   /note="gene_id=mCG140070.0"
FT   mRNA            join(<1618121..1618195,1675703..1675799,1678893..1678977,
FT                   1679208..1679285,1718733..1718900,1721901..1721954,
FT                   1725343..1725485)
FT                   /locus_tag="mCG_140070"
FT                   /product="mCG140070"
FT                   /note="gene_id=mCG140070.0 transcript_id=mCT167893.0
FT                   created on 12-APR-2002"
FT   gene            complement(1643461..>1685566)
FT                   /locus_tag="mCG_1034352"
FT                   /note="gene_id=mCG1034352.0"
FT   mRNA            complement(join(1643461..1643581,1685368..>1685566))
FT                   /locus_tag="mCG_1034352"
FT                   /product="mCG1034352"
FT                   /note="gene_id=mCG1034352.0 transcript_id=mCT152056.1
FT                   created on 13-MAY-2002"
FT   CDS             complement(join(1643504..1643581,1685368..>1685565))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034352"
FT                   /product="mCG1034352"
FT                   /note="gene_id=mCG1034352.0 transcript_id=mCT152056.1
FT                   protein_id=mCP51628.1"
FT                   /protein_id="EDL32260.1"
FT                   /translation="LSLTHTHTHTHKHTHTPRHTHSHTYTHTKTHTDTYTHIDKHRDKI
FT                   HTHTHTHTHSFCQLHETLCKAVSLTLTHTHTHTHTHTHTHTHTHAA"
FT   CDS             join(<1678928..1678977,1679208..1679285,1718733..1718900,
FT                   1721901..1721954,1725343..1725397)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140070"
FT                   /product="mCG140070"
FT                   /note="gene_id=mCG140070.0 transcript_id=mCT167893.0
FT                   protein_id=mCP90809.0"
FT                   /protein_id="EDL32259.1"
FT                   /translation="HQLLFPISTSQMDLRRRDSDVLEVPVVLHLLEREVQMAVNCLILK
FT                   LSVYMRRTTLNVCFRGLGLHECTNMAGFCDAAIEPRTSSIQGSDSINCSSFPALFHGMV
FT                   HNIDPASGSISPMESANLKVDGTSAFWLQL"
FT   gene            1748026..1808730
FT                   /gene="LOC432723"
FT                   /locus_tag="mCG_1051075"
FT                   /note="gene_id=mCG1051075.0"
FT   mRNA            join(1748026..1748073,1805789..1805912,1806442..1808730)
FT                   /gene="LOC432723"
FT                   /locus_tag="mCG_1051075"
FT                   /product="hypothetical protein LOC432723"
FT                   /note="gene_id=mCG1051075.0 transcript_id=mCT194864.0
FT                   created on 27-JAN-2005"
FT   CDS             join(1748037..1748073,1805789..1805912,1806442..1806697)
FT                   /codon_start=1
FT                   /gene="LOC432723"
FT                   /locus_tag="mCG_1051075"
FT                   /product="hypothetical protein LOC432723"
FT                   /note="gene_id=mCG1051075.0 transcript_id=mCT194864.0
FT                   protein_id=mCP115893.0"
FT                   /protein_id="EDL32261.1"
FT                   /translation="MTHASSAWRLLLCCYAILKWPSVSILLVLCLAEIDLVVISCGAEE
FT                   ETQNLFYTSIHHHCYTEIHEPNDPTMNYRERNTYEPYSLSLSLSLSSLSLPPFPLLSSP
FT                   ALCTRLPCSMYMLDCGVSGLCPPYFLTQALQHIR"
FT   gene            1792603..1793609
FT                   /locus_tag="mCG_114456"
FT                   /note="gene_id=mCG114456.0"
FT   mRNA            1792603..1793609
FT                   /locus_tag="mCG_114456"
FT                   /product="mCG114456"
FT                   /note="gene_id=mCG114456.0 transcript_id=mCT115548.0
FT                   created on 15-APR-2002"
FT   CDS             1792709..1793146
FT                   /codon_start=1
FT                   /locus_tag="mCG_114456"
FT                   /product="mCG114456"
FT                   /note="gene_id=mCG114456.0 transcript_id=mCT115548.0
FT                   protein_id=mCP51643.1"
FT                   /db_xref="GOA:Q4KL41"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="InterPro:IPR022422"
FT                   /db_xref="InterPro:IPR023392"
FT                   /db_xref="MGI:MGI:1915202"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KL41"
FT                   /protein_id="EDL32262.1"
FT                   /translation="MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQ
FT                   KLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQ
FT                   QLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE"
FT   gene            complement(2160187..>2160747)
FT                   /locus_tag="mCG_49970"
FT                   /note="gene_id=mCG49970.2"
FT   mRNA            complement(2160187..>2160747)
FT                   /locus_tag="mCG_49970"
FT                   /product="mCG49970"
FT                   /note="gene_id=mCG49970.2 transcript_id=mCT50153.2 created
FT                   on 15-APR-2002"
FT   CDS             complement(2160463..>2160747)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49970"
FT                   /product="mCG49970"
FT                   /note="gene_id=mCG49970.2 transcript_id=mCT50153.2
FT                   protein_id=mCP39798.2"
FT                   /protein_id="EDL32263.1"
FT                   /translation="ALNKKGYEAKEYYEALPELKLVIDQIDNGFFSPNQPGLFKDITNM
FT                   LFYHDRFKVFADYEAYVKCQEKVSQLYMNQKAWNTMVLKNIDASGKFSQ"
FT   gene            complement(<2670009..>2695663)
FT                   /locus_tag="mCG_1034361"
FT                   /note="gene_id=mCG1034361.0"
FT   mRNA            complement(join(<2670009..2670227,2695617..>2695663))
FT                   /locus_tag="mCG_1034361"
FT                   /product="mCG1034361"
FT                   /note="gene_id=mCG1034361.0 transcript_id=mCT152065.0
FT                   created on 15-APR-2002"
FT   CDS             complement(<2670009..>2670190)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034361"
FT                   /product="mCG1034361"
FT                   /note="gene_id=mCG1034361.0 transcript_id=mCT152065.0
FT                   protein_id=mCP51562.0"
FT                   /protein_id="EDL32264.1"
FT                   /translation="SQHLGGRGRRISEFEASLVYRVSSRTARAIQRNPVSKNQKKKKKK
FT                   KKKKKKKKWRQHSIN"
FT   gene            complement(2800948..>2803531)
FT                   /locus_tag="mCG_144848"
FT                   /note="gene_id=mCG144848.0"
FT   mRNA            complement(join(2800948..2801390,2802288..2802343,
FT                   2803436..>2803531))
FT                   /locus_tag="mCG_144848"
FT                   /product="mCG144848"
FT                   /note="gene_id=mCG144848.0 transcript_id=mCT184272.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(2801143..2801390,2802288..>2802321))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144848"
FT                   /product="mCG144848"
FT                   /note="gene_id=mCG144848.0 transcript_id=mCT184272.0
FT                   protein_id=mCP105537.0"
FT                   /protein_id="EDL32265.1"
FT                   /translation="VAFSHCICLSEGFLVDGFMEVTFFSGPARELLSGLQNLGVVRILP
FT                   STSTEEALPLKEDSGNVVEDLATSHLPPCLPRTSSGVPGGDMWKRAGK"
FT   gene            2806930..2815827
FT                   /gene="Klf6"
FT                   /locus_tag="mCG_1722"
FT                   /note="gene_id=mCG1722.2"
FT   mRNA            join(2806930..2807279,2810205..2810781,2812076..2812199,
FT                   2812669..2815827)
FT                   /gene="Klf6"
FT                   /locus_tag="mCG_1722"
FT                   /product="Kruppel-like factor 6, transcript variant
FT                   mCT1135"
FT                   /note="gene_id=mCG1722.2 transcript_id=mCT1135.2 created on
FT                   15-APR-2002"
FT   CDS             join(2807076..2807279,2810205..2810781,2812076..2812199,
FT                   2812669..2812720)
FT                   /codon_start=1
FT                   /gene="Klf6"
FT                   /locus_tag="mCG_1722"
FT                   /product="Kruppel-like factor 6, isoform CRA_a"
FT                   /note="gene_id=mCG1722.2 transcript_id=mCT1135.2
FT                   protein_id=mCP19317.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BPQ2"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1346318"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BPQ2"
FT                   /protein_id="EDL32266.1"
FT                   /translation="MKLSPALPGTVSARTPDRSPPCFPDSEDCLFQPDMDVLPMCSIFQ
FT                   ELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKFILA
FT                   RGEKKEESELKISSSPPEDSLISSSFNYNLETNSLNSDVSSESSDSSEELSPTTKFTSD
FT                   PIGEVLVNSGNLSSSVISTPPSSPEVNRESSQLWGCGPGDLPSPGKVRSGTSGKSGDKG
FT                   NGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDE
FT                   LTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL"
FT   mRNA            join(<2809001..2809062,2810205..2810781,2812076..2812199,
FT                   2812669..2815827)
FT                   /gene="Klf6"
FT                   /locus_tag="mCG_1722"
FT                   /product="Kruppel-like factor 6, transcript variant
FT                   mCT168076"
FT                   /note="gene_id=mCG1722.2 transcript_id=mCT168076.0 created
FT                   on 15-APR-2002"
FT   CDS             join(<2809060..2809062,2810205..2810781,2812076..2812199,
FT                   2812669..2812720)
FT                   /codon_start=1
FT                   /gene="Klf6"
FT                   /locus_tag="mCG_1722"
FT                   /product="Kruppel-like factor 6, isoform CRA_b"
FT                   /note="gene_id=mCG1722.2 transcript_id=mCT168076.0
FT                   protein_id=mCP90926.0 isoform=CRA_b"
FT                   /protein_id="EDL32267.1"
FT                   /translation="KTCLELERYLQSEPCYVSASEIKFDSQEDLWTKFILARGEKKEES
FT                   ELKISSSPPEDSLISSSFNYNLETNSLNSDVSSESSDSSEELSPTTKFTSDPIGEVLVN
FT                   SGNLSSSVISTPPSSPEVNRESSQLWGCGPGDLPSPGKVRSGTSGKSGDKGNGDASPDG
FT                   RRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKH
FT                   TGAKPFKCSHCDRCFSRSDHLALHMKRHL"
FT   gene            3497293..3530334
FT                   /gene="Pitrm1"
FT                   /locus_tag="mCG_1726"
FT                   /note="gene_id=mCG1726.2"
FT   mRNA            join(3497293..3497355,3498706..3498808,3501758..3501864,
FT                   3502306..3502457,3504450..3504564,3504648..3504744,
FT                   3505638..3505798,3506858..3506984,3507252..3507340,
FT                   3508693..3508821,3509368..3509481,3509940..3510036,
FT                   3511291..3511425,3512714..3512852,3514329..3514445,
FT                   3516688..3516820,3518002..3518122,3518237..3518313,
FT                   3518538..3518703,3519940..3520040,3522379..3522499,
FT                   3523655..3523726,3524312..3524424,3526685..3526810,
FT                   3527736..3527881,3528713..3528815,3528945..3530334)
FT                   /gene="Pitrm1"
FT                   /locus_tag="mCG_1726"
FT                   /product="pitrilysin metallepetidase 1"
FT                   /note="gene_id=mCG1726.2 transcript_id=mCT1034.2 created on
FT                   15-APR-2002"
FT   CDS             join(3497300..3497355,3498706..3498808,3501758..3501864,
FT                   3502306..3502457,3504450..3504564,3504648..3504744,
FT                   3505638..3505798,3506858..3506984,3507252..3507340,
FT                   3508693..3508821,3509368..3509481,3509940..3510036,
FT                   3511291..3511425,3512714..3512852,3514329..3514445,
FT                   3516688..3516820,3518002..3518122,3518237..3518313,
FT                   3518538..3518703,3519940..3520040,3522379..3522499,
FT                   3523655..3523726,3524312..3524424,3526685..3526810,
FT                   3527736..3527881,3528713..3528815,3528945..3529038)
FT                   /codon_start=1
FT                   /gene="Pitrm1"
FT                   /locus_tag="mCG_1726"
FT                   /product="pitrilysin metallepetidase 1"
FT                   /note="gene_id=mCG1726.2 transcript_id=mCT1034.2
FT                   protein_id=mCP19307.2"
FT                   /protein_id="EDL32268.1"
FT                   /translation="MWRFSGRRGLCAVQRLSCGRVHHRVWREKSDQACERALQYKVGEK
FT                   IHGFTVNQVTPVPELFLTAVKLSHDNTGARYLHLAREDKNNLFSVQFRTTPMDSTGVPH
FT                   VLEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAMTASDYTIYPFSTQNPKDFQNLLSVY
FT                   LDATFFPCLRELDFWQEGWRLEHENPRDPQTPLIFKGVVFNEMKGAFTDNERIFSQHLQ
FT                   NKLLPDHTYSVVSGGDPLCIPELTWEQLKQFHATHYHPSNARFFTYGNFQLEGHLKQIH
FT                   EEALSKFQRLEQSTAVPAQPHWDKPREFHITCGPDSLATETAKQTTVSVSFLLPDITDT
FT                   FEAFTLSLLSSLLIAGPNSPFYKALIESGLGTDFSPDVGYNGYTREAYFSVGLQGIAEK
FT                   DVKTVRELVDRTIEEVIEKGFEDDRIEALLHKIEIQTKHQSASFGLTLTSYIASCWNHD
FT                   GDPVELLQIGSQLTRFRKCLKENPKFLQEKVEQYFKNNQHKLTLSMKPDDKYYEKQTQM
FT                   ETEKLEQKVNSLSPADKQQIYEKGLELQTQQSKHQDASCLPALKVSDIEPSMPFTKLDI
FT                   GLAAGDIPVQYCPQPTNGMVYFRAFSSLNTLPEDLRPIVPLFCSVLTKLGCGILNYREQ
FT                   AQQIELKTGGMSVTPHVLPDDSQLDTYEQGVLFSSLCLERNLPDMMHLWSEIFNNPCFE
FT                   EEEHFKVLVKMTAQELSNGISDSGHLYAALRASKTLTPSGDLQETFSGMDQVKVMKRIA
FT                   EMTDIKPILRKLPRIKKYLLNCDNMRCSVNATPQQMPQAEKEVENFLRNVGRSKKERKP
FT                   VRPHIVEKPTPSGPSGAAHVSGSQIVRKLVTDPTFKPCQMKTHFVLPFPVNYIGECVRT
FT                   VPYADPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLTHSGIFTLYSYRDPNSIET
FT                   LQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDSPVAPSDKGMDHFLYGLSDEMKQAYR
FT                   EQLFAVNHDKLTSVSHKYLGIGKSTHGLAILGPENSKIAKDPSWIIK"
FT   gene            complement(3530470..3596788)
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /note="gene_id=mCG1724.1"
FT   mRNA            complement(join(3530470..3530887,3531698..3531800,
FT                   3533896..3533995,3535775..3535886,3536347..3536408,
FT                   3537784..3537948,3547154..3547306,3548034..3548121,
FT                   3549891..3549961,3552008..3552154,3552374..3552443,
FT                   3552694..3552758,3554251..3554376,3554931..3555023,
FT                   3563694..3563789,3568165..3568273,3568510..3568554,
FT                   3569876..3570041,3570897..3571086,3574126..3574203,
FT                   3584949..3585022,3596623..3596788))
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, transcript variant
FT                   mCT1036"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT1036.1 created on
FT                   15-APR-2002"
FT   mRNA            complement(join(3530470..3530887,3531698..3531800,
FT                   3533896..3533995,3535775..3535840,3584938..3585022,
FT                   3596623..3596734))
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, transcript variant
FT                   mCT168078"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT168078.0 created
FT                   on 15-APR-2002"
FT   mRNA            complement(join(3530477..3530887,3531698..3531800,
FT                   3533896..3533995,3535775..3535886,3536347..3536408,
FT                   3537784..3537948,3542396..3542548,3548034..3548121,
FT                   3549891..3549961,3552008..3552154,3552374..3552443,
FT                   3552694..3552758,3554251..3554376,3554931..3555023,
FT                   3563694..3563789,3568165..3568273,3568510..3568554,
FT                   3569876..3570041,3570897..3571086,3574126..3574203,
FT                   3584949..3585022,3596623..>3596778))
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, transcript variant
FT                   mCT193004"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT193004.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3530511..3530887,3531698..3531800,
FT                   3533896..3533995,3534502..3534567,3535775..3535886,
FT                   3536347..3536408,3537784..3537948,3542396..3542459,
FT                   3544258..3544331,3545279..3545353,3547154..3547306,
FT                   3548034..3548121,3549891..3549961,3552008..3552154,
FT                   3552374..3552443,3552694..3552758,3554251..3554376,
FT                   3554931..3555023,3563694..3563789,3568165..3568273,
FT                   3568510..3568554,3569876..3570041,3570897..3571086,
FT                   3574126..3574203,3584949..3585022,3596623..3596788))
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, transcript variant
FT                   mCT168079"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT168079.0 created
FT                   on 15-APR-2002"
FT   mRNA            complement(join(3530527..3530887,3531698..3531800,
FT                   3533896..3533995,3535775..3535886,3536347..3536408,
FT                   3537784..3537948,3544258..3544312,3547154..3547306,
FT                   3548034..3548121,3549891..3549961,3552008..3552154,
FT                   3552374..3552443,3552694..3552758,3554251..3554376,
FT                   3554931..3555023,3563694..3563789,3568165..3568273,
FT                   3568510..3568554,3569876..3570041,3570897..3571086,
FT                   3574126..3574203,3584949..3585022,3596623..3596788))
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, transcript variant
FT                   mCT168077"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT168077.0 created
FT                   on 15-APR-2002"
FT   CDS             complement(join(3530755..3530887,3531698..3531800,
FT                   3533896..3533995,3535775..3535886,3536347..3536408,
FT                   3537784..3537948,3542396..3542548,3548034..3548121,
FT                   3549891..3549961,3552008..3552154,3552374..3552443,
FT                   3552694..3552758,3554251..3554376,3554931..3555023,
FT                   3563694..3563789,3568165..3568273,3568510..3568554,
FT                   3569876..3570041,3570897..3571086,3574126..3574203,
FT                   3584949..3585022,3596623..>3596776))
FT                   /codon_start=1
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, isoform CRA_e"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT193004.0
FT                   protein_id=mCP113975.0 isoform=CRA_e"
FT                   /protein_id="EDL32273.1"
FT                   /translation="VLAEYGSVWRLYLLIMSDLDSSSSSAYPKYLEHLSGDGKAIGVLT
FT                   SGGDAQGMNAAVRAVVRMGIYTGAKVYFIYEGYQGLVDGGSNIVEAKWDCVSSILQVGG
FT                   TIIGSARCKAFRSREGRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSGLLEELA
FT                   RNGDIDNDTVQKYSYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSH
FT                   QRTFVLEVMGRHCGYLALVSALTCGADWVFLPESPPEEDWEENMCLKLSENRARKKRLN
FT                   IIIVSEGAIDMQNKPITSEKIKELVVKNLGFDTRVTILGHVQRGGTPSAFDRILASRMG
FT                   VEAVIALLEATPETPACVVSLRGNQAVRLPLMECVQMTQDVQKAMDERRFKEAVKLRGR
FT                   RFEGNLNTYKRLAIKLPDEKIVKSNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHKMF
FT                   AIYDGFEGFANGQIKEIGWADVGGWTGQGGSILGTKRTLPGKYLEKIAEQMHSHSINAL
FT                   LIIGGFEGYHGAIMLSEARNNHEEFCIPICVLPATISNDIPGSDISIGCDTALNVIVET
FT                   CDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEPFDIGDLQSNVVH
FT                   LTEKMKTSIQRGLVLRNESCSVNYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSP
FT                   FDRNFGTKISAKAMEWISAKLKGSQGTGKKFVSDDSICVLGICKRDLLFQPVAELKKVT
FT                   DFEHRIPKEQWWLKLRPIMKILAKYEASYDMSDSGKLESLQHHEEL"
FT   CDS             complement(join(3530755..3530887,3531698..3531800,
FT                   3533896..3533995,3535775..3535886,3536347..3536408,
FT                   3537784..3537948,3547154..3547306,3548034..3548121,
FT                   3549891..3549961,3552008..3552154,3552374..3552443,
FT                   3552694..3552758,3554251..3554376,3554931..3555023,
FT                   3563694..3563789,3568165..3568273,3568510..3568554,
FT                   3569876..3570041,3570897..3571086,3574126..3574203,
FT                   3584949..3585022,3596623..3596731))
FT                   /codon_start=1
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, isoform CRA_f"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT1036.1
FT                   protein_id=mCP19322.1 isoform=CRA_f"
FT                   /protein_id="EDL32274.1"
FT                   /translation="MSDLDSSSSSAYPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAV
FT                   VRMGIYTGAKVYFIYEGYQGLVDGGSNIVEAKWDCVSSILQVGGTIIGSARCKAFRSRE
FT                   GRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGDIDNDTVQKYSY
FT                   LNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGY
FT                   LALVSALTCGADWVFLPESPPEEDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKP
FT                   ITSEKIKELVVKNLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPETP
FT                   ACVVSLRGNQAVRLPLMECVQMTQDVQKAMDERRFKEAVKLRGRRFEGNLNTYKRLAIK
FT                   LPDEKIVKSNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHKMFAIYDGFEGFANGQIK
FT                   EIGWADVGGWTGQGGSILGTKRTLPGKYLEKIAEQMHSHSINALLIIGGFEAYLGLLEL
FT                   AAAREKHEAFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRV
FT                   FIIETMGGYCGYLANMGALAAGADAAYIFEEPFDIGDLQSNVVHLTEKMKTSIQRGLVL
FT                   RNESCSVNYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAME
FT                   WISAKLKGSQGTGKKFVSDDSICVLGICKRDLLFQPVAELKKVTDFEHRIPKEQWWLKL
FT                   RPIMKILAKYEASYDMSDSGKLESLQHHEEL"
FT   CDS             complement(join(3530755..3530887,3531698..3531800,
FT                   3533896..3533995,3535775..3535783))
FT                   /codon_start=1
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, isoform CRA_b"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT168078.0
FT                   protein_id=mCP90911.0 isoform=CRA_b"
FT                   /protein_id="EDL32270.1"
FT                   /translation="MQQGGAPSPFDRNFGTKISAKAMEWISAKLKGSQGTGKKFVSDDS
FT                   ICVLGICKRDLLFQPVAELKKVTDFEHRIPKEQWWLKLRPIMKILAKYEASYDMSDSGK
FT                   LESLQHHEEL"
FT   CDS             complement(join(3537932..3537948,3544258..3544312,
FT                   3547154..3547306,3548034..3548121,3549891..3549961,
FT                   3552008..3552154,3552374..3552443,3552694..3552758,
FT                   3554251..3554376,3554931..3555023,3563694..3563789,
FT                   3568165..3568273,3568510..3568554,3569876..3570041,
FT                   3570897..3571086,3574126..3574203,3584949..3585022,
FT                   3596623..3596731))
FT                   /codon_start=1
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, isoform CRA_a"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT168077.0
FT                   protein_id=mCP90920.0 isoform=CRA_a"
FT                   /protein_id="EDL32269.1"
FT                   /translation="MSDLDSSSSSAYPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAV
FT                   VRMGIYTGAKVYFIYEGYQGLVDGGSNIVEAKWDCVSSILQVGGTIIGSARCKAFRSRE
FT                   GRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGDIDNDTVQKYSY
FT                   LNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGY
FT                   LALVSALTCGADWVFLPESPPEEDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKP
FT                   ITSEKIKELVVKNLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPETP
FT                   ACVVSLRGNQAVRLPLMECVQMTQDVQKAMDERRFKEAVKLRGRRFEGNLNTYKRLAIK
FT                   LPDEKIVKSNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHKMFAIYDGFEGFANGQIK
FT                   EIGWADVGGWTGQGGSILGTKRTLPGKYLEKIAEQMHSHSINALLIIGGFEAYLGLLEL
FT                   AAAREKHEAFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDDLEARLSGWLLQSLLL
FT                   LLDVRPH"
FT   mRNA            complement(join(3542268..3545357,3548034..3548121,
FT                   3549891..3549961,3552008..3552154,3552374..3552443,
FT                   3552694..3552758,3554251..3554376,3554931..3555023,
FT                   3563694..3563789,3568165..3568273,3568510..3568554,
FT                   3569876..3570041,3570897..3571086,3574126..3574203,
FT                   3584949..3585022,3596623..>3596778))
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, transcript variant
FT                   mCT193003"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT193003.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3545343..3545357,3548034..3548121,
FT                   3549891..3549961,3552008..3552154,3552374..3552443,
FT                   3552694..3552758,3554251..3554376,3554931..3555023,
FT                   3563694..3563789,3568165..3568273,3568510..3568554,
FT                   3569876..3570041,3570897..3571086,3574126..3574203,
FT                   3584949..3585022,3596623..>3596776))
FT                   /codon_start=1
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, isoform CRA_d"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT193003.0
FT                   protein_id=mCP113974.0 isoform=CRA_d"
FT                   /protein_id="EDL32272.1"
FT                   /translation="VLAEYGSVWRLYLLIMSDLDSSSSSAYPKYLEHLSGDGKAIGVLT
FT                   SGGDAQGMNAAVRAVVRMGIYTGAKVYFIYEGYQGLVDGGSNIVEAKWDCVSSILQVGG
FT                   TIIGSARCKAFRSREGRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSGLLEELA
FT                   RNGDIDNDTVQKYSYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSH
FT                   QRTFVLEVMGRHCGYLALVSALTCGADWVFLPESPPEEDWEENMCLKLSENRARKKRLN
FT                   IIIVSEGAIDMQNKPITSEKIKELVVKNLGFDTRVTILGHVQRGGTPSAFDRILASRMG
FT                   VEAVIALLEATPETPACVVSLRGNQAVRLPLMECVQMTQDVQKAMDERRFKEAVKLRGR
FT                   RFEGNLNTYKRLAIKLPDEKIVKSNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHKMF
FT                   AIYDGFEGFANGQIKEIGWADVGGWTGQGGSILGTKRTLPGKYLEKIAEQMHSHSINAL
FT                   LIIGGFEPVVI"
FT   CDS             complement(join(3545348..3545353,3547154..3547306,
FT                   3548034..3548121,3549891..3549961,3552008..3552154,
FT                   3552374..3552443,3552694..3552758,3554251..3554376,
FT                   3554931..3555023,3563694..3563789,3568165..3568273,
FT                   3568510..3568554,3569876..3570041,3570897..3571086,
FT                   3574126..3574203,3584949..3585022,3596623..3596731))
FT                   /codon_start=1
FT                   /gene="Pfkp"
FT                   /locus_tag="mCG_1724"
FT                   /product="phosphofructokinase, platelet, isoform CRA_c"
FT                   /note="gene_id=mCG1724.1 transcript_id=mCT168079.0
FT                   protein_id=mCP90917.0 isoform=CRA_c"
FT                   /protein_id="EDL32271.1"
FT                   /translation="MSDLDSSSSSAYPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAV
FT                   VRMGIYTGAKVYFIYEGYQGLVDGGSNIVEAKWDCVSSILQVGGTIIGSARCKAFRSRE
FT                   GRLKAACNLARLGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGDIDNDTVQKYSY
FT                   LNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGY
FT                   LALVSALTCGADWVFLPESPPEEDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKP
FT                   ITSEKIKELVVKNLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPETP
FT                   ACVVSLRGNQAVRLPLMECVQMTQDVQKAMDERRFKEAVKLRGRRFEGNLNTYKRLAIK
FT                   LPDEKIVKSNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHKMFAIYDGFEGFANGQIK
FT                   EIGWADVGGWTGQGGSILGTKRTLPGKYLEKIAEQMHSHSINALLIIGGFEAYLGLLEL
FT                   AAAREKHEAFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDW"
FT   gene            complement(3610607..>3611101)
FT                   /locus_tag="mCG_1723"
FT                   /note="gene_id=mCG1723.2"
FT   mRNA            complement(3610607..>3611101)
FT                   /locus_tag="mCG_1723"
FT                   /product="mCG1723"
FT                   /note="gene_id=mCG1723.2 transcript_id=mCT1040.2 created on
FT                   15-APR-2002"
FT   CDS             complement(3610689..>3611066)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1723"
FT                   /product="mCG1723"
FT                   /note="gene_id=mCG1723.2 transcript_id=mCT1040.2
FT                   protein_id=mCP19321.0"
FT                   /protein_id="EDL32275.1"
FT                   /translation="PDCWGLLGTGLLTASMSGRLWCKAIFAGYKRGLRNQREHTALLKI
FT                   EGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVIAKFR
FT                   SNLPAKAIGHRIRAMLYPSRI"
FT   gene            4244407..4245741
FT                   /pseudo
FT                   /locus_tag="mCG_112808"
FT                   /note="gene_id=mCG112808.1"
FT   mRNA            4244407..4245741
FT                   /pseudo
FT                   /locus_tag="mCG_112808"
FT                   /note="gene_id=mCG112808.1 transcript_id=mCT113880.1
FT                   created on 16-APR-2002"
FT   gene            complement(4967751..4969702)
FT                   /pseudo
FT                   /locus_tag="mCG_56313"
FT                   /note="gene_id=mCG56313.2"
FT   mRNA            complement(join(4967751..4968245,4968648..4969702))
FT                   /pseudo
FT                   /locus_tag="mCG_56313"
FT                   /note="gene_id=mCG56313.2 transcript_id=mCT56496.2 created
FT                   on 16-APR-2002"
FT   gene            5066368..5069155
FT                   /pseudo
FT                   /locus_tag="mCG_6591"
FT                   /note="gene_id=mCG6591.1"
FT   mRNA            5066368..5069155
FT                   /pseudo
FT                   /locus_tag="mCG_6591"
FT                   /note="gene_id=mCG6591.1 transcript_id=mCT6244.1 created on
FT                   16-APR-2002"
FT   gene            5142235..>5711016
FT                   /gene="Adarb2"
FT                   /locus_tag="mCG_140103"
FT                   /note="gene_id=mCG140103.0"
FT   mRNA            join(5142235..5142406,5502027..5502113,5512580..5513487,
FT                   5616343..5616457,5641636..5641804,5645902..5646053,
FT                   5657920..5658088,5676275..5676456,5696925..5697103,
FT                   5701564..5701695,5710985..>5711016)
FT                   /gene="Adarb2"
FT                   /locus_tag="mCG_140103"
FT                   /product="adenosine deaminase, RNA-specific, B2, transcript
FT                   variant mCT168082"
FT                   /note="gene_id=mCG140103.0 transcript_id=mCT168082.0
FT                   created on 16-APR-2002"
FT   mRNA            join(5142235..5142406,5502027..5502113,5512580..5513487,
FT                   5616343..5616457,5641636..5641804,5645902..5646053,
FT                   5657920..5658088,5676275..5676456,5696925..5697103,
FT                   5701564..5701780)
FT                   /gene="Adarb2"
FT                   /locus_tag="mCG_140103"
FT                   /product="adenosine deaminase, RNA-specific, B2, transcript
FT                   variant mCT168081"
FT                   /note="gene_id=mCG140103.0 transcript_id=mCT168081.0
FT                   created on 16-APR-2002"
FT   CDS             join(5142307..5142406,5502027..5502113,5512580..5513487,
FT                   5616343..5616457,5641636..5641804,5645902..5646053,
FT                   5657920..5658088,5676275..5676456,5696925..5697103,
FT                   5701564..5701695,5710985..>5711016)
FT                   /codon_start=1
FT                   /gene="Adarb2"
FT                   /locus_tag="mCG_140103"
FT                   /product="adenosine deaminase, RNA-specific, B2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140103.0 transcript_id=mCT168082.0
FT                   protein_id=mCP90925.0 isoform=CRA_a"
FT                   /protein_id="EDL32276.1"
FT                   /translation="MASVLGSGRGSGGLSSQLKCKSKRRRRRRSKRKDKVSILSTFLAP
FT                   FKYLSPGTTNTEDEDNLSTSSAEVKENRNVSNLGTRPLPPGDWARGSTPSVKRKRPLEE
FT                   GNGGHFCKLQLIWKKLSWSVTPKNALVQLHELKPGLQYRMVSQTGPVHAPVFAVAVEVN
FT                   GLTFEGTGPTKKKAKMRAAEMALKSFVQFPNAFQAHLAMGSSTSPCTDFTSDQADFPDT
FT                   LFKEFEPSSKNEDFPGCHPVDTEFLSSAYRRGRLLYHTLDLMGQALPDRSRLAPGALGE
FT                   RNPVVVLNELRSGLRYVCLSETAEKPRVKSFVMAVCVDGRTFEGSGRSKKLAKGQAAQA
FT                   ALQALFDIRLPGHIPSRSKSNLLPQDFADSVSQLVTQKFRELTVGLTSVYARHKTLAGI
FT                   VMTKGLDTKQAQVIVLSSGTKCISGEHISDQGLVVNDCHAEIVARRAFLHFLYSQLELH
FT                   LSKHQEDPERSIFIRLKEGGYRLRENILFHLYVSTSPCGDARVNSPYEITTDLNSSKHI
FT                   VRKFRGHLRTKIESGEGTVPVRGPSAVQTWDGILLGEQLITMSCTDKIASWNVLGLQGA
FT                   LLCHFIEPVYLHSIIVGSLHHTGHLARVMSHRMEGIGQLPASYRQNRPLLSGVSHAEAR
FT                   QPGKSPHFSANWVVGSADLEIINATTGKRSCGGSSRLCKHVFSAWWARLHGRLSTRIPS
FT                   HGDTPSMYCEAKQGAHTYQSVKQQLFKAFQKAGLGTWVPVRAPKCCGR"
FT   CDS             join(5142307..5142406,5502027..5502113,5512580..5513487,
FT                   5616343..5616457,5641636..5641804,5645902..5646053,
FT                   5657920..5658088,5676275..5676456,5696925..5697103,
FT                   5701564..5701740)
FT                   /codon_start=1
FT                   /gene="Adarb2"
FT                   /locus_tag="mCG_140103"
FT                   /product="adenosine deaminase, RNA-specific, B2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG140103.0 transcript_id=mCT168081.0
FT                   protein_id=mCP90914.0 isoform=CRA_b"
FT                   /protein_id="EDL32277.1"
FT                   /translation="MASVLGSGRGSGGLSSQLKCKSKRRRRRRSKRKDKVSILSTFLAP
FT                   FKYLSPGTTNTEDEDNLSTSSAEVKENRNVSNLGTRPLPPGDWARGSTPSVKRKRPLEE
FT                   GNGGHFCKLQLIWKKLSWSVTPKNALVQLHELKPGLQYRMVSQTGPVHAPVFAVAVEVN
FT                   GLTFEGTGPTKKKAKMRAAEMALKSFVQFPNAFQAHLAMGSSTSPCTDFTSDQADFPDT
FT                   LFKEFEPSSKNEDFPGCHPVDTEFLSSAYRRGRLLYHTLDLMGQALPDRSRLAPGALGE
FT                   RNPVVVLNELRSGLRYVCLSETAEKPRVKSFVMAVCVDGRTFEGSGRSKKLAKGQAAQA
FT                   ALQALFDIRLPGHIPSRSKSNLLPQDFADSVSQLVTQKFRELTVGLTSVYARHKTLAGI
FT                   VMTKGLDTKQAQVIVLSSGTKCISGEHISDQGLVVNDCHAEIVARRAFLHFLYSQLELH
FT                   LSKHQEDPERSIFIRLKEGGYRLRENILFHLYVSTSPCGDARVNSPYEITTDLNSSKHI
FT                   VRKFRGHLRTKIESGEGTVPVRGPSAVQTWDGILLGEQLITMSCTDKIASWNVLGLQGA
FT                   LLCHFIEPVYLHSIIVGSLHHTGHLARVMSHRMEGIGQLPASYRQNRPLLSGVSHAEAR
FT                   QPGKSPHFSANWVVGSADLEIINATTGKRSCGGSSRLCKHVFSAWWARLHGRLSTRIPS
FT                   HGDTPSMYCEAKQGAHTYQSVKQQLFKAFQKAGLGTWVRKPPEQDQFLLSL"
FT   gene            complement(5227790..5228852)
FT                   /pseudo
FT                   /locus_tag="mCG_113734"
FT                   /note="gene_id=mCG113734.0"
FT   mRNA            complement(5227790..5228852)
FT                   /pseudo
FT                   /locus_tag="mCG_113734"
FT                   /note="gene_id=mCG113734.0 transcript_id=mCT114820.0
FT                   created on 16-APR-2002"
FT   gene            complement(<5609639..>5610847)
FT                   /locus_tag="mCG_1034377"
FT                   /note="gene_id=mCG1034377.0"
FT   mRNA            complement(join(<5609639..5610234,5610565..5610640,
FT                   5610669..>5610847))
FT                   /locus_tag="mCG_1034377"
FT                   /product="mCG1034377"
FT                   /note="gene_id=mCG1034377.0 transcript_id=mCT152081.1
FT                   created on 16-APR-2002"
FT   CDS             complement(<5609639..>5610128)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034377"
FT                   /product="mCG1034377"
FT                   /note="gene_id=mCG1034377.0 transcript_id=mCT152081.1
FT                   protein_id=mCP51637.0"
FT                   /protein_id="EDL32278.1"
FT                   /translation="ILPVAGGLHSCLKMFLVPCPGSRVPGFGTNCCTRSTGQEERRCYR
FT                   ILLHTFIQSCLFFLHISPLFISPLFLYLPRTLGLSLFYTLSSHPRTAGHATSPGTQLQL
FT                   IRAAGANLHQIGFTCILVHLRSTQDVCVLYEEVRCKSYDLAAVPGAFGTAATPAPHISV
FT                   "
FT   gene            complement(5747199..5805240)
FT                   /gene="Wdr37"
FT                   /locus_tag="mCG_4407"
FT                   /note="gene_id=mCG4407.2"
FT   mRNA            complement(join(5747199..5750146,5763946..5764060,
FT                   5764494..5764628,5779380..5779521,5780866..5781106,
FT                   5786813..5786889,5791697..5791768,5793616..5793751,
FT                   5797752..5797816,5800807..5800903,5805063..5805240))
FT                   /gene="Wdr37"
FT                   /locus_tag="mCG_4407"
FT                   /product="WD repeat domain 37"
FT                   /note="gene_id=mCG4407.2 transcript_id=mCT3214.2 created on
FT                   16-APR-2002"
FT   CDS             complement(join(5750015..5750146,5763946..5764060,
FT                   5764494..5764628,5779380..5779521,5780866..5781106,
FT                   5786813..5786889,5791697..5791768,5793616..5793751,
FT                   5797752..5797816,5800807..5800903,5805063..5805200))
FT                   /codon_start=1
FT                   /gene="Wdr37"
FT                   /locus_tag="mCG_4407"
FT                   /product="WD repeat domain 37"
FT                   /note="gene_id=mCG4407.2 transcript_id=mCT3214.2
FT                   protein_id=mCP19306.2"
FT                   /protein_id="EDL32279.1"
FT                   /translation="MPTESGSCSTARQAKQKRKSHSLSIRRTNSSEQERTGLPREMLEG
FT                   QDSKLPSSVRSTLLELFGQIEREFENLYIENLESSHSTSQLSQKLKTTYKASTSKIVSS
FT                   FKTTTSRAICQLVKEYIGHRDGIWDVSVTRTQPIVLGTASADHTALLWSIETGKCLVKY
FT                   AGHVGSASGDQTAHIWRYVVQLPTPQPVADTSQQISGEDEIECSDKDEPDIDGDVSSDC
FT                   PTVRVPLTSLKSHQGVVIAADWLVGGKQVVTASWDRTANLYDVETSELVHSLTGHDQEL
FT                   THCCTHPTQRLVVTSSRDTTFRLWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGS
FT                   DDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMSGVRLAR
FT                   LPRSSRQGHRRMVCCSAWSEDHPICNLFTCGFDRQAIGWNINIPALLQEK"
FT   gene            5829479..5836912
FT                   /gene="Idi1"
FT                   /locus_tag="mCG_4413"
FT                   /note="gene_id=mCG4413.3"
FT   mRNA            join(5829479..5829974,5830710..5830882,5831463..5831555,
FT                   5831901..5832031,5834296..5835164,5836252..5836912)
FT                   /gene="Idi1"
FT                   /locus_tag="mCG_4413"
FT                   /product="isopentenyl-diphosphate delta isomerase"
FT                   /note="gene_id=mCG4413.3 transcript_id=mCT3205.3 created on
FT                   23-APR-2004"
FT   CDS             join(5829838..5829974,5830710..5830882,5831463..5831555,
FT                   5831901..5832031,5834296..5834613)
FT                   /codon_start=1
FT                   /gene="Idi1"
FT                   /locus_tag="mCG_4413"
FT                   /product="isopentenyl-diphosphate delta isomerase"
FT                   /note="gene_id=mCG4413.3 transcript_id=mCT3205.3
FT                   protein_id=mCP19334.3"
FT                   /db_xref="GOA:G3XA48"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="MGI:MGI:2442264"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA48"
FT                   /protein_id="EDL32280.1"
FT                   /translation="MWRGRTLARAIGYAVRGRGLEAEHAAERIEVQLSAQLLSTCSRNL
FT                   CVLGQIRHSVTMPEINTSHLDEKQVQLLAEMCILIDENDNKIGADTKKNCHLNENIDKG
FT                   LLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNSCCSHPLSNPGELEENNAIGVKRA
FT                   AKRRLKAELGIPLEEVDLNEMDYLTRIYYKAQSDGIWGEHEVDYILFLRKNVTLNPDPN
FT                   EIKSYCYVSKEEVREILKKAASGEIKLTPWFKIIADTFLFKWWDNLNHLSPFVDHEKIH
FT                   RL"
FT   gene            complement(5885643..5886340)
FT                   /locus_tag="mCG_51329"
FT                   /note="gene_id=mCG51329.1"
FT   mRNA            complement(5885643..5886340)
FT                   /locus_tag="mCG_51329"
FT                   /product="mCG51329"
FT                   /note="gene_id=mCG51329.1 transcript_id=mCT51512.1 created
FT                   on 17-APR-2002"
FT   CDS             complement(5885690..5886334)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51329"
FT                   /product="mCG51329"
FT                   /note="gene_id=mCG51329.1 transcript_id=mCT51512.1
FT                   protein_id=mCP39750.0"
FT                   /protein_id="EDL32281.1"
FT                   /translation="MSSKVSRDALLEAVREVLHGNQCKRHKFLEMVELQISLKNYDPQK
FT                   DKGLSSTITINSTPHPNFAVGDQQHCDEAKAVEIPYMDIEALKKLNKNKKLVKKLAKKY
FT                   DAFLASESLIKQIPRILGPGLNKAGKFPSLLIHNENTFAKVDDVKSTIKFQMKKVLCLA
FT                   VAVGHVKMTDDELVHNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY"
FT   gene            complement(5914120..5937585)
FT                   /gene="Gtpbp4"
FT                   /locus_tag="mCG_4410"
FT                   /note="gene_id=mCG4410.2"
FT   mRNA            complement(join(5914120..5914924,5915814..5915957,
FT                   5916595..5916660,5918886..5919083,5920180..5920280,
FT                   5921081..5921132,5921554..5921631,5926861..5926971,
FT                   5927290..5927379,5928901..5928966,5929408..5929599,
FT                   5930705..5930797,5932231..5932331,5933248..5933384,
FT                   5933465..5933568,5934178..5934348,5937482..5937585))
FT                   /gene="Gtpbp4"
FT                   /locus_tag="mCG_4410"
FT                   /product="GTP binding protein 4, transcript variant
FT                   mCT3210"
FT                   /note="gene_id=mCG4410.2 transcript_id=mCT3210.2 created on
FT                   17-APR-2002"
FT   CDS             complement(join(5914772..5914924,5915814..5915957,
FT                   5916595..5916660,5918886..5919083,5920180..5920280,
FT                   5921081..5921132,5921554..5921631,5926861..5926971,
FT                   5927290..5927379,5928901..5928966,5929408..5929599,
FT                   5930705..5930797,5932231..5932331,5933248..5933384,
FT                   5933465..5933568,5934178..5934348,5937482..5937529))
FT                   /codon_start=1
FT                   /gene="Gtpbp4"
FT                   /locus_tag="mCG_4410"
FT                   /product="GTP binding protein 4, isoform CRA_b"
FT                   /note="gene_id=mCG4410.2 transcript_id=mCT3210.2
FT                   protein_id=mCP19316.2 isoform=CRA_b"
FT                   /protein_id="EDL32283.1"
FT                   /translation="MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRH
FT                   FYMRKVKFTQQNYHDRLSQILSDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKN
FT                   LVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQRQSLEYLEQVRQHLSRLPT
FT                   IDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDT
FT                   PGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLKEQLELFQNIRPLFIN
FT                   KPLIVVANKCDVKRIAELSEEDQKIFLDLQAEGFPVIETSTLTEEGVIQVKTEACDRLL
FT                   AHRVETKMKGNKVNEVLNRLHLAVPNKRDDKERPPFIPEGVIARRKRMEIEEPKKKRER
FT                   DLELEMGDDYILDLQKYWDLMNSSEKYDKIPEIWEGHNVADYIDPAIMKKLEELEKEEE
FT                   LRTAAGEYDSDSESEDEEMMEIRQLAKQIREKKKLKILQSKEKNKQGPRMPRTAKKVQR
FT                   ADLENEMRSLGVDMDDKNNAHYAVQARRSRSVTRKRKREESVPPSSTARSRSCSRTPRD
FT                   VSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR"
FT   mRNA            complement(join(5926458..5926539,5926861..5926971,
FT                   5927290..5927379,5928901..5928966,5929408..5929599,
FT                   5930705..5930797,5932231..5932331,5933248..5933384,
FT                   5933465..5933568,5934178..5934348,5937482..5937585))
FT                   /gene="Gtpbp4"
FT                   /locus_tag="mCG_4410"
FT                   /product="GTP binding protein 4, transcript variant
FT                   mCT168080"
FT                   /note="gene_id=mCG4410.2 transcript_id=mCT168080.0 created
FT                   on 17-APR-2002"
FT   CDS             complement(join(5926489..5926539,5926861..5926971,
FT                   5927290..5927379,5928901..5928966,5929408..5929599,
FT                   5930705..5930797,5932231..5932331,5933248..5933384,
FT                   5933465..5933568,5934178..5934348,5937482..5937529))
FT                   /codon_start=1
FT                   /gene="Gtpbp4"
FT                   /locus_tag="mCG_4410"
FT                   /product="GTP binding protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG4410.2 transcript_id=mCT168080.0
FT                   protein_id=mCP90927.0 isoform=CRA_a"
FT                   /protein_id="EDL32282.1"
FT                   /translation="MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRH
FT                   FYMRKVKFTQQNYHDRLSQILSDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKN
FT                   LVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTIIKRQRQSLEYLEQVRQHLSRLPT
FT                   IDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDT
FT                   PGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLKEQLELFQNIRPLFIN
FT                   KPLIVVANKCDVKRIAELSEEDQKIFLDLQAEGFPVIETSTLTEEGVIQVKTEACDRLL
FT                   AHRVETKMKGNKVNEVLNRLHLAVPNKRDDKVQSSNPSNHMVAHNHL"
FT   gene            6036134..6116579
FT                   /gene="Larp5"
FT                   /locus_tag="mCG_4415"
FT                   /note="gene_id=mCG4415.2"
FT   mRNA            join(6036134..6036243,6060138..6060279,6064282..6064400,
FT                   6066077..6066136,6078953..6079100,6079329..6079475,
FT                   6085928..6086006,6087556..6087692,6089575..6089678,
FT                   6092000..6092110,6093039..6093092,6093189..6093398,
FT                   6100295..6100401,6100723..6100974,6106847..6106892,
FT                   6108489..6108653,6110851..6110975,6111071..6111179,
FT                   6112825..6116579)
FT                   /gene="Larp5"
FT                   /locus_tag="mCG_4415"
FT                   /product="La ribonucleoprotein domain family, member 5,
FT                   transcript variant mCT3207"
FT                   /note="gene_id=mCG4415.2 transcript_id=mCT3207.2 created on
FT                   17-APR-2002"
FT   mRNA            join(6036134..6036243,6064282..6064400,6066077..6066136,
FT                   6078953..6079100,6079329..6079475,6085928..6086006,
FT                   6087556..6087692,6089575..6089684,6092000..6092110,
FT                   6093039..6093092,6093189..6093398,6100295..6100401,
FT                   6100723..6100974,6106847..6106892,6108489..6108653,
FT                   6110851..6110975,6111071..6111179,6112825..6116579)
FT                   /gene="Larp5"
FT                   /locus_tag="mCG_4415"
FT                   /product="La ribonucleoprotein domain family, member 5,
FT                   transcript variant mCT168083"
FT                   /note="gene_id=mCG4415.2 transcript_id=mCT168083.0 created
FT                   on 17-APR-2002"
FT   CDS             join(6064320..6064400,6066077..6066136,6078953..6079100,
FT                   6079329..6079475,6085928..6086006,6087556..6087692,
FT                   6089575..6089684,6092000..6092110,6093039..6093092,
FT                   6093189..6093398,6100295..6100401,6100723..6100974,
FT                   6106847..6106892,6108489..6108653,6110851..6110975,
FT                   6111071..6111179,6112825..6113115)
FT                   /codon_start=1
FT                   /gene="Larp5"
FT                   /locus_tag="mCG_4415"
FT                   /product="La ribonucleoprotein domain family, member 5,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG4415.2 transcript_id=mCT168083.0
FT                   protein_id=mCP90928.0 isoform=CRA_b"
FT                   /protein_id="EDL32285.1"
FT                   /translation="MTSDQDAKVVAEPQAQRVQEGKDSSHLMNGPISQTTSQTRSLPAL
FT                   TQVPTTKVSELNPNAKVWGTHMLHLEASSAAVGVNAAWEEAPGHPTDCDQQVLGLDANG
FT                   DGDKSRENAALPDAQEAEQTDMSTLALDHSEYEPLPENNDTGGNESQPESQEDPREVLK
FT                   KTLEFCLSRENLASDMYLISQMDSDQYVPITTVANLDHIKKLSTDVDLIVEVLRSLPLV
FT                   QVDEKGEKVRPNQNRCIVILREISESTPVEVSEVEALFKGDNLPKFINCEFAYNDNWFI
FT                   TFETEADAQQAYKYLREEVRTFQGKPIKARIKAKAIAINTFLPKNGFRPLDMNLYTQQR
FT                   YATSFYLPPVYSPQQQFPLYSLITPQTWSTTHSYLDPPLVTPFPSTGFINGFTSPTFKP
FT                   ATSPLTSLRQYPPRSRNPSKSHLRHAIPSTERGPGLLESPSIFNFTADRLINGVRSPQT
FT                   RQAGQTRTRIQNPSAYAKREIGTGRVEPSSLESSPGLGRGRKNSFGYRKKREEKFTSSQ
FT                   TQSPTPPKPPSPSFELGLSNFPPLPGAAGNLKTEDLFENRLSSLIIGSSKERNLSTDAS
FT                   TNTVPVVGPREPSVPAPCAVSAAFERSPSPVHLPEDPKVAEKQRETQSVDRLPSTPTTT
FT                   ACKSVQVNGAATELRKPSYAEICQRTSKDPSSSSPLQPPKEQKPSTVACGKEEKQLSEP
FT                   VERHREPPALKSTPGVPKDQRRQPGRRASPPAAGKRLSKEQNTPPKSPQ"
FT   CDS             join(6064320..6064400,6066077..6066136,6078953..6079100,
FT                   6079329..6079475,6085928..6086006,6087556..6087692,
FT                   6089575..6089678,6092000..6092110,6093039..6093092,
FT                   6093189..6093398,6100295..6100401,6100723..6100974,
FT                   6106847..6106892,6108489..6108653,6110851..6110975,
FT                   6111071..6111179,6112825..6113115)
FT                   /codon_start=1
FT                   /gene="Larp5"
FT                   /locus_tag="mCG_4415"
FT                   /product="La ribonucleoprotein domain family, member 5,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG4415.2 transcript_id=mCT3207.2
FT                   protein_id=mCP19343.2 isoform=CRA_a"
FT                   /protein_id="EDL32284.1"
FT                   /translation="MTSDQDAKVVAEPQAQRVQEGKDSSHLMNGPISQTTSQTRSLPAL
FT                   TQVPTTKVSELNPNAKVWGTHMLHLEASSAAVGVNAAWEEAPGHPTDCDQQVLGLDANG
FT                   DGDKSRENAALPDAQEAEQTDMSTLALDHSEYEPLPENNDTGGNESQPESQEDPREVLK
FT                   KTLEFCLSRENLASDMYLISQMDSDQYVPITTVANLDHIKKLSTDVDLIVEVLRSLPLV
FT                   QVDEKGEKVRPNQNRCIVILREISESTPVEEVEALFKGDNLPKFINCEFAYNDNWFITF
FT                   ETEADAQQAYKYLREEVRTFQGKPIKARIKAKAIAINTFLPKNGFRPLDMNLYTQQRYA
FT                   TSFYLPPVYSPQQQFPLYSLITPQTWSTTHSYLDPPLVTPFPSTGFINGFTSPTFKPAT
FT                   SPLTSLRQYPPRSRNPSKSHLRHAIPSTERGPGLLESPSIFNFTADRLINGVRSPQTRQ
FT                   AGQTRTRIQNPSAYAKREIGTGRVEPSSLESSPGLGRGRKNSFGYRKKREEKFTSSQTQ
FT                   SPTPPKPPSPSFELGLSNFPPLPGAAGNLKTEDLFENRLSSLIIGSSKERNLSTDASTN
FT                   TVPVVGPREPSVPAPCAVSAAFERSPSPVHLPEDPKVAEKQRETQSVDRLPSTPTTTAC
FT                   KSVQVNGAATELRKPSYAEICQRTSKDPSSSSPLQPPKEQKPSTVACGKEEKQLSEPVE
FT                   RHREPPALKSTPGVPKDQRRQPGRRASPPAAGKRLSKEQNTPPKSPQ"
FT   gene            6160213..6161474
FT                   /locus_tag="mCG_1034380"
FT                   /note="gene_id=mCG1034380.1"
FT   mRNA            join(6160213..6160655,6160773..6161474)
FT                   /locus_tag="mCG_1034380"
FT                   /product="mCG1034380"
FT                   /note="gene_id=mCG1034380.1 transcript_id=mCT152084.1
FT                   created on 23-MAY-2002"
FT   CDS             join(6160529..6160655,6160773..6160966)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034380"
FT                   /product="mCG1034380"
FT                   /note="gene_id=mCG1034380.1 transcript_id=mCT152084.1
FT                   protein_id=mCP51641.1"
FT                   /protein_id="EDL32286.1"
FT                   /translation="MTYKVVLSQNLSEKNRGSRKRHLNTFSTFIHFFVCVCVCVCMLCI
FT                   CVCTGVGAQVPWYKHGGQRDWFFLSAVWVLGTELSHQPWWSFVPTESSCEVRHFRISAL
FT                   KK"
FT   gene            6165815..6167300
FT                   /pseudo
FT                   /locus_tag="mCG_4406"
FT                   /note="gene_id=mCG4406.2"
FT   mRNA            6165815..6167300
FT                   /pseudo
FT                   /locus_tag="mCG_4406"
FT                   /note="gene_id=mCG4406.2 transcript_id=mCT3213.2 created on
FT                   17-APR-2002"
FT   gene            complement(6214854..>6215176)
FT                   /locus_tag="mCG_51330"
FT                   /note="gene_id=mCG51330.1"
FT   mRNA            complement(6214854..>6215176)
FT                   /locus_tag="mCG_51330"
FT                   /product="mCG51330"
FT                   /note="gene_id=mCG51330.1 transcript_id=mCT51513.1 created
FT                   on 17-APR-2002"
FT   CDS             complement(6214859..>6215176)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51330"
FT                   /product="mCG51330"
FT                   /note="gene_id=mCG51330.1 transcript_id=mCT51513.1
FT                   protein_id=mCP39758.1"
FT                   /protein_id="EDL32287.1"
FT                   /translation="WISTLVSLTASCVVFCLLAGSVIPGELQEAGVKRAVFPHPLTRPL
FT                   LPAHLDHISCIPGWPSLGPCYSIPVTSSAIMTSRCLHGDNWDHMYWLCLVGSPFVTIKS
FT                   I"
FT   gene            complement(<6219052..>6219223)
FT                   /locus_tag="mCG_1034337"
FT                   /note="gene_id=mCG1034337.1"
FT   mRNA            complement(<6219052..>6219223)
FT                   /locus_tag="mCG_1034337"
FT                   /product="mCG1034337"
FT                   /note="gene_id=mCG1034337.1 transcript_id=mCT152041.1
FT                   created on 17-APR-2002"
FT   CDS             complement(<6219052..>6219223)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1034337"
FT                   /product="mCG1034337"
FT                   /note="gene_id=mCG1034337.1 transcript_id=mCT152041.1
FT                   protein_id=mCP51557.1"
FT                   /protein_id="EDL32288.1"
FT                   /translation="LQLQLGQPGPHLQRESHAFQAAVRHARRRRLRPAGLLFVRRRRAP
FT                   QRPPLEPGGAAL"
FT   gene            complement(6327918..6329516)
FT                   /pseudo
FT                   /locus_tag="mCG_51799"
FT                   /note="gene_id=mCG51799.2"
FT   mRNA            complement(6327918..6329516)
FT                   /pseudo
FT                   /locus_tag="mCG_51799"
FT                   /note="gene_id=mCG51799.2 transcript_id=mCT51982.1 created
FT                   on 17-APR-2002"
FT   gene            6448703..6609356
FT                   /locus_tag="mCG_140102"
FT                   /note="gene_id=mCG140102.0"
FT   mRNA            join(6448703..6448813,6475001..6475126,6478405..6478614,
FT                   6491931..6492065,6493493..6493612,6495021..6495218,
FT                   6502418..6502509,6504863..6504973,6509580..6509703,
FT                   6510050..6510159,6510340..6510442,6512799..6512863,
FT                   6516884..6516977,6517112..6517231,6518554..6518668,
FT                   6543108..6543247,6546240..6546376,6548074..6548282,
FT                   6550819..6550933,6552572..6552773,6556215..6556336,
FT                   6557652..6557717,6563844..6563967,6564547..6564668,
FT                   6565722..6565833,6565923..6566032,6569938..6570068,
FT                   6576809..6576977,6579182..6579352,6589098..6589159,
FT                   6596722..6596779,6598756..6598830,6601364..6601538,
FT                   6604256..6604379,6607897..6609356)
FT                   /locus_tag="mCG_140102"
FT                   /product="mCG140102"
FT                   /note="gene_id=mCG140102.0 transcript_id=mCT168073.0
FT                   created on 09-MAY-2002"
FT   CDS             join(6478596..6478614,6491931..6492065,6493493..6493612,
FT                   6495021..6495218,6502418..6502509,6504863..6504973,
FT                   6509580..6509703,6510050..6510159,6510340..6510442,
FT                   6512799..6512863,6516884..6516977,6517112..6517231,
FT                   6518554..6518668,6543108..6543247,6546240..6546376,
FT                   6548074..6548282,6550819..6550933,6552572..6552773,
FT                   6556215..6556336,6557652..6557717,6563844..6563967,
FT                   6564547..6564668,6565722..6565833,6565923..6566032,
FT                   6569938..6570068,6576809..6576977,6579182..6579352,
FT                   6589098..6589159,6596722..6596779,6598756..6598830,
FT                   6601364..6601538,6604256..6604379,6607897..6608149)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140102"
FT                   /product="mCG140102"
FT                   /note="gene_id=mCG140102.0 transcript_id=mCT168073.0
FT                   protein_id=mCP90912.0"
FT                   /protein_id="EDL32289.1"
FT                   /translation="MAQTHIENHSAPPDVTTYTSEHSIQVERPQGSTTSRTAPKYGNAE
FT                   LMETGDGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKPEG
FT                   AQMLATRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYILTYGKLWTR
FT                   SMKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPL
FT                   TRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHL
FT                   SKPPRDWFPHIKDANNDTAYIEYKTCKDGSVLGVTVTRIALLTHCQALTQACGYTEAET
FT                   IVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSR
FT                   DMHWALVAHRDQRDVNLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCAS
FT                   SPEALTVAIRRPTDDSNQPPGRGVLSMHGLTYGVIRVDSEEKLSVLTVQDVGLVMPGAI
FT                   MCSVKPDGIPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEYP
FT                   FIRTGLLGFVGPGGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVF
FT                   SVTVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTP
FT                   LGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQKQPEIGPASVMVGNLVSGKR
FT                   IAQASGRDLGQIEDNDQARKVRTEVLQWRAQDPLPDHLLYTLLNCRGTIANSLTCVQLH
FT                   KRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPHPQNIAT
FT                   TLPTVKMIVEVSRSACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKKRPAQIY
FT                   KPSNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCG
FT                   LGFVLWCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLG
FT                   SQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNL
FT                   AICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPET
FT                   KGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFL
FT                   RRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKSVTECAVFTWTN
FT                   LLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLR
FT                   DGFLADQLDPIYVAYNM"
FT   gene            complement(6538095..6539165)
FT                   /pseudo
FT                   /locus_tag="mCG_116915"
FT                   /note="gene_id=mCG116915.1"
FT   mRNA            complement(join(6538095..6538806,6539103..6539165))
FT                   /pseudo
FT                   /locus_tag="mCG_116915"
FT                   /note="gene_id=mCG116915.1 transcript_id=mCT118044.1
FT                   created on 17-APR-2002"
FT   gene            6609661..6611042
FT                   /locus_tag="mCG_148098"
FT                   /note="gene_id=mCG148098.0"
FT   mRNA            6609661..6611042
FT                   /locus_tag="mCG_148098"
FT                   /product="mCG148098"
FT                   /note="gene_id=mCG148098.0 transcript_id=mCT188361.0
FT                   created on 13-JAN-2004"
FT   CDS             6610051..6610485
FT                   /codon_start=1
FT                   /locus_tag="mCG_148098"
FT                   /product="mCG148098"
FT                   /note="gene_id=mCG148098.0 transcript_id=mCT188361.0
FT                   protein_id=mCP109197.0"
FT                   /protein_id="EDL32290.1"
FT                   /translation="MCKALFISINHLIFQILFAHCYMFLHVSNTHSYSLQLPQGGKSLP
FT                   HTERIFLIHAFAPPYLPPPQGTWFNVSDSRLIGKHDYSVQEIFHLANVRKQSKFRCHSE
FT                   PTLNFSPYQLHTQGGRRLQHRGKAHPSRSLLYPAICHVTL"
FT   gene            complement(6628473..>6708782)
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /note="gene_id=mCG12598.3"
FT   mRNA            complement(join(6628473..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638819,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6664429..6664588,6678986..6679120,6708676..>6708782))
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11,
FT                   transcript variant mCT193000"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT193000.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(6628473..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638816,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6653802..6653963,6664429..6664588,6678986..6679120,
FT                   6708370..>6708590))
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11,
FT                   transcript variant mCT193001"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT193001.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(6628479..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638819,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6653802..6653963,6664429..6664588,6678986..6679120,
FT                   6708676..6708752))
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11,
FT                   transcript variant mCT13241"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT13241.2 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(6628479..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638819,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6664429..6664588,6678986..6679127,6708370..6708525))
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11,
FT                   transcript variant mCT168074"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT168074.1 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(6629412..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638819,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6653802..6653963,6664429..6664588,6678986..6679120,
FT                   6708370..6708581))
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11,
FT                   transcript variant mCT178266"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT178266.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(6630497..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638819,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6664429..6664588,6678986..>6679116))
FT                   /codon_start=1
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT193000.0
FT                   protein_id=mCP113972.0 isoform=CRA_d"
FT                   /protein_id="EDL32295.1"
FT                   /translation="RSKQVMARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKY
FT                   MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKHS
FT                   NKQEMGTYLRFIVSRMKERAIDLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRS
FT                   YEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDN
FT                   WFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITV
FT                   NVHRLHVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKV
FT                   TQEPRAKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIERVSVSTQTKKLSASSP
FT                   RMLHRSTQTTSDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEE
FT                   EKRQAVNKAVASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNC
FT                   EEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR"
FT   CDS             complement(join(6630497..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638816,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6653802..6653963,6664429..6664588,6678986..>6679116))
FT                   /codon_start=1
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT193001.0
FT                   protein_id=mCP113973.0 isoform=CRA_e"
FT                   /protein_id="EDL32296.1"
FT                   /translation="RSKQVMARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKY
FT                   MSRVHGMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETETH
FT                   DWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSHWQCPVCRSIKKKHSNKQEM
FT                   GTYLRFIVSRMKERAIDLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFK
FT                   ADAQLLLHNTVIFYGDSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPC
FT                   IPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLH
FT                   VKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRA
FT                   KKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIERVSVSTQTKKLSASSPRMLHRS
FT                   TQTTSDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAV
FT                   NKAVASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMY
FT                   HCCWNTSYCSIKCQQEHWHAEHKRTCRRKR"
FT   CDS             complement(join(6630497..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638819,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6664429..6664588,6678986..6679101))
FT                   /codon_start=1
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT168074.1
FT                   protein_id=mCP90916.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BJZ0"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="MGI:MGI:1913755"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BJZ0"
FT                   /protein_id="EDL32292.1"
FT                   /translation="MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVH
FT                   GMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEISIKKKHSNKQEM
FT                   GTYLRFIVSRMKERAIDLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFK
FT                   ADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYP
FT                   CIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRL
FT                   HVKRSMGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPR
FT                   AKKGRRNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIERVSVSTQTKKLSASSPRMLHR
FT                   STQTTSDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQA
FT                   VNKAVASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAM
FT                   YHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR"
FT   CDS             complement(join(6630497..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638819,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6653802..6653963,6664429..6664588,6678986..6679101))
FT                   /codon_start=1
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT13241.2
FT                   protein_id=mCP19340.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R5C8"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="MGI:MGI:1913755"
FT                   /db_xref="PDB:4N4G"
FT                   /db_xref="PDB:4N4H"
FT                   /db_xref="PDB:4N4I"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5C8"
FT                   /protein_id="EDL32291.1"
FT                   /translation="MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVH
FT                   GMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCF
FT                   ECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSHWQCPVCRSIKKKHSNKQEMGTYLR
FT                   FIVSRMKERAIDLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQL
FT                   LLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNH
FT                   ELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRS
FT                   MGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGR
FT                   RNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIERVSVSTQTKKLSASSPRMLHRSTQTT
FT                   SDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAV
FT                   ASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCW
FT                   NTSYCSIKCQQEHWHAEHKRTCRRKR"
FT   CDS             complement(join(6630497..6630619,6632698..6632883,
FT                   6633087..6633359,6634081..6634149,6634538..6634745,
FT                   6637065..6637183,6637904..6637981,6638764..6638819,
FT                   6639374..6639461,6641279..6641371,6642263..6642340,
FT                   6653802..6653963,6664429..6664588,6678986..6679101))
FT                   /codon_start=1
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT178266.0
FT                   protein_id=mCP101188.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R5C8"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="MGI:MGI:1913755"
FT                   /db_xref="PDB:4N4G"
FT                   /db_xref="PDB:4N4H"
FT                   /db_xref="PDB:4N4I"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5C8"
FT                   /protein_id="EDL32294.1"
FT                   /translation="MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVH
FT                   GMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCF
FT                   ECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSHWQCPVCRSIKKKHSNKQEMGTYLR
FT                   FIVSRMKERAIDLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQL
FT                   LLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNH
FT                   ELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRS
FT                   MGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGR
FT                   RNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIERVSVSTQTKKLSASSPRMLHRSTQTT
FT                   SDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAV
FT                   ASLQGDMDRKGKQLKEKCKEEFVEEIKKLAAQHKQLISQTKKKQWCYNCEEEAMYHCCW
FT                   NTSYCSIKCQQEHWHAEHKRTCRRKR"
FT   mRNA            complement(join(6632774..6633359,6634081..6634149,
FT                   6634538..6634745,6637065..6637183,6637904..6637981,
FT                   6638764..6638819,6639374..6639461,6641279..6641371,
FT                   6642263..6642340,6653802..6653963,6664429..6664588,
FT                   6678986..6679127))
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11,
FT                   transcript variant mCT168075"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT168075.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(6633009..6633359,6634081..6634149,
FT                   6634538..6634745,6637065..6637183,6637904..6637981,
FT                   6638764..6638819,6639374..6639461,6641279..6641371,
FT                   6642263..6642340,6653802..6653963,6664429..6664588,
FT                   6678986..6679101))
FT                   /codon_start=1
FT                   /gene="Zmynd11"
FT                   /locus_tag="mCG_12598"
FT                   /product="zinc finger, MYND domain containing 11, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG12598.3 transcript_id=mCT168075.0
FT                   protein_id=mCP90918.0 isoform=CRA_c"
FT                   /protein_id="EDL32293.1"
FT                   /translation="MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVH
FT                   GMHPKETTRQLSLAVKDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETETHDWYCF
FT                   ECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSHWQCPVCRSIKKKHSNKQEMGTYLR
FT                   FIVSRMKERAIDLNKKGKDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQL
FT                   LLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNH
FT                   ELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNVHRLHVKRS
FT                   MGWKKACDELELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGR
FT                   RNQSVEPKKEEPEPETEAVSSSQEIPTMPQPIERVSVSTQTKKLSASSPRMLHRSTQTT
FT                   SDGVCQSMCHDKYTKIFNDFKDRMKSDHKRETERVVREALEKVGLCIAGGRWRVQSFSQ
FT                   ERLSQYSS"
FT   gene            complement(6820205..7316019)
FT                   /gene="Chrm3"
FT                   /locus_tag="mCG_52288"
FT                   /note="gene_id=mCG52288.2"
FT   mRNA            complement(join(6820205..6822609,6971683..6971729,
FT                   7065631..7065694,7179022..7179134,7315479..7316019))
FT                   /gene="Chrm3"
FT                   /locus_tag="mCG_52288"
FT                   /product="cholinergic receptor, muscarinic 3, cardiac"
FT                   /note="gene_id=mCG52288.2 transcript_id=mCT52471.2 created
FT                   on 11-JUN-2003"
FT   CDS             complement(6820821..6822590)
FT                   /codon_start=1
FT                   /gene="Chrm3"
FT                   /locus_tag="mCG_52288"
FT                   /product="cholinergic receptor, muscarinic 3, cardiac"
FT                   /note="gene_id=mCG52288.2 transcript_id=mCT52471.2
FT                   protein_id=mCP39795.1"
FT                   /db_xref="GOA:Q542R4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000995"
FT                   /db_xref="InterPro:IPR001183"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:88398"
FT                   /db_xref="UniProtKB/TrEMBL:Q542R4"
FT                   /protein_id="EDL32297.1"
FT                   /translation="MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVSQLDSYNISQT
FT                   SGNFSSNDTSSDPLGGHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNY
FT                   FLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISF
FT                   DRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFI
FT                   QFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVH
FT                   PTGSSRSCSSYELQQQGTKRSSRRKYGGCHFWFTTKSWKPSAEQMDQDHSSSDSWNNND
FT                   AAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPDKDLGTMD
FT                   VERNAHKLQAQKSMDDRDNCQKDFSKLPIQLESAVDTAKTSDTNSSVDKTTAALPLSFK
FT                   EATLAKRFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCD
FT                   SCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQ
FT                   SVIFHKRVPEQAL"
FT   gene            <7070283..7109468
FT                   /locus_tag="mCG_140426"
FT                   /note="gene_id=mCG140426.0"
FT   gene            complement(7070283..>7109468)
FT                   /locus_tag="mCG_140104"
FT                   /note="gene_id=mCG140104.0"
FT   mRNA            join(<7070283..7070348,7108446..7109468)
FT                   /locus_tag="mCG_140426"
FT                   /product="mCG140426"
FT                   /note="gene_id=mCG140426.0 transcript_id=mCT169482.0
FT                   created on 23-MAY-2002"
FT   mRNA            complement(join(7070283..7070353,7108440..>7109468))
FT                   /locus_tag="mCG_140104"
FT                   /product="mCG140104"
FT                   /note="gene_id=mCG140104.0 transcript_id=mCT168089.0
FT                   created on 17-APR-2002"
FT   CDS             <7108724..7109008
FT                   /codon_start=1
FT                   /locus_tag="mCG_140426"
FT                   /product="mCG140426"
FT                   /note="gene_id=mCG140426.0 transcript_id=mCT169482.0
FT                   protein_id=mCP92385.0"
FT                   /protein_id="EDL32299.1"
FT                   /translation="TQILPPGLLSITCSIHFHIQPRTNLPMDGITHSGVSPLSYQSLIK
FT                   NMPQQHTYRPANRGHSSTVIPSLVTSVWKADKKPTSTIIDGVLSITFNV"
FT   CDS             complement(7108879..>7109091)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140104"
FT                   /product="mCG140104"
FT                   /note="gene_id=mCG140104.0 transcript_id=mCT168089.0
FT                   protein_id=mCP90924.0"
FT                   /protein_id="EDL32298.1"
FT                   /translation="LHFILYFSFNICFINSCIILSNDTTALHYTLNVILRTPSIIVLVG
FT                   FLSAFHTLVTREGITVEEWPLLAGL"
FT   gene            <7992379..7993052
FT                   /locus_tag="mCG_112815"
FT                   /note="gene_id=mCG112815.1"
FT   mRNA            <7992379..7993052
FT                   /locus_tag="mCG_112815"
FT                   /product="mCG112815"
FT                   /note="gene_id=mCG112815.1 transcript_id=mCT113887.1
FT                   created on 23-MAY-2002"
FT   CDS             <7992711..7992884
FT                   /codon_start=1
FT                   /locus_tag="mCG_112815"
FT                   /product="mCG112815"
FT                   /note="gene_id=mCG112815.1 transcript_id=mCT113887.1
FT                   protein_id=mCP51603.1"
FT                   /protein_id="EDL32300.1"
FT                   /translation="GNAIVLISELGLSPREEKRVKSGPPTHGFREPWEVPALGHHRCPD
FT                   HTLIPPSSCFPM"
FT   gene            complement(8467023..9025830)
FT                   /gene="Ryr2"
FT                   /locus_tag="mCG_9118"
FT                   /note="gene_id=mCG9118.2"
FT   mRNA            complement(join(8467023..8468224,8469044..8469095,
FT                   8470211..8470311,8471659..8471723,8474136..8474292,
FT                   8480504..8480638,8482128..8482274,8485902..8485962,
FT                   8492271..8492404,8498620..8498662,8499891..8500021,
FT                   8501699..8501920,8502625..8502711,8505724..8505871,
FT                   8507592..8507656,8509181..8510478,8511570..8511651,
FT                   8513005..8513109,8516258..8516386,8518156..8518244,
FT                   8519627..8519707,8533297..8533370,8534160..8534236,
FT                   8536005..8536084,8537592..8537691,8550215..8550268,
FT                   8553122..8553173,8554964..8555067,8558457..8558553,
FT                   8561146..8561258,8562351..8562390,8564383..8564517,
FT                   8569034..8569093,8570286..8570456,8571701..8571793,
FT                   8573619..8573706,8574770..8575010,8576735..8577055,
FT                   8580545..8580675,8581743..8581824,8583477..8583715,
FT                   8584593..8584653,8590868..8590917,8595636..8595757,
FT                   8599132..8599196,8601623..8601738,8602570..8602693,
FT                   8604972..8605047,8607319..8607396,8614936..8615073,
FT                   8615467..8615556,8618279..8618357,8620417..8620580,
FT                   8621364..8621504,8622548..8622638,8622788..8623008,
FT                   8624683..8624852,8626901..8627021,8629283..8629388,
FT                   8631707..8631893,8633136..8633271,8636517..8636620,
FT                   8637497..8637629,8639029..8639143,8641617..8641890,
FT                   8645103..8645246,8646406..8646511,8650231..8650431,
FT                   8652482..8653280,8656614..8656840,8659938..8660024,
FT                   8660357..8660519,8662248..8662408,8664196..8664310,
FT                   8665449..8665801,8666956..8667164,8674427..8674601,
FT                   8675985..8676193,8684601..8684748,8687169..8687328,
FT                   8693922..8694005,8699775..8699878,8704996..8705100,
FT                   8707200..8707416,8709073..8709265,8714213..8714454,
FT                   8715669..8715802,8716338..8716456,8725422..8725517,
FT                   8738813..8738948,8742566..8742749,8744589..8744710,
FT                   8748956..8749120,8767265..8767421,8769323..8769397,
FT                   8787222..8787318,8788222..8788321,8798580..8798692,
FT                   8802150..8802228,8804569..8804643,8822313..8822339,
FT                   8837479..8837583,8865199..8865318,9025541..9025830))
FT                   /gene="Ryr2"
FT                   /locus_tag="mCG_9118"
FT                   /product="ryanodine receptor 2, cardiac, transcript variant
FT                   mCT9353"
FT                   /note="gene_id=mCG9118.2 transcript_id=mCT9353.3 created on
FT                   02-JAN-2003"
FT   mRNA            complement(join(8468128..8468224,8469044..8469095,
FT                   8470211..8470311,8471659..8471723,8474136..8474292,
FT                   8480504..8480638,8482128..8482274,8485902..8485962,
FT                   8492271..8492404,8498620..8498662,8499891..8500021,
FT                   8501699..8501920,8502625..8502711,8505724..8505871,
FT                   8507592..8507656,8509181..8510478,8511570..8511651,
FT                   8513005..8513109,8516258..8516386,8518156..8518244,
FT                   8519627..8519707,8533297..8533370,8534160..8534236,
FT                   8536005..8536084,8537592..8537691,8550215..8550268,
FT                   8553122..8553173,8554964..8555067,8558457..8558553,
FT                   8561146..8561258,8562351..8562390,8564383..8564517,
FT                   8569034..8569093,8570286..8570456,8571701..8571793,
FT                   8573619..8573706,8574770..8575010,8576735..8577055,
FT                   8580545..8580675,8581743..8581824,8583477..8583715,
FT                   8584593..8584653,8590868..8590917,8595636..8595757,
FT                   8599132..8599196,8601623..8601736,8602566..8602693,
FT                   8604972..8605047,8607319..8607396,8614936..8615073,
FT                   8615467..8615556,8618279..8618357,8620417..8620580,
FT                   8621364..8621504,8622548..8622638,8622788..8623008,
FT                   8624683..8624852,8626901..8627021,8629283..8629388,
FT                   8631707..8631893,8633136..8633271,8636517..8636620,
FT                   8637497..8637629,8639029..8639143,8641617..8641890,
FT                   8645103..8645246,8646406..8646511,8650231..8650431,
FT                   8652482..8653280,8656614..8656840,8659938..8660024,
FT                   8660357..8660519,8662248..8662408,8664196..8664310,
FT                   8665449..8665801,8666956..8667164,8674427..8674601,
FT                   8675985..8676193,8684601..8684748,8687169..8687328,
FT                   8693922..8694005,8699775..8699878,8704996..8705100,
FT                   8707200..8707416,8709073..8709265,8714213..8714454,
FT                   8715669..8715802,8716338..8716456,8725422..8725517,
FT                   8738813..8738948,8742566..8742749,8744589..8744710,
FT                   8748956..8749120,8767265..8767421,8769323..8769397,
FT                   8787222..8787318,8788222..8788321,8798580..8798692,
FT                   8802150..8802228,8804569..8804643,8822313..8822339,
FT                   8837479..8837583,8865199..8865318,9025541..>9025588))
FT                   /gene="Ryr2"
FT                   /locus_tag="mCG_9118"
FT                   /product="ryanodine receptor 2, cardiac, transcript variant
FT                   mCT193005"
FT                   /note="gene_id=mCG9118.2 transcript_id=mCT193005.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(8561206..8561258,8562351..8562390,
FT                   8564383..8564517,8569034..8569093,8570286..8570456,
FT                   8571701..8571793,8573619..8573706,8574770..8575010,
FT                   8576735..8577055,8580545..8580675,8581743..8581824,
FT                   8583477..8583715,8584593..8584653,8590868..8590917,
FT                   8595636..8595757,8599132..8599196,8601623..8601738,
FT                   8602570..8602693,8604972..8605047,8607319..8607396,
FT                   8614936..8615073,8615467..8615556,8618279..8618357,
FT                   8620417..8620580,8621364..8621504,8622548..8622638,
FT                   8622788..8623008,8624683..8624852,8626901..8627021,
FT                   8629283..8629388,8631707..8631893,8633136..8633271,
FT                   8636517..8636620,8637497..8637629,8639029..8639143,
FT                   8641617..8641890,8645103..8645246,8646406..8646511,
FT                   8650231..8650431,8652482..8653280,8656614..8656840,
FT                   8659938..8660024,8660357..8660519,8662248..8662408,
FT                   8664196..8664310,8665449..8665801,8666956..8667164,
FT                   8674427..8674601,8675985..8676193,8684601..8684748,
FT                   8687169..8687328,8693922..8694005,8699775..8699878,
FT                   8704996..8705100,8707200..8707416,8709073..8709265,
FT                   8714213..8714454,8715669..8715802,8716338..8716456,
FT                   8725422..8725517,8738813..8738948,8742566..8742749,
FT                   8744589..8744710,8748956..8749120,8767265..8767421,
FT                   8769323..8769397,8787222..8787318,8788222..8788321,
FT                   8798580..8798692,8802150..8802228,8804569..8804643,
FT                   8822313..8822339,8837479..8837583,8865199..8865318,
FT                   9025541..9025588))
FT                   /codon_start=1
FT                   /gene="Ryr2"
FT                   /locus_tag="mCG_9118"
FT                   /product="ryanodine receptor 2, cardiac, isoform CRA_b"
FT                   /note="gene_id=mCG9118.2 transcript_id=mCT9353.3
FT                   protein_id=mCP19312.3 isoform=CRA_b"
FT                   /protein_id="EDL32302.1"
FT                   /translation="MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNR
FT                   LCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWVCTAQG
FT                   GGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPAS
FT                   KQRSEGEKVRVGDDLILVSVSSERYLHLSYGNSSWHVDAAFQQTLWSVAPISSGSEAAQ
FT                   GYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAW
FT                   SGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDVGVR
FT                   KEVDGMGTSEIKYGDSICYIQHVDTGLWLTYQAVDVKSARMGSIQRKAIMHHEGHMDDG
FT                   LNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKLPTIDLPIESVSLSLQDLIG
FT                   YFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGR
FT                   EAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVL
FT                   VESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLP
FT                   GRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGW
FT                   ASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVIS
FT                   CCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLP
FT                   PPGYAACYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPVPVDTSQIVL
FT                   PPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNL
FT                   QMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQ
FT                   EAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLR
FT                   EAVRTLLGYGYHLEAPDQDHASRAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTA
FT                   GDMRVGWSRPGCQPDLELGSDDRAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMN
FT                   EHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFT
FT                   ICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQ
FT                   KSFGSQNNNTDIMFYRLSMPIECAEVFSKSVAGGLPGAGFYGPKNDLEDFDVDSDFEVL
FT                   MKTAHGHLVPDRIDKDKETPKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTGHSARL
FT                   TEDVLADDRDDYEYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDRVRT
FT                   VTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNSNGLEIGCVVDAASGLLTFIA
FT                   NGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQ
FT                   CPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVD
FT                   ILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLR
FT                   AGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKHGLPGIGLSTSLR
FT                   PRMRFSSPSFVSISNDCYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTTEFL
FT                   FVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAVPEEEGGTPEKEISIEDAKLE
FT                   GEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQ
FT                   DNQRFRYNEVMQALNMSAALTARKTREFRSPPQEQINMLLNFKDDKSECPCPEEIRDQL
FT                   LDFHEDLMTHCGIELDEDGSLDGSNDLTIRGRLLSLVEKVTYLKKKQAEKPVASDSRKC
FT                   SSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVE
FT                   DTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVME
FT                   VMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASP
FT                   AMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWN
FT                   PVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEA
FT                   IKIAEDPSRDGPSPTSGSSKTLDIEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLI
FT                   HAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGKVVEPDMSAGFCPDHKAAM
FT                   VLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPL
FT                   LTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQ
FT                   HLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLF
FT                   WGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQ
FT                   PVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLL
FT                   SEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGYS
FT                   PRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKE
FT                   KAKDREKAQDIFKFLQISGYVVSRGFKDLDLDTPSIEKRFAYSFLQQLIRYVDEAHQYI
FT                   LEFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGHASNK
FT                   EKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLDSVKSALR
FT                   AFLDNAAEDLEKTMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQF
FT                   GEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPIAFLETHLD
FT                   KHNVYSIYNTRSSRERAALSLPANVEDVCPNIPSLEKLMTEIIELAESGIRYTQMPYMM
FT                   EVVLPMLCSYMSRWWEHGPENHPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGA
FT                   WMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAEL
FT                   LILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNF
FT                   KREEQNFVVQNEINNMSFLITDTKSKMSKAAISDQERKKMKRKGDRYSMQTSLIVAALK
FT                   RLLPIGLNICAPGDQELIALAKNRFSLKDTEEEVRDIIRSNIHLQGKLEDPAIRWQMAL
FT                   YKDLPNRTEDPSDPERTVERVLGIANVLFHLEQKSKYTGRGYFSLGSGTSSKIKESCVA
FT                   QTTL"
FT   CDS             complement(join(8601716..8601736,8602566..8602693,
FT                   8604972..8605047,8607319..8607396,8614936..8615073,
FT                   8615467..8615556,8618279..8618357,8620417..8620580,
FT                   8621364..8621504,8622548..8622638,8622788..8623008,
FT                   8624683..8624852,8626901..8627021,8629283..8629388,
FT                   8631707..8631893,8633136..8633271,8636517..8636620,
FT                   8637497..8637629,8639029..8639143,8641617..8641890,
FT                   8645103..8645246,8646406..8646511,8650231..8650431,
FT                   8652482..8653280,8656614..8656840,8659938..8660024,
FT                   8660357..8660519,8662248..8662408,8664196..8664310,
FT                   8665449..8665801,8666956..8667164,8674427..8674601,
FT                   8675985..8676193,8684601..8684748,8687169..8687328,
FT                   8693922..8694005,8699775..8699878,8704996..8705100,
FT                   8707200..8707416,8709073..8709265,8714213..8714454,
FT                   8715669..8715802,8716338..8716456,8725422..8725517,
FT                   8738813..8738948,8742566..8742749,8744589..8744710,
FT                   8748956..8749120,8767265..8767421,8769323..8769397,
FT                   8787222..8787318,8788222..8788321,8798580..8798692,
FT                   8802150..8802228,8804569..8804643,8822313..8822339,
FT                   8837479..8837583,8865199..8865318,9025541..9025588))
FT                   /codon_start=1
FT                   /gene="Ryr2"
FT                   /locus_tag="mCG_9118"
FT                   /product="ryanodine receptor 2, cardiac, isoform CRA_a"
FT                   /note="gene_id=mCG9118.2 transcript_id=mCT193005.0
FT                   protein_id=mCP113979.0 isoform=CRA_a"
FT                   /protein_id="EDL32301.1"
FT                   /translation="MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNR
FT                   LCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWVCTAQG
FT                   GGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPAS
FT                   KQRSEGEKVRVGDDLILVSVSSERYLHLSYGNSSWHVDAAFQQTLWSVAPISSGSEAAQ
FT                   GYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAW
FT                   SGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDVGVR
FT                   KEVDGMGTSEIKYGDSICYIQHVDTGLWLTYQAVDVKSARMGSIQRKAIMHHEGHMDDG
FT                   LNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKLPTIDLPIESVSLSLQDLIG
FT                   YFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGR
FT                   EAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVL
FT                   VESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLP
FT                   GRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGW
FT                   ASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVIS
FT                   CCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLP
FT                   PPGYAACYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPVPVDTSQIVL
FT                   PPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNL
FT                   QMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQ
FT                   EAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLR
FT                   EAVRTLLGYGYHLEAPDQDHASRAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTA
FT                   GDMRVGWSRPGCQPDLELGSDDRAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMN
FT                   EHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFT
FT                   ICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQ
FT                   KSFGSQNNNTDIMFYRLSMPIECAEVFSKSVAGGLPGAGFYGPKNDLEDFDVDSDFEVL
FT                   MKTAHGHLVPDRIDKDKETPKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTGHSARL
FT                   TEDVLADDRDDYEYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDRVRT
FT                   VTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNSNGLEIGCVVDAASGLLTFIA
FT                   NGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQ
FT                   CPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVD
FT                   ILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLR
FT                   AGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKHGLPGIGLSTSLR
FT                   PRMRFSSPSFVSISNDCYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTTEFL
FT                   FVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAVPEEEGGTPEKEISIEDAKLE
FT                   GEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQ
FT                   DNQRFRYNEVMQALNMSAALTARKTREFRSPPQEQINMLLNFKDDKSECPCPEEIRDQL
FT                   LDFHEDLMTHCGIELDEDGSLDGSNDLTIRGRLLSLVEKVTYLKKKQAEKPVASDSRKC
FT                   SSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVE
FT                   DTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVME
FT                   VMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASP
FT                   AMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWN
FT                   PVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEA
FT                   IKIAEDPSRDGPSPTSGSSKTLDIEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLI
FT                   HAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGKVVEPDMSAGFCPDHKAAM
FT                   VLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPL
FT                   LTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQ
FT                   HLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLF
FT                   WGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQ
FT                   PVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLL
FT                   SEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGYS
FT                   PRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKE
FT                   KAKDREKAQDIFKFLQISGYVVSRQGSKTWI"
FT   gene            8858907..8859855
FT                   /pseudo
FT                   /locus_tag="mCG_9120"
FT                   /note="gene_id=mCG9120.1"
FT   mRNA            8858907..8859855
FT                   /pseudo
FT                   /locus_tag="mCG_9120"
FT                   /note="gene_id=mCG9120.1 transcript_id=mCT9355.1 created on
FT                   17-APR-2002"
FT   gene            complement(9106145..9177772)
FT                   /locus_tag="mCG_9119"
FT                   /note="gene_id=mCG9119.1"
FT   mRNA            complement(join(9106145..9106700,9107618..9107730,
FT                   9108924..9109116,9109781..9109981,9113191..9113387,
FT                   9114815..9114970,9117490..9117565,9118623..9118721,
FT                   9119774..9119855,9124320..9124440,9124867..9124934,
FT                   9131965..9132065,9132206..9132355,9134990..9135142,
FT                   9136387..9136476,9141000..9141140,9141733..9141849,
FT                   9145030..9145209,9147240..9147425,9150501..9150641,
FT                   9152446..9152570,9155013..9155092,9157652..9157719,
FT                   9159320..9159381,9161236..9161336,9163606..9163700,
FT                   9164226..9164288,9166990..9167096,9167564..9167656,
FT                   9169512..9169581,9170269..9170358,9173435..9173649,
FT                   9177533..9177772))
FT                   /locus_tag="mCG_9119"
FT                   /product="mCG9119"
FT                   /note="gene_id=mCG9119.1 transcript_id=mCT9354.1 created on
FT                   17-APR-2002"
FT   CDS             complement(join(9106614..9106700,9107618..9107730,
FT                   9108924..9109116,9109781..9109981,9113191..9113387,
FT                   9114815..9114970,9117490..9117565,9118623..9118721,
FT                   9119774..9119855,9124320..9124440,9124867..9124934,
FT                   9131965..9132065,9132206..9132355,9134990..9135142,
FT                   9136387..9136476,9141000..9141140,9141733..9141849,
FT                   9145030..9145209,9147240..9147425,9150501..9150641,
FT                   9152446..9152570,9155013..9155092,9157652..9157719,
FT                   9159320..9159381,9161236..9161336,9163606..9163700,
FT                   9164226..9164288,9166990..9167096,9167564..9167656,
FT                   9169512..9169581,9170269..9170358,9173435..9173644))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9119"
FT                   /product="mCG9119"
FT                   /note="gene_id=mCG9119.1 transcript_id=mCT9354.1
FT                   protein_id=mCP19349.2"
FT                   /protein_id="EDL32303.1"
FT                   /translation="MKKTLQDEIEAILRKRIMVLDGGMGTMIQRYKLSEEHFQGQEFKD
FT                   HSRPLKGNNDILSITQPDIIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRM
FT                   NKCSADVARKAAEEITLQTGVKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVDAY
FT                   QEQAKGLLDGRVDILLIETIFDTANAKAALFAIQNLFEENYAPPRPIFISGTIVDKSGR
FT                   TLSGQTGEAFVTSVSHSDPLCIGLNCSLGAAEMRPFIETIGKCTTAYVLCYPNAGLPNT
FT                   FGDYDETPSTMATHLKDFAVDGLVNIVGGCCGSTPDHIREIAEAVKKCKPRVPPASVFE
FT                   GHMLLSGLEPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEVSILEALSIAKAQVE
FT                   MGAQVLDINMDDGMLDGPSAMTRFCNSIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGK
FT                   CIVNSISLKEGEGDFLEKARKIKKFGAAVVVMAFDEEGQATETDVKVNVCTRAYHLLVD
FT                   KVGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATRVIKETLPGVRISGGLSNLSFSF
FT                   RGMEAIREAMHGVFLYHAIKFGMDMGIVNAGNLPVYDAIHKDLLQLCEDLIWNKDSEAT
FT                   EKLLRYAQTHGTGGKKVIQTDEWRNGSIEERLEYALVKGIEKHIVEDTEEARLNGEKYP
FT                   RPLNIIEGPLMNGMKVVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREEARLI
FT                   NGSVEEEASHLVQAWKACFSEDPYQGTIVLATVKGDVHDIGKNIVGVVLACNNFRVIDL
FT                   GVMTPCDKILQAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIKIPLLIGGATTSR
FT                   THTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLRDDYFEEILEEYEDIRQDHYESL
FT                   KERKYVPLSQARKHGFHIDWLSEPHPVKPTFIGTQVFEDYNLQKLVDYIDWKPFFDVWQ
FT                   LRGKYPNRGFPKIFNDKAVGEEARKVYNDAQNMLNILISQKKLQARGVVGFWPAQSVQD
FT                   DIHLYAEGVVPQAAEPIATFYGLRQQAEKDSSSTDPYHCLSDFIAPLHSGVCDYLGLFA
FT                   VACFGVEELSKTYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYSRSEQLGV
FT                   PDLRRLRYEGIRPAPGYPSQPDHTEKLTMWRLASIEQATGIRLTESLAMAPASAVSGLY
FT                   FSNVKAKYFAVGKISKDQTEDYALRKNMPVAEVEKWLGPILGYDTD"
FT   gene            complement(9188872..9257139)
FT                   /gene="Actn2"
FT                   /locus_tag="mCG_9123"
FT                   /note="gene_id=mCG9123.2"
FT   mRNA            complement(join(9188872..9189396,9190522..9190680,
FT                   9192481..9192546,9194860..9195006,9196145..9196324,
FT                   9197181..9197315,9198577..9198759,9200212..9200352,
FT                   9202298..9202406,9208320..9208470,9210432..9210579,
FT                   9211418..9211648,9214068..9214160,9216233..9216318,
FT                   9220574..9220655,9223953..9224031,9225940..9226027,
FT                   9228566..9228652,9229261..9229380,9230513..9230627,
FT                   9256780..9257139))
FT                   /gene="Actn2"
FT                   /locus_tag="mCG_9123"
FT                   /product="actinin alpha 2"
FT                   /note="gene_id=mCG9123.2 transcript_id=mCT9359.2 created on
FT                   18-APR-2002"
FT   CDS             complement(join(9189238..9189396,9190522..9190680,
FT                   9192481..9192546,9194860..9195006,9196145..9196324,
FT                   9197181..9197315,9198577..9198759,9200212..9200352,
FT                   9202298..9202406,9208320..9208470,9210432..9210579,
FT                   9211418..9211648,9214068..9214160,9216233..9216318,
FT                   9220574..9220655,9223953..9224031,9225940..9226027,
FT                   9228566..9228652,9229261..9229380,9230513..9230627,
FT                   9256780..9256905))
FT                   /codon_start=1
FT                   /gene="Actn2"
FT                   /locus_tag="mCG_9123"
FT                   /product="actinin alpha 2"
FT                   /note="gene_id=mCG9123.2 transcript_id=mCT9359.2
FT                   protein_id=mCP19341.1"
FT                   /db_xref="GOA:Q9JI91"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014837"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="MGI:MGI:109192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI91"
FT                   /protein_id="EDL32304.1"
FT                   /translation="MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFT
FT                   AWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKAL
FT                   DYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQR
FT                   KTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKH
FT                   LDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENER
FT                   LMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQ
FT                   LEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERL
FT                   EHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRV
FT                   EQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQL
FT                   HLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIL
FT                   AIQNEVEKVIQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN
FT                   ERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDK
FT                   LEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQE
FT                   QMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQ
FT                   SFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPPYSG
FT                   PGSVPGALDYTAFSSALYGESDL"
FT   gene            <9294579..9295155
FT                   /locus_tag="mCG_9116"
FT                   /note="gene_id=mCG9116.2"
FT   mRNA            <9294579..9295155
FT                   /locus_tag="mCG_9116"
FT                   /product="mCG9116"
FT                   /note="gene_id=mCG9116.2 transcript_id=mCT9351.2 created on
FT                   18-APR-2002"
FT   CDS             <9294605..9295096
FT                   /codon_start=1
FT                   /locus_tag="mCG_9116"
FT                   /product="mCG9116"
FT                   /note="gene_id=mCG9116.2 transcript_id=mCT9351.2
FT                   protein_id=mCP19310.1"
FT                   /protein_id="EDL32305.1"
FT                   /translation="LAKMTNTKRKRRGTWYMFSRPFRKHGIVPLATYVRIYKKGDIVDI
FT                   KGAGTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVWIEHIKHSKS
FT                   RDSFLKQVKEKDQKKKEAKEKGTWVQLKHQPVPPREAHFVRTNGKEPELLEPIPYEFMA
FT                   "
FT   gene            <9312261..9356542
FT                   /gene="Heatr1"
FT                   /locus_tag="mCG_119362"
FT                   /note="gene_id=mCG119362.1"
FT   mRNA            join(<9312261..9312402,9312887..9313103,9315368..9315509,
FT                   9317346..9317447,9317746..9317886,9319010..9319221,
FT                   9319441..9319574,9321192..9321294,9322327..9322437,
FT                   9322829..9322946,9323821..9323928,9324958..9325053,
FT                   9325513..9325601,9326700..9326911,9327524..9327645,
FT                   9328349..9328540,9329507..9329690,9329794..9329930,
FT                   9330655..9330847,9331699..9331868,9332233..9332391,
FT                   9333742..9333984,9334380..9334511,9337324..9337427,
FT                   9337560..9337703,9338323..9338441,9338523..9338644,
FT                   9339916..9340044,9340902..9341132,9342436..9342562,
FT                   9343044..9343204,9346049..9346095,9346423..9346546,
FT                   9347193..9347333,9347962..9348254,9348911..9349061,
FT                   9349894..9350052,9350199..9350333,9350469..9350573,
FT                   9350656..9350824,9351329..9351483,9351952..9352110,
FT                   9354087..9354195,9354842..9355023,9356388..9356542)
FT                   /gene="Heatr1"
FT                   /locus_tag="mCG_119362"
FT                   /product="HEAT repeat containing 1"
FT                   /note="gene_id=mCG119362.1 transcript_id=mCT120534.1
FT                   created on 18-APR-2002"
FT   CDS             join(9312261..9312402,9312887..9313103,9315368..9315509,
FT                   9317346..9317447,9317746..9317886,9319010..9319221,
FT                   9319441..9319574,9321192..9321294,9322327..9322437,
FT                   9322829..9322946,9323821..9323928,9324958..9325053,
FT                   9325513..9325601,9326700..9326911,9327524..9327645,
FT                   9328349..9328540,9329507..9329690,9329794..9329930,
FT                   9330655..9330847,9331699..9331868,9332233..9332391,
FT                   9333742..9333984,9334380..9334511,9337324..9337427,
FT                   9337560..9337703,9338323..9338441,9338523..9338644,
FT                   9339916..9340044,9340902..9341132,9342436..9342562,
FT                   9343044..9343204,9346049..9346095,9346423..9346546,
FT                   9347193..9347333,9347962..9348254,9348911..9349061,
FT                   9349894..9350052,9350199..9350333,9350469..9350573,
FT                   9350656..9350824,9351329..9351483,9351952..9352110,
FT                   9354087..9354195,9354842..9354930)
FT                   /codon_start=1
FT                   /gene="Heatr1"
FT                   /locus_tag="mCG_119362"
FT                   /product="HEAT repeat containing 1"
FT                   /note="gene_id=mCG119362.1 transcript_id=mCT120534.1
FT                   protein_id=mCP51550.1"
FT                   /db_xref="GOA:G3X9B1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012954"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022125"
FT                   /db_xref="MGI:MGI:2442524"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9B1"
FT                   /protein_id="EDL32306.1"
FT                   /translation="MTSLAQQLQRLALPQTDPSLLSRREVASLLFDPKEAATIDRDTAF
FT                   AIGCTGLEELLGIDPAFEQFEAPLFSQLAKGLERSVQTKAVNKQLDENISSFLLHLSPY
FT                   FLLKPAQKCLEWLIHRFHIHLYNADSLIACVLPYHETRVFVRVIQLLKISNPKHKWFWL
FT                   SPVKHSGVPLARGTLVTHCYKDLGFMDFICSLVTRSVKAFAEDPGSSTRLRVLLAFYAS
FT                   TIVSALVAAENLSDNVVAKLFPYIQKGLKSSLPDYRAATYMIICQISVKVTMEDTFVKS
FT                   LASQLIKTLTKVPSQVNDGLGCLIILLQRQKPENLGEKPFLHLCGVPDLIGLLHGISES
FT                   YDVSPLLRCMLPHLVASVVQHIAGEEAEGIDGQIYKNHLEEILIKIPLTNNLDHLLASH
FT                   LFEEYISYSSQEETQANGVALLNEQFLPLIRLLESKYPRALDAVLEEHLKEITGLKKQE
FT                   LFHQFISLSTSGGKYQFLEDSDTSLMLSLNHPLAPVRLLAVNHLKTFMKTSKEGIDETF
FT                   IKEAILTRLGDDNVDVVLATLSAFEIFQQHFGVEETVSSLLNLFQRADLSKNEGWFRVL
FT                   ELAANILIKEEILSKNDQLANQVVVQLLPFMVITSNDIESPDMKIAIHLSKSGICSLHP
FT                   LLRGWKEALENVIKSRKSREIIGVGNQKMVQLLGSNLSLGERSTVLKLVEDLVCAGEKE
FT                   SYSLKQKVAFHVTVSVLISCCSSFQETCFPFALRVFSLLQKKIRKLKSVITAVEIPSEW
FT                   HLELMLNRGLPEELWVRYVQELHGAQRVVMEDAILLVFSMKCFIFAMKAPKSFPTGAMW
FT                   WNPEQLDEDSRHYLHLLIGIFEMLLEVSDAMHFRVLIRLIMKVHLQDVLQLFKFFCVLW
FT                   TYGSSLSNPLNCTVKSELQTQALYIGSAMLSSQNTQYKQKLASTASPVVMSLLLNLGSH
FT                   IKEVRRAAVQCLQALRGVPSKFELVIDHLIPKAEEITSDATYVLQDLATLFDELQNEEK
FT                   QKSHQKLSETLRSLLHCVYGCPSYIAKGLMKVLQGVNSEMVLAQLLPMVEQLLEKVEKE
FT                   PTAVLKDEAVVLHLTLGKYNEYSASLLQKDPKSLDLFIKAMHTTKELHPGMPTVRITAL
FT                   EKITKPFFAAVSDGQVQQKLLCVLFDLLVNCKDAHCVQTVGSVFKGISVDAEQIRIELE
FT                   PRDKAKSLGTIQQTRRQKMQQKKSQDVESVQEVEGPYWQRVTLILELLQHKKKLKCPQI
FT                   LIPPLFNLLSRCLEPLSSEQGNMEYTKQLILSCLLNICQKLSPDGGRIPKDVVDEEKFN
FT                   VELIVQCIRLSEMPQTHHHALLLLGTVAGIFPDKVLHNIMSIFTFMGANVMRLDDAYSF
FT                   QVISKTVKMVIPALIQSDTGDSVEVTRNVEQIVVKIIGVFVDALPHVPEHRRLPILVQL
FT                   VTTLSAKKFLWILLVLLFEQYVTKTVLVAAYGEKDAILEADTEFWISVCCEFSVQHQVQ
FT                   SLMHILHYLEKLPEEKEEATSKTVSTKSEVQDEMLPVFKVDAHTSKQLRHFKYLSVSFM
FT                   SQLLASNHFLKKVVGSGGPKSLHGLEQGLLETVLSYINTVAQSMEKNADKLTGKFWRAL
FT                   LSKAYDMLDKVNALLPTETFISVIRGLVGNPLPSVRRKALDLLNNKLQQHTFWRKKMVH
FT                   RFLKLVPVLLAIVQHKKREAEDEQAINRQTALYTLKLLCKNFGAQNREPFIPVLSTAVK
FT                   LIEPEKKEEKNVLGSALLCIAEVTSTLEALAIPQLPSLMPSLLTAMKSTSELVHSEVCL
FT                   LSALAALHKVVETLPHFISPYLEGLLTQVIHLEKITREMGSASQANIRLTALKKTLATE
FT                   LSPRVLLPAISKTFKQIQKNWKNHMGPFMSILQEHIGVMKKEELLSHQSQLTTFFLEAL
FT                   DFRAQHSEDDLEEVGKTEGWIIDCLVAMVVKLSEVTFRPLFFKLFDWAKTEDAPKDRLL
FT                   TFYNLADCIAEKLKGLFTLFAGHLVKPFADTLNQVNISKTDEAFFDSERDPEKCCLLLQ
FT                   FILNCLYKVFLFDTQNFMSRERAEALMMPLVDQLENRLGGEERFQERVTKYLVPCIAQF
FT                   SVAMADDSMWKPLNYQILLKTRDSSPKVRFAALITVLALAEKLRENYIVLLPESIPFLA
FT                   ELMEDECEEVEHQCQKTIQQLEAVLGEPLQSYF"
FT   gene            complement(9341388..>9341914)
FT                   /locus_tag="mCG_9114"
FT                   /note="gene_id=mCG9114.1"
FT   mRNA            complement(9341388..>9341914)
FT                   /locus_tag="mCG_9114"
FT                   /product="mCG9114"
FT                   /note="gene_id=mCG9114.1 transcript_id=mCT9349.1 created on
FT                   18-APR-2002"
FT   CDS             complement(9341447..>9341914)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9114"
FT                   /product="mCG9114"
FT                   /note="gene_id=mCG9114.1 transcript_id=mCT9349.1
FT                   protein_id=mCP19309.0"
FT                   /protein_id="EDL32307.1"
FT                   /translation="AIVGGAAATMQIFVKTLTGKTITLEVEPWDTIENVKATTQDKEGI
FT                   PPHQQRLVFAGKQLEDGRTLSDYNIQRESTLHLVLRLRGGAKRRKKKSYTTPKKNKHKR
FT                   KKVKLAVLKYYKVDKNGKISRLRRQCPDECGAGVFMGSHLDRHCCGKCCLT"
FT   gene            complement(9355566..9381162)
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /note="gene_id=mCG9125.2"
FT   mRNA            complement(join(9355566..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9372597..9372685,
FT                   9375426..9375568,9377679..9377990,9381147..9381162))
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, transcript
FT                   variant mCT168086"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT168086.0 created
FT                   on 18-APR-2002"
FT   mRNA            complement(join(9355566..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9372597..9372685,
FT                   9375426..9375568,9377911..9377986))
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, transcript
FT                   variant mCT168088"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT168088.0 created
FT                   on 18-APR-2002"
FT   mRNA            complement(join(9355566..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9372597..9372685,
FT                   9375426..9375568,9377493..9377699))
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, transcript
FT                   variant mCT9360"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT9360.2 created on
FT                   18-APR-2002"
FT   mRNA            complement(join(9355566..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9372597..9372685,
FT                   9375426..9375568,9377057..9377299))
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, transcript
FT                   variant mCT168087"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT168087.0 created
FT                   on 18-APR-2002"
FT   mRNA            complement(join(9355671..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9375426..9375568,
FT                   9377679..>9377747))
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, transcript
FT                   variant mCT193002"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT193002.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9357098..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9372597..9372685,
FT                   9375426..9375467))
FT                   /codon_start=1
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT168086.0
FT                   protein_id=mCP90922.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542M5"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q542M5"
FT                   /protein_id="EDL32308.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
FT   CDS             complement(join(9357098..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9372597..9372685,
FT                   9375426..9375467))
FT                   /codon_start=1
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT168087.0
FT                   protein_id=mCP90913.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542M5"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q542M5"
FT                   /protein_id="EDL32309.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
FT   CDS             complement(join(9357098..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9372597..9372685,
FT                   9375426..9375467))
FT                   /codon_start=1
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT168088.0
FT                   protein_id=mCP90919.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542M5"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q542M5"
FT                   /protein_id="EDL32310.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
FT   CDS             complement(join(9357098..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9372597..9372685,
FT                   9375426..9375467))
FT                   /codon_start=1
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT9360.2
FT                   protein_id=mCP19351.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q542M5"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/TrEMBL:Q542M5"
FT                   /protein_id="EDL32312.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
FT   CDS             complement(join(9357098..9357247,9363400..9363565,
FT                   9364672..9364760,9367654..9367680,9368975..9369031,
FT                   9369538..9369657,9370988..9371198,9375426..>9375454))
FT                   /codon_start=1
FT                   /gene="Lgals8"
FT                   /locus_tag="mCG_9125"
FT                   /product="lectin, galactose binding, soluble 8, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG9125.2 transcript_id=mCT193002.0
FT                   protein_id=mCP113980.0 isoform=CRA_b"
FT                   /protein_id="EDL32311.1"
FT                   /translation="ITYKISSITRFQVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNT
FT                   LTQEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVG
FT                   IYGKVNIHSIGFRFSSDLQSMETSALGLTQINRENIQKPGKLQLSLPFEARLNASMGPG
FT                   RTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPRLNVKAFVRNSFLQDAWGEEERNIT
FT                   CFPFSSGMYFEMIIYCDVREFKVAINGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRS
FT                   W"
FT   gene            complement(9393001..>9436692)
FT                   /gene="Edaradd"
FT                   /locus_tag="mCG_52996"
FT                   /note="gene_id=mCG52996.2"
FT   mRNA            complement(join(9393001..9394762,9399793..9399838,
FT                   9416735..9416793,9423618..9423657,9424705..9424763,
FT                   9436227..>9436692))
FT                   /gene="Edaradd"
FT                   /locus_tag="mCG_52996"
FT                   /product="EDAR (ectodysplasin-A receptor)-associated death
FT                   domain"
FT                   /note="gene_id=mCG52996.2 transcript_id=mCT53179.2 created
FT                   on 18-APR-2002"
FT   CDS             complement(join(9394652..9394762,9399793..9399838,
FT                   9416735..9416793,9423618..9423657,9424705..9424763,
FT                   9436227..>9436640))
FT                   /codon_start=1
FT                   /gene="Edaradd"
FT                   /locus_tag="mCG_52996"
FT                   /product="EDAR (ectodysplasin-A receptor)-associated death
FT                   domain"
FT                   /note="gene_id=mCG52996.2 transcript_id=mCT53179.2
FT                   protein_id=mCP39801.2"
FT                   /protein_id="EDL32313.1"
FT                   /translation="KALPVAIAWDLRGKTRVLRPRYQQGKCSGGPSVSSRAQPQPTESS
FT                   PEFWRDSRREGALLIAGSEHEEEVAEIKKRKGRRRSSSSSRAERRQSRALPRKRLGPCD
FT                   PAVLRGPRDCPPLLGHSSVLSWSSWLLRTTLCAQITWQRSQWRTRTPALYPLPCQTSIP
FT                   FKTPASLKLKSVIQSIPTVHQILMTNLREKKMTFQTAPKIPFQVSAETSPVRTGRAAAL
FT                   ALPAPPGPPPSATCSTIRTC"
FT   gene            <9456513..9479087
FT                   /locus_tag="mCG_145501"
FT                   /note="gene_id=mCG145501.0"
FT   mRNA            join(<9456513..9456603,9457626..9457946,9478718..9479087)
FT                   /locus_tag="mCG_145501"
FT                   /product="mCG145501"
FT                   /note="gene_id=mCG145501.0 transcript_id=mCT184925.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<9457937..9457946,9478718..9478932)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145501"
FT                   /product="mCG145501"
FT                   /note="gene_id=mCG145501.0 transcript_id=mCT184925.0
FT                   protein_id=mCP105538.0"
FT                   /protein_id="EDL32314.1"
FT                   /translation="THTASCSHGYRLEPGPLLRCISLPHDGWTHLFPLQLFLAGHSNEK
FT                   SNRSSVLRTLTHPHHVNGKSSLFAPKDLY"
FT   gene            9482283..9527784
FT                   /locus_tag="mCG_9117"
FT                   /note="gene_id=mCG9117.1"
FT   mRNA            join(9482283..9482554,9491196..9491315,9495552..9495635,
FT                   9496735..9496776,9498030..9498112,9499898..9499971,
FT                   9507122..9507242,9507346..9507396,9512083..9512109,
FT                   9516248..9516340,9516474..9516720,9518123..9518192,
FT                   9518698..9518785,9520717..9520850,9525956..9527784)
FT                   /locus_tag="mCG_9117"
FT                   /product="mCG9117, transcript variant mCT9352"
FT                   /note="gene_id=mCG9117.1 transcript_id=mCT9352.2 created on
FT                   18-APR-2002"
FT   mRNA            join(9482283..9482554,9491196..9491315,9495552..9495635,
FT                   9496735..9496776,9498030..9498112,9499898..9499971,
FT                   9507122..9507242,9507346..9507396,9512083..9512109,
FT                   9516248..9516340,9516474..9516720,9518123..9518192,
FT                   9518698..9518785,9520717..9520850,9523216..9523804)
FT                   /locus_tag="mCG_9117"
FT                   /product="mCG9117, transcript variant mCT168084"
FT                   /note="gene_id=mCG9117.1 transcript_id=mCT168084.0 created
FT                   on 18-APR-2002"
FT   CDS             join(9482453..9482554,9491196..9491315,9495552..9495635,
FT                   9496735..9496776,9498030..9498112,9499898..9499971,
FT                   9507122..9507242,9507346..9507396,9512083..9512109,
FT                   9516248..9516260)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9117"
FT                   /product="mCG9117, isoform CRA_a"
FT                   /note="gene_id=mCG9117.1 transcript_id=mCT168084.0
FT                   protein_id=mCP90915.0 isoform=CRA_a"
FT                   /protein_id="EDL32315.1"
FT                   /translation="MSPGFRRAVTGQGAAAAVQLLVTLSFLSSLVKTQVTGVLDDCLCD
FT                   IDSIDKFNTYKIFPKIKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESK
FT                   IPVGIKAGRSNKYSQAANSTKELDDCEQANKLGAINSTLSNESKEAFIDWARYDDSQDH
FT                   FCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAP
FT                   SRGGRIILYVARRFVS"
FT   CDS             join(9482453..9482554,9491196..9491315,9495552..9495635,
FT                   9496735..9496776,9498030..9498112,9499898..9499971,
FT                   9507122..9507242,9507346..9507396,9512083..9512109,
FT                   9516248..9516260)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9117"
FT                   /product="mCG9117, isoform CRA_a"
FT                   /note="gene_id=mCG9117.1 transcript_id=mCT9352.2
FT                   protein_id=mCP19313.2 isoform=CRA_a"
FT                   /protein_id="EDL32317.1"
FT                   /translation="MSPGFRRAVTGQGAAAAVQLLVTLSFLSSLVKTQVTGVLDDCLCD
FT                   IDSIDKFNTYKIFPKIKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESK
FT                   IPVGIKAGRSNKYSQAANSTKELDDCEQANKLGAINSTLSNESKEAFIDWARYDDSQDH
FT                   FCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAP
FT                   SRGGRIILYVARRFVS"
FT   mRNA            join(<9482833..9482991,9491196..9491315,9495552..9495635,
FT                   9496735..9496776,9498030..9498112,9499898..9499971,
FT                   9507122..9507242,9507346..9507396,9512083..9512109,
FT                   9516248..9516340,9516474..9516720,9518123..9518192,
FT                   9518698..9518785,9520717..9520850,9523216..9523490)
FT                   /locus_tag="mCG_9117"
FT                   /product="mCG9117, transcript variant mCT168085"
FT                   /note="gene_id=mCG9117.1 transcript_id=mCT168085.0 created
FT                   on 18-APR-2002"
FT   CDS             join(<9482911..9482991,9491196..9491315,9495552..9495635,
FT                   9496735..9496776,9498030..9498112,9499898..9499971,
FT                   9507122..9507242,9507346..9507396,9512083..9512109,
FT                   9516248..9516260)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9117"
FT                   /product="mCG9117, isoform CRA_b"
FT                   /note="gene_id=mCG9117.1 transcript_id=mCT168085.0
FT                   protein_id=mCP90923.0 isoform=CRA_b"
FT                   /protein_id="EDL32316.1"
FT                   /translation="TCALEIAIGITRFIIIHLSYVCKVACQVTGVLDDCLCDIDSIDKF
FT                   NTYKIFPKIKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKA
FT                   GRSNKYSQAANSTKELDDCEQANKLGAINSTLSNESKEAFIDWARYDDSQDHFCELDDE
FT                   RSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGGRII
FT                   LYVARRFVS"
FT   gene            complement(9530456..>9547066)
FT                   /locus_tag="mCG_119356"
FT                   /note="gene_id=mCG119356.1"
FT   mRNA            complement(join(9530456..9532237,9534113..9534237,
FT                   9536154..9536268,9537757..9537910,9540272..9540494,
FT                   9547000..>9547066))
FT                   /locus_tag="mCG_119356"
FT                   /product="mCG119356, transcript variant mCT120528"
FT                   /note="gene_id=mCG119356.1 transcript_id=mCT120528.1
FT                   created on 18-APR-2002"
FT   mRNA            complement(join(9533295..9533887,9534113..9534237,
FT                   9536154..9536268,9537757..9537910,9540272..9540494,
FT                   9547000..>9547066))
FT                   /locus_tag="mCG_119356"
FT                   /product="mCG119356, transcript variant mCT168072"
FT                   /note="gene_id=mCG119356.1 transcript_id=mCT168072.0
FT                   created on 18-APR-2002"
FT   CDS             complement(join(9536243..9536268,9537757..9537910,
FT                   9540272..9540494,9547000..>9547064))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119356"
FT                   /product="mCG119356, isoform CRA_a"
FT                   /note="gene_id=mCG119356.1 transcript_id=mCT120528.1
FT                   protein_id=mCP51613.1 isoform=CRA_a"
FT                   /protein_id="EDL32318.1"
FT                   /translation="FLSLQVIFKAKSKYSPELLKYRLPLYLASLFISLVFLLVNLTCAV
FT                   LVKTGDWDRKVIVSVRVAINDTLFVLCAISLSICLYKISKMSLANIYLESKGSSVCQVT
FT                   AIGVTVILLYASRACYNLFILSFSQIKNVHSFDYDWYNVSDQVASWVMPAT"
FT   CDS             complement(join(9536243..9536268,9537757..9537910,
FT                   9540272..9540494,9547000..>9547064))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119356"
FT                   /product="mCG119356, isoform CRA_a"
FT                   /note="gene_id=mCG119356.1 transcript_id=mCT168072.0
FT                   protein_id=mCP90921.0 isoform=CRA_a"
FT                   /protein_id="EDL32319.1"
FT                   /translation="FLSLQVIFKAKSKYSPELLKYRLPLYLASLFISLVFLLVNLTCAV
FT                   LVKTGDWDRKVIVSVRVAINDTLFVLCAISLSICLYKISKMSLANIYLESKGSSVCQVT
FT                   AIGVTVILLYASRACYNLFILSFSQIKNVHSFDYDWYNVSDQVASWVMPAT"
FT   assembly_gap    1638..1657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17318..17654
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    18995..21760
FT                   /estimated_length=2766
FT                   /gap_type="unknown"
FT   assembly_gap    23513..25243
FT                   /estimated_length=1731
FT                   /gap_type="unknown"
FT   assembly_gap    26670..26689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    27735..27754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    31119..31138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    44632..44747
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    51854..52345
FT                   /estimated_length=492
FT                   /gap_type="unknown"
FT   assembly_gap    65212..66948
FT                   /estimated_length=1737
FT                   /gap_type="unknown"
FT   assembly_gap    69204..69621
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    72435..73084
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    97082..97101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    102902..104562
FT                   /estimated_length=1661
FT                   /gap_type="unknown"
FT   assembly_gap    155998..157109
FT                   /estimated_length=1112
FT                   /gap_type="unknown"
FT   assembly_gap    160735..161732
FT                   /estimated_length=998
FT                   /gap_type="unknown"
FT   assembly_gap    165765..165784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    188111..188130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    193456..194275
FT                   /estimated_length=820
FT                   /gap_type="unknown"
FT   assembly_gap    197153..197803
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    246702..246721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    270176..270539
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    283298..283678
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    294608..294627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    295674..295693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    322340..323800
FT                   /estimated_length=1461
FT                   /gap_type="unknown"
FT   assembly_gap    325384..326221
FT                   /estimated_length=838
FT                   /gap_type="unknown"
FT   assembly_gap    331559..331659
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    372971..372990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    374626..374645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    376638..376657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    377892..377911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    380866..380885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    410265..410388
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    466108..466127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    495084..495920
FT                   /estimated_length=837
FT                   /gap_type="unknown"
FT   assembly_gap    497705..501355
FT                   /estimated_length=3651
FT                   /gap_type="unknown"
FT   assembly_gap    512518..512537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    576216..576770
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    590510..590529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    611104..611242
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    613588..613607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    626855..627077
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    634768..634787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    642233..642252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    653680..653938
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    700374..700493
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    721617..722098
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   assembly_gap    728337..728356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    755665..755818
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    758462..758731
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    763974..764062
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    766665..766893
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    817507..820900
FT                   /estimated_length=3394
FT                   /gap_type="unknown"
FT   assembly_gap    822783..824673
FT                   /estimated_length=1891
FT                   /gap_type="unknown"
FT   assembly_gap    828694..828824
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    832621..833111
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    834290..834799
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   assembly_gap    843454..843473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    854777..854796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    856989..857008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    858761..858780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    866776..867026
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    887406..889336
FT                   /estimated_length=1931
FT                   /gap_type="unknown"
FT   assembly_gap    893184..893203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    897448..897591
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    901389..901543
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    905037..905056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    918886..919299
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    925144..925163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    936717..936972
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    943797..943876
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    951795..951814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    961028..962426
FT                   /estimated_length=1399
FT                   /gap_type="unknown"
FT   assembly_gap    963464..963683
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    982665..982865
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    988028..988047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1020650..1021183
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   assembly_gap    1050319..1050338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1051514..1051533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1130822..1130978
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    1137669..1137705
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    1143686..1143804
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    1191531..1191685
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    1199604..1200116
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    1245166..1245185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1246321..1246340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1255191..1255243
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    1312888..1312917
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1318552..1318571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1319599..1319618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1334697..1334837
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    1337385..1337404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1383671..1383984
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    1403345..1403364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1404564..1404583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1417106..1417174
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    1424620..1424674
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    1433965..1433984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1512245..1512513
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    1520003..1520022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1534692..1534711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1551391..1555567
FT                   /estimated_length=4177
FT                   /gap_type="unknown"
FT   assembly_gap    1564353..1564372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1566303..1566322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1575405..1575424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1581935..1582204
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    1591904..1591923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1602843..1606435
FT                   /estimated_length=3593
FT                   /gap_type="unknown"
FT   assembly_gap    1608529..1608548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1609629..1610459
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   assembly_gap    1612374..1613075
FT                   /estimated_length=702
FT                   /gap_type="unknown"
FT   assembly_gap    1637401..1637686
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    1695391..1695620
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    1699084..1699352
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    1703540..1703559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1706093..1706168
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    1729164..1729424
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    1745889..1746055
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    1747052..1747085
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    1765043..1765062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1766325..1766344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1767427..1767446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1792078..1792097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798826..1801101
FT                   /estimated_length=2276
FT                   /gap_type="unknown"
FT   assembly_gap    1805400..1805544
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    1826628..1826647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1840983..1841002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1842623..1842642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1854333..1854352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1869593..1869612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1892205..1892728
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    1894183..1894261
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    1902769..1902832
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    1915423..1915481
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    1931193..1931212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1932950..1932969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1940702..1940721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1951756..1951833
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    1964771..1964790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1993581..1993600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2013474..2015386
FT                   /estimated_length=1913
FT                   /gap_type="unknown"
FT   assembly_gap    2025971..2025990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2034838..2034857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2045179..2045280
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    2046707..2046726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2070422..2074178
FT                   /estimated_length=3757
FT                   /gap_type="unknown"
FT   assembly_gap    2075167..2075410
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    2089347..2094016
FT                   /estimated_length=4670
FT                   /gap_type="unknown"
FT   assembly_gap    2102308..2102375
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    2116611..2116873
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    2122399..2122418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2157490..2157645
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    2158989..2159008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2267660..2267698
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    2276812..2276977
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    2315537..2315630
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    2430879..2433711
FT                   /estimated_length=2833
FT                   /gap_type="unknown"
FT   assembly_gap    2437934..2438639
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    2439346..2439365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2492170..2492189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2525240..2525296
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    2561521..2561741
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    2565326..2565345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2584885..2584944
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    2596059..2596356
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    2606410..2606524
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    2639217..2639236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2698797..2699131
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   assembly_gap    2797754..2798485
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    2843599..2843618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2851334..2852405
FT                   /estimated_length=1072
FT                   /gap_type="unknown"
FT   assembly_gap    2909029..2909048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2936199..2936218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2948574..2948593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2967688..2967707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2980340..2980380
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    2987089..2987211
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    2995779..2995885
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    3019367..3019459
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    3025503..3025832
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    3026251..3026858
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    3079905..3079924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3084106..3084125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3085499..3088598
FT                   /estimated_length=3100
FT                   /gap_type="unknown"
FT   assembly_gap    3114814..3114833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3143628..3144356
FT                   /estimated_length=729
FT                   /gap_type="unknown"
FT   assembly_gap    3166846..3166929
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    3195582..3195601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3197173..3197418
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    3199275..3199365
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    3207100..3207139
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    3277092..3277355
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    3282072..3282294
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    3294857..3294876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3345790..3345809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3387003..3389653
FT                   /estimated_length=2651
FT                   /gap_type="unknown"
FT   assembly_gap    3393075..3393094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3398244..3398427
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    3440457..3441278
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   assembly_gap    3463132..3463419
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    3472148..3472753
FT                   /estimated_length=606
FT                   /gap_type="unknown"
FT   assembly_gap    3476939..3476958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3490595..3490614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3492849..3492915
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    3502833..3502852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3508587..3508606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3523227..3523250
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3555609..3561249
FT                   /estimated_length=5641
FT                   /gap_type="unknown"
FT   assembly_gap    3580242..3580468
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    3582980..3582999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3589356..3589375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3595256..3595404
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    3597591..3597610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3606566..3606645
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    3612254..3612312
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    3615985..3618342
FT                   /estimated_length=2358
FT                   /gap_type="unknown"
FT   assembly_gap    3623876..3623983
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    3647934..3647953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3648944..3649253
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    3661887..3683146
FT                   /estimated_length=21260
FT                   /gap_type="unknown"
FT   assembly_gap    3684435..3684454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3690857..3691237
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    3697691..3697861
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    3704345..3704364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3728058..3728420
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    3739148..3739167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3766893..3766912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3811801..3812504
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    3821986..3822913
FT                   /estimated_length=928
FT                   /gap_type="unknown"
FT   assembly_gap    3843234..3843253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3844329..3844530
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    3877901..3878750
FT                   /estimated_length=850
FT                   /gap_type="unknown"
FT   assembly_gap    3882971..3884859
FT                   /estimated_length=1889
FT                   /gap_type="unknown"
FT   assembly_gap    3890416..3890435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3929253..3929606
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    3937796..3937864
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3988204..3990018
FT                   /estimated_length=1815
FT                   /gap_type="unknown"
FT   assembly_gap    3991424..3991448
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    3993080..3993099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3994618..3994637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3997524..3998752
FT                   /estimated_length=1229
FT                   /gap_type="unknown"
FT   assembly_gap    4008040..4008059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4064132..4067390
FT                   /estimated_length=3259
FT                   /gap_type="unknown"
FT   assembly_gap    4082208..4082283
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    4149941..4151675
FT                   /estimated_length=1735
FT                   /gap_type="unknown"
FT   assembly_gap    4162836..4163350
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    4211617..4211762
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    4266424..4266443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4275764..4276364
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    4323716..4323758
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    4338847..4338991
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    4351298..4351317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4356396..4356679
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    4375766..4375785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4384563..4384582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4405732..4405751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4435591..4435881
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    4437735..4437895
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    4507569..4508138
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    4545098..4545688
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    4559273..4559292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4560968..4560987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4584338..4584806
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   assembly_gap    4586727..4586750
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    4603029..4603048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4611254..4611273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4679981..4680057
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    4694919..4694938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4720869..4720888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4746130..4748117
FT                   /estimated_length=1988
FT                   /gap_type="unknown"
FT   assembly_gap    4805428..4805813
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   assembly_gap    4816496..4816515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4822153..4822172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4835103..4835793
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    4839493..4839859
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    4890206..4892252
FT                   /estimated_length=2047
FT                   /gap_type="unknown"
FT   assembly_gap    4899004..4899703
FT                   /estimated_length=700
FT                   /gap_type="unknown"
FT   assembly_gap    4980022..4980124
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    4981976..4982195
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    4994284..4994303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5052860..5052879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5059082..5059101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5077248..5077277
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    5103288..5105201
FT                   /estimated_length=1914
FT                   /gap_type="unknown"
FT   assembly_gap    5112366..5112385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5130713..5130732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5141115..5141266
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    5155314..5155333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5180523..5180542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5195801..5195820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5211610..5211635
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    5220834..5221175
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    5268025..5268098
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    5274711..5274730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5288280..5288562
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    5296539..5298657
FT                   /estimated_length=2119
FT                   /gap_type="unknown"
FT   assembly_gap    5312466..5312485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5320824..5320843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5393858..5394047
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    5406536..5407197
FT                   /estimated_length=662
FT                   /gap_type="unknown"
FT   assembly_gap    5407954..5408018
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    5474156..5474175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5495378..5495644
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    5501491..5501510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5503341..5503360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5514234..5514547
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    5520370..5520643
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    5525206..5525590
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    5556302..5556454
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    5567536..5567555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5571131..5571189
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    5604340..5604359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5626688..5627131
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    5635293..5635374
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    5645698..5645717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5669234..5669559
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    5699352..5699887
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    5703196..5703215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5704670..5704764
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    5706948..5710597
FT                   /estimated_length=3650
FT                   /gap_type="unknown"
FT   assembly_gap    5711750..5711769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5714555..5714574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5717469..5717802
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    5725733..5725752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5743888..5744074
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    5751324..5751431
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    5754433..5757247
FT                   /estimated_length=2815
FT                   /gap_type="unknown"
FT   assembly_gap    5798079..5798098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5835165..5836251
FT                   /estimated_length=1087
FT                   /gap_type="unknown"
FT   assembly_gap    5844767..5845180
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    5857374..5857393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5874087..5874106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5877313..5877332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5887239..5887696
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    5889093..5894835
FT                   /estimated_length=5743
FT                   /gap_type="unknown"
FT   assembly_gap    5899355..5903508
FT                   /estimated_length=4154
FT                   /gap_type="unknown"
FT   assembly_gap    5930980..5931727
FT                   /estimated_length=748
FT                   /gap_type="unknown"
FT   assembly_gap    5953414..5954138
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   assembly_gap    5971685..5971757
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    5975014..5975165
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    5976958..5977306
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    6013626..6013645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6027117..6027136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6031625..6031735
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    6036244..6036849
FT                   /estimated_length=606
FT                   /gap_type="unknown"
FT   assembly_gap    6132856..6133175
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    6158867..6158899
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    6164019..6164381
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    6167379..6167726
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    6182901..6183053
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    6197612..6197815
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    6219399..6219576
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    6340401..6340420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6377104..6378637
FT                   /estimated_length=1534
FT                   /gap_type="unknown"
FT   assembly_gap    6393688..6393707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6401032..6402216
FT                   /estimated_length=1185
FT                   /gap_type="unknown"
FT   assembly_gap    6415481..6416074
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    6454148..6455818
FT                   /estimated_length=1671
FT                   /gap_type="unknown"
FT   assembly_gap    6466451..6466470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6469902..6470210
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    6549123..6549532
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    6553534..6553669
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    6561924..6561943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6576370..6576547
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    6586518..6586537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6620278..6620297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6621319..6621338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6642806..6643015
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    6707992..6708183
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    6717390..6717453
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    6719011..6719030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6723652..6723671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6729090..6729129
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    6751253..6751445
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    6758793..6758812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6776639..6776658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6778493..6780417
FT                   /estimated_length=1925
FT                   /gap_type="unknown"
FT   assembly_gap    6797294..6800923
FT                   /estimated_length=3630
FT                   /gap_type="unknown"
FT   assembly_gap    6808676..6808695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6827265..6827668
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    6832920..6833103
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    6836419..6836438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6837613..6837632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6850165..6850222
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    6866169..6866367
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    6868658..6868919
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    6887876..6887895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6903827..6903852
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    6921246..6921310
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    6960632..6960670
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    6988095..6988160
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    7000154..7000317
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    7011852..7012034
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    7020174..7020256
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    7046531..7046576
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    7062852..7062871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7098705..7098724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7099850..7100595
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   assembly_gap    7103058..7103077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7108044..7108063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7110149..7110267
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    7119078..7136816
FT                   /estimated_length=17739
FT                   /gap_type="unknown"
FT   assembly_gap    7142048..7142067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7157600..7157834
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    7159205..7159543
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    7244401..7244420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7250902..7252329
FT                   /estimated_length=1428
FT                   /gap_type="unknown"
FT   assembly_gap    7263574..7264078
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    7271147..7271166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7274390..7274445
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    7322323..7322342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7324944..7325354
FT                   /estimated_length=411
FT                   /gap_type="unknown"
FT   assembly_gap    7330579..7330993
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    7331425..7331452
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    7335815..7335834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7370931..7371006
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    7380175..7380194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7407857..7407876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7434884..7434922
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    7463381..7463967
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    7542329..7544997
FT                   /estimated_length=2669
FT                   /gap_type="unknown"
FT   assembly_gap    7547024..7547106
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    7558457..7559657
FT                   /estimated_length=1201
FT                   /gap_type="unknown"
FT   assembly_gap    7560376..7563496
FT                   /estimated_length=3121
FT                   /gap_type="unknown"
FT   assembly_gap    7570159..7570178
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7587204..7587390
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    7588947..7594907
FT                   /estimated_length=5961
FT                   /gap_type="unknown"
FT   assembly_gap    7599726..7599745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7625612..7625794
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    7643628..7643647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7657741..7657760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7686606..7686625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7697215..7697277
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    7766875..7766944
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    7770293..7770436
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    7775900..7775925
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    7798695..7798714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7811422..7811658
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    7813677..7814486
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   assembly_gap    7845853..7847188
FT                   /estimated_length=1336
FT                   /gap_type="unknown"
FT   assembly_gap    7849990..7850009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7854245..7854465
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   assembly_gap    7864912..7865277
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    7894113..7894538
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    7905548..7906106
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    7946834..7946853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7992359..7992378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7993927..8005574
FT                   /estimated_length=11648
FT                   /gap_type="unknown"
FT   assembly_gap    8013847..8013993
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    8015212..8015329
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    8060433..8060972
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    8112833..8114447
FT                   /estimated_length=1615
FT                   /gap_type="unknown"
FT   assembly_gap    8117512..8117706
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    8167576..8168708
FT                   /estimated_length=1133
FT                   /gap_type="unknown"
FT   assembly_gap    8179595..8181112
FT                   /estimated_length=1518
FT                   /gap_type="unknown"
FT   assembly_gap    8183117..8183136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8185515..8185534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8192530..8192549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8193645..8193664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8212508..8212577
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    8238192..8238355
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    8240776..8241007
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    8259709..8259728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8264876..8264970
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    8299736..8299755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8300991..8301010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8320242..8320261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8347717..8347895
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    8359166..8359325
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    8378866..8378885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8422013..8422032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8452980..8453135
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    8468017..8468036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8475566..8475594
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    8486224..8488110
FT                   /estimated_length=1887
FT                   /gap_type="unknown"
FT   assembly_gap    8517191..8517339
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    8529702..8529721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8555353..8555418
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    8566484..8566503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8607642..8607661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8723234..8724327
FT                   /estimated_length=1094
FT                   /gap_type="unknown"
FT   assembly_gap    8741785..8741804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8758111..8758130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8780610..8780629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8781723..8781742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8782953..8782972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8784826..8784845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8785900..8785919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8825966..8826176
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    8846788..8846836
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    8852521..8852540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8880149..8880308
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    8922245..8922976
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    8923775..8923794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8936963..8937027
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    8957698..8958424
FT                   /estimated_length=727
FT                   /gap_type="unknown"
FT   assembly_gap    9007285..9007304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9016009..9016028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9025872..9026113
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    9067487..9067595
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    9075769..9075788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9077511..9077530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9087941..9087960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9104152..9104202
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    9107485..9107541
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    9144788..9144807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9168585..9168604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9186708..9186835
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    9191684..9191936
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    9202487..9202546
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    9209560..9209669
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    9216836..9216855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9225118..9225137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9250122..9250141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9251353..9251372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9269933..9269952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9281777..9281826
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    9303510..9303529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9312444..9312466
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    9320221..9320240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9383774..9383914
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    9385465..9385484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9422355..9422557
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    9438480..9438582
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    9440303..9440322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9443190..9443247
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    9510318..9510395
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    9536271..9536290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9542011..9542301
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    9545127..9545227
FT                   /estimated_length=101
FT                   /gap_type="unknown"
XX
CO   join(complement(AAHY01103809.1:1..1637),gap(20),AAHY01103810.1:1..15660,
CO   gap(337),AAHY01103811.1:1..1340,gap(2766),AAHY01103812.1:1..1752,gap(1731),
CO   AAHY01103813.1:1..1426,gap(20),AAHY01103814.1:1..1045,gap(20),
CO   AAHY01103815.1:1..3364,gap(20),AAHY01103816.1:1..13493,gap(116),
CO   complement(AAHY01103817.1:1..7106),gap(492),AAHY01103818.1:1..12866,
CO   gap(1737),AAHY01103819.1:1..2255,gap(418),
CO   complement(AAHY01103820.1:1..2813),gap(650),AAHY01103821.1:1..23997,
CO   gap(20),AAHY01103822.1:1..5800,gap(1661),AAHY01103823.1:1..51435,gap(1112),
CO   AAHY01103824.1:1..3625,gap(998),AAHY01103825.1:1..4032,gap(20),
CO   AAHY01103826.1:1..22326,gap(20),AAHY01103827.1:1..5325,gap(820),
CO   AAHY01103828.1:1..2877,gap(651),AAHY01103829.1:1..48898,gap(20),
CO   AAHY01103830.1:1..23454,gap(364),AAHY01103831.1:1..12758,gap(381),
CO   AAHY01103832.1:1..10929,gap(20),complement(AAHY01103833.1:1..1046),gap(20),
CO   AAHY01103834.1:1..26646,gap(1461),complement(AAHY01103835.1:1..1583),
CO   gap(838),complement(AAHY01103836.1:1..5337),gap(101),
CO   AAHY01103837.1:1..41311,gap(20),AAHY01103838.1:1..1635,gap(20),
CO   complement(AAHY01103839.1:1..1992),gap(20),
CO   complement(AAHY01103840.1:1..1234),gap(20),AAHY01103841.1:1..2954,gap(20),
CO   AAHY01103842.1:1..29379,gap(124),AAHY01103843.1:1..55719,gap(20),
CO   AAHY01103844.1:1..28956,gap(837),AAHY01103845.1:1..1784,gap(3651),
CO   AAHY01103846.1:1..11162,gap(20),AAHY01103847.1:1..63678,gap(555),
CO   AAHY01103848.1:1..13739,gap(20),AAHY01103849.1:1..20574,gap(139),
CO   complement(AAHY01103850.1:1..2345),gap(20),AAHY01103851.1:1..13247,
CO   gap(223),AAHY01103852.1:1..7690,gap(20),AAHY01103853.1:1..7445,gap(20),
CO   AAHY01103854.1:1..11427,gap(259),AAHY01103855.1:1..46435,gap(120),
CO   AAHY01103856.1:1..21123,gap(482),complement(AAHY01103857.1:1..6238),
CO   gap(20),AAHY01103858.1:1..27308,gap(154),AAHY01103859.1:1..2643,gap(270),
CO   complement(AAHY01103860.1:1..5242),gap(89),AAHY01103861.1:1..2602,gap(229),
CO   AAHY01103862.1:1..50613,gap(3394),AAHY01103863.1:1..1882,gap(1891),
CO   AAHY01103864.1:1..4020,gap(131),AAHY01103865.1:1..3796,gap(491),
CO   AAHY01103866.1:1..1178,gap(510),AAHY01103867.1:1..8654,gap(20),
CO   AAHY01103868.1:1..11303,gap(20),complement(AAHY01103869.1:1..2192),gap(20),
CO   AAHY01103870.1:1..1752,gap(20),complement(AAHY01103871.1:1..7995),gap(251),
CO   AAHY01103872.1:1..20379,gap(1931),AAHY01103873.1:1..3847,gap(20),
CO   complement(AAHY01103874.1:1..4244),gap(144),
CO   complement(AAHY01103875.1:1..3797),gap(155),AAHY01103876.1:1..3493,gap(20),
CO   complement(AAHY01103877.1:1..13829),gap(414),AAHY01103878.1:1..5844,
CO   gap(20),complement(AAHY01103879.1:1..11553),gap(256),
CO   complement(AAHY01103880.1:1..6824),gap(80),
CO   complement(AAHY01103881.1:1..7918),gap(20),
CO   complement(AAHY01103882.1:1..9213),gap(1399),
CO   complement(AAHY01103883.1:1..1037),gap(220),AAHY01103884.1:1..18981,
CO   gap(201),complement(AAHY01103885.1:1..5162),gap(20),
CO   AAHY01103886.1:1..32602,gap(534),complement(AAHY01103887.1:1..29135),
CO   gap(20),AAHY01103888.1:1..1175,gap(20),AAHY01103889.1:1..79288,gap(157),
CO   complement(AAHY01103890.1:1..6690),gap(37),
CO   complement(AAHY01103891.1:1..5980),gap(119),
CO   complement(AAHY01103892.1:1..47726),gap(155),AAHY01103893.1:1..7918,
CO   gap(513),AAHY01103894.1:1..45049,gap(20),AAHY01103895.1:1..1135,gap(20),
CO   complement(AAHY01103896.1:1..8850),gap(53),AAHY01103897.1:1..57644,gap(30),
CO   AAHY01103898.1:1..5634,gap(20),complement(AAHY01103899.1:1..1027),gap(20),
CO   AAHY01103900.1:1..15078,gap(141),complement(AAHY01103901.1:1..2547),
CO   gap(20),AAHY01103902.1:1..46266,gap(314),AAHY01103903.1:1..19360,gap(20),
CO   AAHY01103904.1:1..1199,gap(20),AAHY01103905.1:1..12522,gap(69),
CO   AAHY01103906.1:1..7445,gap(55),AAHY01103907.1:1..9290,gap(20),
CO   AAHY01103908.1:1..78260,gap(269),AAHY01103909.1:1..7489,gap(20),
CO   AAHY01103910.1:1..14669,gap(20),AAHY01103911.1:1..16679,gap(4177),
CO   AAHY01103912.1:1..8785,gap(20),AAHY01103913.1:1..1930,gap(20),
CO   AAHY01103914.1:1..9082,gap(20),AAHY01103915.1:1..6510,gap(270),
CO   AAHY01103916.1:1..9699,gap(20),AAHY01103917.1:1..10919,gap(3593),
CO   AAHY01103918.1:1..2093,gap(20),complement(AAHY01103919.1:1..1080),gap(831),
CO   AAHY01103920.1:1..1914,gap(702),AAHY01103921.1:1..24325,gap(286),
CO   AAHY01103922.1:1..57704,gap(230),AAHY01103923.1:1..3463,gap(269),
CO   AAHY01103924.1:1..4187,gap(20),AAHY01103925.1:1..2533,gap(76),
CO   AAHY01103926.1:1..22995,gap(261),AAHY01103927.1:1..16464,gap(167),
CO   AAHY01103928.1:1..996,gap(34),AAHY01103929.1:1..17957,gap(20),
CO   complement(AAHY01103930.1:1..1262),gap(20),
CO   complement(AAHY01103931.1:1..1082),gap(20),AAHY01103932.1:1..24631,gap(20),
CO   AAHY01103933.1:1..6728,gap(2276),AAHY01103934.1:1..4298,gap(145),
CO   AAHY01103935.1:1..21083,gap(20),AAHY01103936.1:1..14335,gap(20),
CO   AAHY01103937.1:1..1620,gap(20),AAHY01103938.1:1..11690,gap(20),
CO   AAHY01103939.1:1..15240,gap(20),AAHY01103940.1:1..22592,gap(524),
CO   AAHY01103941.1:1..1454,gap(79),AAHY01103942.1:1..8507,gap(64),
CO   AAHY01103943.1:1..12590,gap(59),AAHY01103944.1:1..15711,gap(20),
CO   complement(AAHY01103945.1:1..1737),gap(20),AAHY01103946.1:1..7732,gap(20),
CO   AAHY01103947.1:1..11034,gap(78),AAHY01103948.1:1..12937,gap(20),
CO   complement(AAHY01103949.1:1..28790),gap(20),AAHY01103950.1:1..19873,
CO   gap(1913),AAHY01103951.1:1..10584,gap(20),AAHY01103952.1:1..8847,gap(20),
CO   AAHY01103953.1:1..10321,gap(102),AAHY01103954.1:1..1426,gap(20),
CO   AAHY01103955.1:1..23695,gap(3757),complement(AAHY01103956.1:1..988),
CO   gap(244),AAHY01103957.1:1..13936,gap(4670),AAHY01103958.1:1..8291,gap(68),
CO   complement(AAHY01103959.1:1..14235),gap(263),AAHY01103960.1:1..5525,
CO   gap(20),AAHY01103961.1:1..35071,gap(156),
CO   complement(AAHY01103962.1:1..1343),gap(20),AAHY01103963.1:1..108651,
CO   gap(39),AAHY01103964.1:1..9113,gap(166),AAHY01103965.1:1..38559,gap(94),
CO   AAHY01103966.1:1..115248,gap(2833),AAHY01103967.1:1..4222,gap(706),
CO   complement(AAHY01103968.1:1..706),gap(20),
CO   complement(AAHY01103969.1:1..52804),gap(20),AAHY01103970.1:1..33050,
CO   gap(57),complement(AAHY01103971.1:1..36224),gap(221),
CO   complement(AAHY01103972.1:1..3584),gap(20),
CO   complement(AAHY01103973.1:1..19539),gap(60),AAHY01103974.1:1..11114,
CO   gap(298),complement(AAHY01103975.1:1..10053),gap(115),
CO   complement(AAHY01103976.1:1..32692),gap(20),AAHY01103977.1:1..59560,
CO   gap(335),complement(AAHY01103978.1:1..98622),gap(732),
CO   AAHY01103979.1:1..45113,gap(20),complement(AAHY01103980.1:1..7715),
CO   gap(1072),complement(AAHY01103981.1:1..56623),gap(20),
CO   AAHY01103982.1:1..27150,gap(20),complement(AAHY01103983.1:1..12355),
CO   gap(20),complement(AAHY01103984.1:1..19094),gap(20),
CO   complement(AAHY01103985.1:1..12632),gap(41),AAHY01103986.1:1..6708,
CO   gap(123),AAHY01103987.1:1..8567,gap(107),
CO   complement(AAHY01103988.1:1..23481),gap(93),
CO   complement(AAHY01103989.1:1..6043),gap(330),
CO   complement(AAHY01103990.1:1..418),gap(608),
CO   complement(AAHY01103991.1:1..53046),gap(20),AAHY01103992.1:1..4181,gap(20),
CO   complement(AAHY01103993.1:1..1373),gap(3100),AAHY01103994.1:1..26215,
CO   gap(20),complement(AAHY01103995.1:1..28794),gap(729),
CO   AAHY01103996.1:1..22489,gap(84),AAHY01103997.1:1..28652,gap(20),
CO   AAHY01103998.1:1..1571,gap(246),complement(AAHY01103999.1:1..1856),gap(91),
CO   complement(AAHY01104000.1:1..7734),gap(40),AAHY01104001.1:1..69952,
CO   gap(264),AAHY01104002.1:1..4716,gap(223),
CO   complement(AAHY01104003.1:1..12562),gap(20),AAHY01104004.1:1..50913,
CO   gap(20),AAHY01104005.1:1..41193,gap(2651),AAHY01104006.1:1..3421,gap(20),
CO   AAHY01104007.1:1..5149,gap(184),AAHY01104008.1:1..42029,gap(822),
CO   AAHY01104009.1:1..21853,gap(288),AAHY01104010.1:1..8728,gap(606),
CO   AAHY01104011.1:1..4185,gap(20),AAHY01104012.1:1..13636,gap(20),
CO   complement(AAHY01104013.1:1..2234),gap(67),
CO   complement(AAHY01104014.1:1..9917),gap(20),
CO   complement(AAHY01104015.1:1..5734),gap(20),AAHY01104016.1:1..14620,gap(24),
CO   AAHY01104017.1:1..32358,gap(5641),AAHY01104018.1:1..18992,gap(227),
CO   AAHY01104019.1:1..2511,gap(20),AAHY01104020.1:1..6356,gap(20),
CO   complement(AAHY01104021.1:1..5880),gap(149),AAHY01104022.1:1..2186,gap(20),
CO   complement(AAHY01104023.1:1..8955),gap(80),
CO   complement(AAHY01104024.1:1..5608),gap(59),AAHY01104025.1:1..3672,
CO   gap(2358),AAHY01104026.1:1..5533,gap(108),AAHY01104027.1:1..23950,gap(20),
CO   AAHY01104028.1:1..990,gap(310),AAHY01104029.1:1..12633,gap(21260),
CO   complement(AAHY01104030.1:1..1288),gap(20),
CO   complement(AAHY01104031.1:1..6402),gap(381),AAHY01104032.1:1..6453,
CO   gap(171),AAHY01104033.1:1..6483,gap(20),AAHY01104034.1:1..23693,gap(363),
CO   AAHY01104035.1:1..10727,gap(20),AAHY01104036.1:1..27725,gap(20),
CO   AAHY01104037.1:1..44888,gap(704),AAHY01104038.1:1..9481,gap(928),
CO   AAHY01104039.1:1..20320,gap(20),complement(AAHY01104040.1:1..1075),
CO   gap(202),complement(AAHY01104041.1:1..33370),gap(850),
CO   AAHY01104042.1:1..4220,gap(1889),complement(AAHY01104043.1:1..5556),
CO   gap(20),AAHY01104044.1:1..38817,gap(354),
CO   complement(AAHY01104045.1:1..8189),gap(69),
CO   complement(AAHY01104046.1:1..50339),gap(1815),
CO   complement(AAHY01104047.1:1..1405),gap(25),
CO   complement(AAHY01104048.1:1..1631),gap(20),AAHY01104049.1:1..1518,gap(20),
CO   AAHY01104050.1:1..2886,gap(1229),AAHY01104051.1:1..9287,gap(20),
CO   AAHY01104052.1:1..56072,gap(3259),complement(AAHY01104053.1:1..14817),
CO   gap(76),AAHY01104054.1:1..67657,gap(1735),AAHY01104055.1:1..11160,gap(515),
CO   AAHY01104056.1:1..48266,gap(146),AAHY01104057.1:1..54661,gap(20),
CO   AAHY01104058.1:1..9320,gap(601),AAHY01104059.1:1..47351,gap(43),
CO   AAHY01104060.1:1..15088,gap(145),AAHY01104061.1:1..12306,gap(20),
CO   AAHY01104062.1:1..5078,gap(284),AAHY01104063.1:1..19086,gap(20),
CO   AAHY01104064.1:1..8777,gap(20),complement(AAHY01104065.1:1..21149),gap(20),
CO   complement(AAHY01104066.1:1..29839),gap(291),
CO   complement(AAHY01104067.1:1..1853),gap(161),
CO   complement(AAHY01104068.1:1..69673),gap(570),AAHY01104069.1:1..36959,
CO   gap(591),complement(AAHY01104070.1:1..13584),gap(20),
CO   AAHY01104071.1:1..1675,gap(20),complement(AAHY01104072.1:1..23350),
CO   gap(469),complement(AAHY01104073.1:1..1920),gap(24),
CO   complement(AAHY01104074.1:1..16278),gap(20),AAHY01104075.1:1..8205,gap(20),
CO   AAHY01104076.1:1..68707,gap(77),AAHY01104077.1:1..14861,gap(20),
CO   complement(AAHY01104078.1:1..25930),gap(20),AAHY01104079.1:1..25241,
CO   gap(1988),AAHY01104080.1:1..57310,gap(386),
CO   complement(AAHY01104081.1:1..10682),gap(20),AAHY01104082.1:1..5637,gap(20),
CO   AAHY01104083.1:1..12930,gap(691),AAHY01104084.1:1..3699,gap(367),
CO   AAHY01104085.1:1..50346,gap(2047),AAHY01104086.1:1..6751,gap(700),
CO   AAHY01104087.1:1..80318,gap(103),AAHY01104088.1:1..1851,gap(220),
CO   AAHY01104089.1:1..12088,gap(20),complement(AAHY01104090.1:1..58556),
CO   gap(20),complement(AAHY01104091.1:1..6202),gap(20),
CO   complement(AAHY01104092.1:1..18146),gap(30),
CO   complement(AAHY01104093.1:1..26010),gap(1914),AAHY01104094.1:1..7164,
CO   gap(20),complement(AAHY01104095.1:1..18327),gap(20),
CO   complement(AAHY01104096.1:1..10382),gap(152),
CO   complement(AAHY01104097.1:1..14047),gap(20),
CO   complement(AAHY01104098.1:1..25189),gap(20),
CO   complement(AAHY01104099.1:1..15258),gap(20),AAHY01104100.1:1..15789,
CO   gap(26),complement(AAHY01104101.1:1..9198),gap(342),
CO   AAHY01104102.1:1..46849,gap(74),complement(AAHY01104103.1:1..6612),gap(20),
CO   complement(AAHY01104104.1:1..13549),gap(283),AAHY01104105.1:1..7976,
CO   gap(2119),complement(AAHY01104106.1:1..13808),gap(20),
CO   AAHY01104107.1:1..8338,gap(20),AAHY01104108.1:1..73014,gap(190),
CO   AAHY01104109.1:1..12488,gap(662),AAHY01104110.1:1..756,gap(65),
CO   AAHY01104111.1:1..66137,gap(20),AAHY01104112.1:1..21202,gap(267),
CO   complement(AAHY01104113.1:1..5846),gap(20),
CO   complement(AAHY01104114.1:1..1830),gap(20),
CO   complement(AAHY01104115.1:1..10873),gap(314),
CO   complement(AAHY01104116.1:1..5822),gap(274),
CO   complement(AAHY01104117.1:1..4562),gap(385),
CO   complement(AAHY01104118.1:1..30711),gap(153),AAHY01104119.1:1..11081,
CO   gap(20),AAHY01104120.1:1..3575,gap(59),complement(AAHY01104121.1:1..33150),
CO   gap(20),AAHY01104122.1:1..22328,gap(444),
CO   complement(AAHY01104123.1:1..8161),gap(82),AAHY01104124.1:1..10323,gap(20),
CO   AAHY01104125.1:1..23516,gap(326),complement(AAHY01104126.1:1..29792),
CO   gap(536),complement(AAHY01104127.1:1..3308),gap(20),AAHY01104128.1:1..1454,
CO   gap(95),complement(AAHY01104129.1:1..2183),gap(3650),
CO   AAHY01104130.1:1..1152,gap(20),AAHY01104131.1:1..2785,gap(20),
CO   AAHY01104132.1:1..2894,gap(334),complement(AAHY01104133.1:1..7930),gap(20),
CO   complement(AAHY01104134.1:1..18135),gap(187),
CO   complement(AAHY01104135.1:1..7249),gap(108),AAHY01104136.1:1..3001,
CO   gap(2815),AAHY01104137.1:1..40831,gap(20),AAHY01104138.1:1..37066,
CO   gap(1087),AAHY01104139.1:1..8515,gap(414),AAHY01104140.1:1..12193,gap(20),
CO   complement(AAHY01104141.1:1..16693),gap(20),
CO   complement(AAHY01104142.1:1..3206),gap(20),
CO   complement(AAHY01104143.1:1..9906),gap(458),
CO   complement(AAHY01104144.1:1..1396),gap(5743),AAHY01104145.1:1..4519,
CO   gap(4154),complement(AAHY01104146.1:1..27471),gap(748),
CO   AAHY01104147.1:1..21686,gap(725),complement(AAHY01104148.1:1..17546),
CO   gap(73),AAHY01104149.1:1..3256,gap(152),complement(AAHY01104150.1:1..1792),
CO   gap(349),AAHY01104151.1:1..36319,gap(20),AAHY01104152.1:1..13471,gap(20),
CO   AAHY01104153.1:1..4488,gap(111),AAHY01104154.1:1..4508,gap(606),
CO   AAHY01104155.1:1..96006,gap(320),AAHY01104156.1:1..25691,gap(33),
CO   AAHY01104157.1:1..5119,gap(363),AAHY01104158.1:1..2997,gap(348),
CO   AAHY01104159.1:1..15174,gap(153),AAHY01104160.1:1..14558,gap(204),
CO   AAHY01104161.1:1..21583,gap(178),AAHY01104162.1:1..120824,gap(20),
CO   AAHY01104163.1:1..36683,gap(1534),AAHY01104164.1:1..15050,gap(20),
CO   AAHY01104165.1:1..7324,gap(1185),AAHY01104166.1:1..13264,gap(594),
CO   AAHY01104167.1:1..38073,gap(1671),AAHY01104168.1:1..10632,gap(20),
CO   AAHY01104169.1:1..3431,gap(309),AAHY01104170.1:1..78912,gap(410),
CO   AAHY01104171.1:1..4001,gap(136),AAHY01104172.1:1..8254,gap(20),
CO   AAHY01104173.1:1..14426,gap(178),AAHY01104174.1:1..9970,gap(20),
CO   complement(AAHY01104175.1:1..33740),gap(20),AAHY01104176.1:1..1021,gap(20),
CO   complement(AAHY01104177.1:1..21467),gap(210),AAHY01104178.1:1..64976,
CO   gap(192),complement(AAHY01104179.1:1..9206),gap(64),
CO   complement(AAHY01104180.1:1..1557),gap(20),
CO   complement(AAHY01104181.1:1..4621),gap(20),
CO   complement(AAHY01104182.1:1..5418),gap(40),AAHY01104183.1:1..22123,
CO   gap(193),complement(AAHY01104184.1:1..7347),gap(20),
CO   AAHY01104185.1:1..17826,gap(20),AAHY01104186.1:1..1834,gap(1925),
CO   AAHY01104187.1:1..16876,gap(3630),complement(AAHY01104188.1:1..7752),
CO   gap(20),complement(AAHY01104189.1:1..18569),gap(404),
CO   AAHY01104190.1:1..5251,gap(184),AAHY01104191.1:1..3315,gap(20),
CO   complement(AAHY01104192.1:1..1174),gap(20),
CO   complement(AAHY01104193.1:1..12532),gap(58),AAHY01104194.1:1..15946,
CO   gap(199),complement(AAHY01104195.1:1..2290),gap(262),
CO   AAHY01104196.1:1..18956,gap(20),AAHY01104197.1:1..15931,gap(26),
CO   AAHY01104198.1:1..17393,gap(65),AAHY01104199.1:1..39321,gap(39),
CO   AAHY01104200.1:1..27424,gap(66),AAHY01104201.1:1..11993,gap(164),
CO   complement(AAHY01104202.1:1..11534),gap(183),AAHY01104203.1:1..8139,
CO   gap(83),AAHY01104204.1:1..26274,gap(46),AAHY01104205.1:1..16275,gap(20),
CO   AAHY01104206.1:1..35833,gap(20),AAHY01104207.1:1..1125,gap(746),
CO   AAHY01104208.1:1..2462,gap(20),AAHY01104209.1:1..4966,gap(20),
CO   complement(AAHY01104210.1:1..2085),gap(119),AAHY01104211.1:1..8810,
CO   gap(17739),complement(AAHY01104212.1:1..5231),gap(20),
CO   AAHY01104213.1:1..15532,gap(235),AAHY01104214.1:1..1370,gap(339),
CO   AAHY01104215.1:1..84857,gap(20),complement(AAHY01104216.1:1..6481),
CO   gap(1428),AAHY01104217.1:1..11244,gap(505),AAHY01104218.1:1..7068,gap(20),
CO   complement(AAHY01104219.1:1..3223),gap(56),AAHY01104220.1:1..47877,gap(20),
CO   complement(AAHY01104221.1:1..2601),gap(411),
CO   complement(AAHY01104222.1:1..5224),gap(415),AAHY01104223.1:1..431,gap(28),
CO   complement(AAHY01104224.1:1..4362),gap(20),AAHY01104225.1:1..35096,gap(76),
CO   AAHY01104226.1:1..9168,gap(20),AAHY01104227.1:1..27662,gap(20),
CO   AAHY01104228.1:1..27007,gap(39),AAHY01104229.1:1..28458,gap(587),
CO   AAHY01104230.1:1..78361,gap(2669),AAHY01104231.1:1..2026,gap(83),
CO   AAHY01104232.1:1..11350,gap(1201),AAHY01104233.1:1..718,gap(3121),
CO   AAHY01104234.1:1..6662,gap(20),complement(AAHY01104235.1:1..17025),
CO   gap(187),complement(AAHY01104236.1:1..1556),gap(5961),
CO   AAHY01104237.1:1..4818,gap(20),AAHY01104238.1:1..25866,gap(183),
CO   AAHY01104239.1:1..17833,gap(20),AAHY01104240.1:1..14093,gap(20),
CO   AAHY01104241.1:1..28845,gap(20),AAHY01104242.1:1..10589,gap(63),
CO   AAHY01104243.1:1..69597,gap(70),complement(AAHY01104244.1:1..3348),
CO   gap(144),complement(AAHY01104245.1:1..5463),gap(26),
CO   AAHY01104246.1:1..22769,gap(20),AAHY01104247.1:1..12707,gap(237),
CO   AAHY01104248.1:1..2018,gap(810),AAHY01104249.1:1..31366,gap(1336),
CO   AAHY01104250.1:1..2801,gap(20),AAHY01104251.1:1..4235,gap(221),
CO   complement(AAHY01104252.1:1..10446),gap(366),AAHY01104253.1:1..28835,
CO   gap(426),AAHY01104254.1:1..11009,gap(559),AAHY01104255.1:1..40727,gap(20),
CO   AAHY01104256.1:1..45505,gap(20),complement(AAHY01104257.1:1..1548),
CO   gap(11648),AAHY01104258.1:1..8272,gap(147),AAHY01104259.1:1..1218,gap(118),
CO   AAHY01104260.1:1..45103,gap(540),AAHY01104261.1:1..51860,gap(1615),
CO   AAHY01104262.1:1..3064,gap(195),AAHY01104263.1:1..49869,gap(1133),
CO   AAHY01104264.1:1..10886,gap(1518),AAHY01104265.1:1..2004,gap(20),
CO   complement(AAHY01104266.1:1..2378),gap(20),AAHY01104267.1:1..6995,gap(20),
CO   complement(AAHY01104268.1:1..1095),gap(20),AAHY01104269.1:1..18843,gap(70),
CO   AAHY01104270.1:1..25614,gap(164),AAHY01104271.1:1..2420,gap(232),
CO   AAHY01104272.1:1..18701,gap(20),complement(AAHY01104273.1:1..5147),gap(95),
CO   AAHY01104274.1:1..34765,gap(20),AAHY01104275.1:1..1235,gap(20),
CO   AAHY01104276.1:1..19231,gap(20),AAHY01104277.1:1..27455,gap(179),
CO   AAHY01104278.1:1..11270,gap(160),AAHY01104279.1:1..19540,gap(20),
CO   complement(AAHY01104280.1:1..43127),gap(20),
CO   complement(AAHY01104281.1:1..30947),gap(156),
CO   complement(AAHY01104282.1:1..14881),gap(20),AAHY01104283.1:1..7529,gap(29),
CO   AAHY01104284.1:1..10629,gap(1887),complement(AAHY01104285.1:1..29080),
CO   gap(149),complement(AAHY01104286.1:1..12362),gap(20),
CO   complement(AAHY01104287.1:1..25631),gap(66),
CO   complement(AAHY01104288.1:1..11065),gap(20),AAHY01104289.1:1..41138,
CO   gap(20),AAHY01104290.1:1..115572,gap(1094),AAHY01104291.1:1..17457,gap(20),
CO   complement(AAHY01104292.1:1..16306),gap(20),AAHY01104293.1:1..22479,
CO   gap(20),complement(AAHY01104294.1:1..1093),gap(20),
CO   complement(AAHY01104295.1:1..1210),gap(20),AAHY01104296.1:1..1853,gap(20),
CO   AAHY01104297.1:1..1054,gap(20),AAHY01104298.1:1..40046,gap(211),
CO   AAHY01104299.1:1..20611,gap(49),complement(AAHY01104300.1:1..5684),gap(20),
CO   AAHY01104301.1:1..27608,gap(160),AAHY01104302.1:1..41936,gap(732),
CO   AAHY01104303.1:1..798,gap(20),AAHY01104304.1:1..13168,gap(65),
CO   AAHY01104305.1:1..20670,gap(727),AAHY01104306.1:1..48860,gap(20),
CO   complement(AAHY01104307.1:1..8704),gap(20),AAHY01104308.1:1..9843,gap(242),
CO   AAHY01104309.1:1..41373,gap(109),AAHY01104310.1:1..8173,gap(20),
CO   AAHY01104311.1:1..1722,gap(20),complement(AAHY01104312.1:1..10410),gap(20),
CO   AAHY01104313.1:1..16191,gap(51),AAHY01104314.1:1..3282,gap(57),
CO   complement(AAHY01104315.1:1..37246),gap(20),AAHY01104316.1:1..23777,
CO   gap(20),AAHY01104317.1:1..18103,gap(128),AAHY01104318.1:1..4848,gap(253),
CO   complement(AAHY01104319.1:1..10550),gap(60),AAHY01104320.1:1..7013,
CO   gap(110),AAHY01104321.1:1..7166,gap(20),complement(AAHY01104322.1:1..8262),
CO   gap(20),AAHY01104323.1:1..24984,gap(20),complement(AAHY01104324.1:1..1211),
CO   gap(20),AAHY01104325.1:1..18560,gap(20),AAHY01104326.1:1..11824,gap(50),
CO   AAHY01104327.1:1..21683,gap(20),complement(AAHY01104328.1:1..8914),gap(23),
CO   complement(AAHY01104329.1:1..7754),gap(20),
CO   complement(AAHY01104330.1:1..63533),gap(141),AAHY01104331.1:1..1550,
CO   gap(20),complement(AAHY01104332.1:1..36870),gap(203),
CO   complement(AAHY01104333.1:1..15922),gap(103),
CO   complement(AAHY01104334.1:1..1720),gap(20),
CO   complement(AAHY01104335.1:1..2867),gap(58),AAHY01104336.1:1..67070,gap(78),
CO   AAHY01104337.1:1..25875,gap(20),complement(AAHY01104338.1:1..5720),
CO   gap(291),complement(AAHY01104339.1:1..2825),gap(101),
CO   AAHY01104340.1:1..11224)
//


spacer
spacer