Dbfetch

ID   CH466578; SV 1; linear; genomic DNA; CON; MUS; 12274004 BP.
XX
AC   CH466578;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009794191 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-12274004
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-12274004
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 6de832268e1b1e33640f6eecc1733a60.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000218.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000711; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002147; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002578; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006728; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019467; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020102; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020115; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020123; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020124; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020218; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020224; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020227; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020228; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025348; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025350; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025351; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025359; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025362; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025364; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025402; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025407; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025410; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025432; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040249; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040258; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042801; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044025; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044293; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044897; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045559; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046041; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047090; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047492; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047626; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047631; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047868; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048015; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048745; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049052; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049217; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049573; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049894; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050198; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050251; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050478; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051236; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051716; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052818; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054052; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056148; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056853; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058251; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058396; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058513; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059762; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061367; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061961; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062914; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063173; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063374; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069421; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069430; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069456; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000070601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071065; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000080115; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000089789; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090841; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000092048; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000092162; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000093866; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094347; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095002; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095075; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095138; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095401; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095483; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095696; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095804; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096220; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096497; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096858; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107662; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017771; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017772; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017776; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017779; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017783; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017789; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017792; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017793; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017794; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017796; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017798; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017800; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017801; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017804; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017810; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017814; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017819; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017820; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017826; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017827; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017828; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017829; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017834; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017854; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017855; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017867; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017872; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017874; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017875; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017878; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017879; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017882; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017883; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017886; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017888; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017889; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017891; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017893; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017897; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017898; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017899; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017900; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017902; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017905; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017906; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017907; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017908; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017910; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017911; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017914; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017915; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017916; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017917; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017919; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017922; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017923; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017924; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017925; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017926; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017927; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017928; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017929; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017930; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017932; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017933; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017934; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017935; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017938; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017939; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017942; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017943; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017944; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017947; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017948; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024987; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017746; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017747; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017751; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017752; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017754; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017758; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017764; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017767; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017768; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017769; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017771; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017773; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017775; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017776; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017785; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017789; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017794; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017795; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017801; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017802; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017803; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017804; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017809; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017814; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017829; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017830; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017842; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017847; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017849; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017850; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017853; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017854; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017857; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017858; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017861; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017863; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017864; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017866; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017868; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017869; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017870; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017871; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017872; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017875; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017876; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017877; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017878; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017879; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017880; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017882; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017883; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017886; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017887; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017888; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017889; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017892; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017893; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017894; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017895; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017896; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017897; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017898; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017899; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017900; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017902; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017903; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017904; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017906; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017907; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017908; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017911; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017912; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017913; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017914; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017917; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017918; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024964; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017709; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017710; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017714; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017717; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017721; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017727; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017730; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017731; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017732; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017734; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017736; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017738; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017739; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017742; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017748; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017752; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017757; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017758; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017764; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017765; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017766; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017767; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017772; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017776; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017777; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017792; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017793; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017805; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017810; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017812; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017813; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017815; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017816; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017817; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017820; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017821; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017824; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017826; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017829; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017831; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017832; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017833; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017834; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017835; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017836; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017839; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017840; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017841; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017842; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017844; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017845; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017846; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017849; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017850; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017851; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017852; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017855; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017856; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017857; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017858; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017859; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017860; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017861; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017864; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017865; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017866; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017867; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017870; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017871; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017874; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017875; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017876; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017877; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017881; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017882; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0024934; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017710; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017711; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017715; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017716; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017718; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017722; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017728; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017731; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017732; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017733; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017735; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017737; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017739; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017740; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017743; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017749; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017753; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017758; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017759; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017765; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017766; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017767; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017768; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017773; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017778; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017793; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017794; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017806; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017811; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017813; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017814; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017816; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017817; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017818; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017821; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017822; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017825; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017827; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017832; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017833; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017834; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017835; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017836; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017837; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017838; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017839; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017840; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017841; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017842; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017843; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017844; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017845; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017846; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017848; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017850; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017852; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017855; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017856; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017857; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017858; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017862; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017863; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017864; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017865; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017866; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017867; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017871; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017872; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017873; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017874; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017875; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017876; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017880; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017881; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017882; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017883; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017887; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017888; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017891; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024963; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017534; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017535; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017539; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017542; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017546; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017552; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017555; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017556; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017557; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017559; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017561; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017563; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017564; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017567; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017573; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017577; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017582; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017583; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017589; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017590; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017591; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017592; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017597; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017600; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017602; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017616; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017617; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017629; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017634; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017636; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017637; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017639; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017640; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017641; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017644; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017645; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017648; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017650; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017653; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017655; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017656; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017657; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017658; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017659; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017660; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017661; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017662; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017663; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017664; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017665; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017667; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017669; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017670; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017671; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017675; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017676; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017677; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017680; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017681; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017682; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017683; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017684; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017685; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017686; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017688; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017689; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017690; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017691; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017692; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017693; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017696; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017697; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017698; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017699; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017702; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017703; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018165; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018166; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018170; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018173; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018177; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018183; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018186; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018187; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018188; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018190; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018192; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018194; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018195; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018198; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018204; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018208; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018213; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018214; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018220; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018222; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018223; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018228; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018233; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018248; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018249; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018261; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018266; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018268; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018269; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018272; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018273; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018276; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018277; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018280; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018282; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018285; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018287; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018288; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018291; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018292; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018293; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018294; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018295; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018298; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018299; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018300; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018301; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018303; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018304; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018305; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018308; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018309; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018311; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018312; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018315; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018316; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018317; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018318; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018320; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018321; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018322; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018323; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018324; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018326; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018327; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018328; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018329; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018330; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018332; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018333; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018336; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018337; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018338; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018342; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018343; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017095; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017096; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017099; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017100; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017102; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017106; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017112; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017115; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017116; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017117; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017119; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017121; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017123; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017124; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017127; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017133; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017137; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017142; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017143; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017149; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017150; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017151; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017152; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017157; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017158; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017177; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017178; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017190; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017195; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017197; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017198; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017200; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017201; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017202; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017205; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017206; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017214; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017220; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017221; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017222; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017223; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017224; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017225; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017228; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017229; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017230; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017233; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017234; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017238; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017239; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017240; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017243; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017244; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017245; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017246; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017247; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017248; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017249; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017250; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017251; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017252; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017253; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017254; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017258; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017262; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017265; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017266; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017503; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017504; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017508; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017511; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017515; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017521; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017524; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017525; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017526; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017528; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017530; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017532; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017533; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017536; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017542; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017546; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017551; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017552; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017558; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017559; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017560; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017561; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017566; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017567; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017571; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017586; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017587; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017599; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017604; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017606; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017607; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017609; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017610; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017611; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017614; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017615; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017618; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017620; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017621; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017623; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017625; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017626; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017627; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017628; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017629; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017630; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017631; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017632; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017633; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017634; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017635; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017636; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017637; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017639; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017640; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017641; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017645; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017647; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017648; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017651; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017652; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017653; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017654; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017655; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017656; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017657; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017661; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017662; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017663; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017664; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017665; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017666; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017668; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017669; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017670; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017671; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017675; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017676; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017609; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017610; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017614; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017617; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017621; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017630; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017631; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017632; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017634; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017636; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017638; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017639; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017642; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017648; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017652; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017657; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017658; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017664; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017666; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017667; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017672; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017673; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017675; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017676; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017677; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017692; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017693; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017710; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017712; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017713; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017715; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017716; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017717; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017720; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017721; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017724; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017726; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017729; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017731; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017734; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017735; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017736; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017737; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017739; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017742; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017743; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017744; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017745; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017746; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017748; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017749; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017752; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017753; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017755; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017756; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017759; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017760; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017761; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017762; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017763; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017764; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017765; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017766; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017767; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017770; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017771; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017772; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017773; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017775; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017776; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017779; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017780; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017781; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017782; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017785; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017786; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017604; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017609; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017610; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017612; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017616; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017622; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017625; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017626; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017627; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017629; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017631; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017633; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017634; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017637; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017643; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017647; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017652; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017653; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017659; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017660; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017661; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017667; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017668; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017672; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017687; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017688; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017700; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017705; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017707; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017708; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017710; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017711; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017712; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017715; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017716; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017719; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017721; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017724; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017726; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017727; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017730; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017731; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017732; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017733; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017735; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017736; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017737; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017738; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017739; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017740; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017742; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017743; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017744; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017747; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017748; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017749; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017750; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017754; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017755; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017756; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017757; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017758; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017759; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017760; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017762; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017763; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017764; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017767; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017768; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017771; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017772; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017773; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017774; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017777; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017778; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017683; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017684; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017688; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017691; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017695; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017701; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017704; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017705; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017706; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017708; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017710; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017712; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017713; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017716; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017722; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017726; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017731; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017732; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017738; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017739; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017740; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017741; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017746; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017747; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017749; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017751; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017766; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017767; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017779; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017784; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017786; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017787; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017790; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017791; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017794; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017795; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017798; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017800; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017803; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017805; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017806; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017807; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017808; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017809; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017810; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017811; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017812; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017813; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017814; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017815; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017816; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017817; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017818; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017819; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017821; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017822; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017825; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017826; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017828; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017829; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017830; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017833; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017834; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017835; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017836; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017837; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017838; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017839; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017840; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017842; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017843; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017844; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017846; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017847; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017849; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017850; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017852; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017853; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017854; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017855; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017857; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017858; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017633; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017634; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017638; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017639; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017641; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017645; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017653; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017654; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017655; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017657; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017659; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017661; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017662; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017665; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017671; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017675; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017680; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017681; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017687; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017688; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017689; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017690; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017695; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017700; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017715; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017716; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017728; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017733; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017736; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017738; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017739; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017740; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017743; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017744; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017747; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017749; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017750; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017752; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017754; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017755; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017758; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017759; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017760; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017761; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017764; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017765; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017766; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017767; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017768; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017769; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017771; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017772; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017773; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017774; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017778; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017780; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017781; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017782; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017786; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017787; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017788; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017792; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017793; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017794; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017797; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017798; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017800; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017801; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017802; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017803; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017806; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017807; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018206; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018207; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018210; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018213; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018217; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018223; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018226; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018227; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018228; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018230; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018232; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018234; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018235; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018238; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018244; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018248; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018253; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018254; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018260; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018261; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018262; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018263; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018268; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018269; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018272; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018273; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018288; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018289; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018301; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018306; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018308; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018309; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018311; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018312; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018313; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018316; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018317; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018320; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018322; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018325; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018327; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018329; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018330; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018331; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018333; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018336; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018337; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018338; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018339; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018340; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018341; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018342; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018344; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018345; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018346; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018349; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018350; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018352; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018353; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018356; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018357; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018358; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018360; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018361; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018362; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018363; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018365; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018366; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018367; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018368; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018369; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018371; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018372; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018373; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018374; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018378; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018379; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016879; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016880; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016884; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016885; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016887; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016891; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016897; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016900; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016901; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016902; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016904; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016906; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016908; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016909; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016912; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016918; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016922; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016927; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016928; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016934; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016935; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016936; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016937; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016942; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016943; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016947; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016962; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016963; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016975; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016980; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016982; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016983; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016985; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016986; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016987; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016990; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016991; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016994; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016996; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016999; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017005; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017006; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017007; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017008; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017010; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017011; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017012; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017013; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017015; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017019; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017020; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017021; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017025; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017026; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017027; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017028; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017029; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017030; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017032; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017033; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017034; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017035; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017038; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017039; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017040; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017045; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017046; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017155; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017156; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017160; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017161; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017163; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017167; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017173; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017176; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017177; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017178; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017180; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017182; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017184; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017185; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017188; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017194; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017198; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017203; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017204; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017210; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017211; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017212; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017213; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017218; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017221; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017236; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017237; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017249; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017254; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017256; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017257; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017259; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017260; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017261; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017264; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017265; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017268; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017270; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017273; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017275; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017276; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017277; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017278; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017279; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017280; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017283; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017284; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017285; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017287; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017288; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017290; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017291; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017292; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017296; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017297; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017298; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017301; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017302; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017303; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017304; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017306; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017307; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017308; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017309; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017311; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017312; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017313; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017318; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017319; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006911; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019611; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020323; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020439; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020448; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020449; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026415; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026420; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026474; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026479; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026500; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050756; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052652; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054364; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056396; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059891; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059957; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060636; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063031; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064893; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071605; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074308; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074713; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076437; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076508; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077024; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077312; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077836; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078876; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078914; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082131; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082342; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000091996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092143; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094502; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095245; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097164; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116231; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130198; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168520; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203887; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204108; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204250; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204529; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204573; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204712; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204979; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205013; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210780; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211781; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213222; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213239; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213294; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213329; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213438; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213512; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213579; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213742; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213970; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214878; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214917; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215453; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215527; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215791; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216067; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216794; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216906; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216966; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217219; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217283; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000218722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000218901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219317; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000220377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000223162; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027217; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027220; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027236; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027242; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027248; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027269; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027281; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027282; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027286; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027290; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027301; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027302; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027310; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027326; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027337; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027355; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027356; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027385; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027386; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027396; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027401; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027415; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027483; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027511; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027521; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027525; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027526; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027536; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027538; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027542; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027543; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027548; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027550; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027553; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027565; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027567; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027571; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027572; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027573; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027577; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027579; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027582; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027584; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027585; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027587; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027589; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027591; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027594; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027595; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027596; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027598; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027601; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027605; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027606; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027611; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027613; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027614; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027615; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027617; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027618; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027620; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027623; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027624; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027625; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027627; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027630; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027631; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027635; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027636; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027638; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027641; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027642; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051368; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027186; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027189; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027206; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027207; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027212; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027218; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027239; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027251; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027252; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027253; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027256; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027259; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027270; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027271; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027295; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027305; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027323; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027324; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027353; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027354; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027364; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027369; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027383; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027389; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027448; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027449; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027477; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027492; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027496; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027497; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027508; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027510; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027514; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027515; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027520; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027522; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027524; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027536; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027538; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027539; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027540; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027541; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027545; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027548; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027549; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027550; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027551; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027553; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027554; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027557; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027559; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027562; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027563; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027564; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027566; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027570; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027571; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027574; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027576; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027577; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027578; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027580; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027582; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027583; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027586; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027587; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027588; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027591; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027592; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027593; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027597; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027598; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027600; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027601; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027604; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0027605; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0051387; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027159; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027162; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027181; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027187; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027193; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027214; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027226; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027227; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027228; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027231; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027234; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027245; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027246; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027254; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027269; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027280; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027298; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027299; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027324; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027325; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027335; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027340; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027354; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027359; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027362; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027419; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027420; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027448; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027457; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027461; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027462; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027471; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027472; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027474; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027478; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027479; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027484; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027486; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027502; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027503; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027504; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027505; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027509; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027510; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027513; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027515; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027516; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027518; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027520; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027522; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027523; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027526; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027527; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027528; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027534; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027537; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027539; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027540; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027543; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027545; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027546; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027551; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027552; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027553; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027555; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027558; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027559; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027563; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027564; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027566; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027567; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027572; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0027573; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0051336; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027164; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027167; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027183; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027184; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027189; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027195; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027217; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027229; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027230; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027231; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027234; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027238; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027249; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027250; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027259; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027275; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027286; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027304; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027305; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027333; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027334; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027344; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027349; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027363; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027426; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027427; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027455; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027470; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027474; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027475; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027484; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027485; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027487; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027491; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027492; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027497; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027499; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027513; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027515; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027516; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027517; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027518; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027519; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027520; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027521; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027525; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027526; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027527; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027529; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027530; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027531; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027533; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027534; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027537; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027539; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027542; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027545; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027546; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027547; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027549; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027555; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027557; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027558; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027560; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027561; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027562; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027568; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027569; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027570; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027572; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027574; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027575; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027580; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027581; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027583; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027584; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027589; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027590; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027593; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051332; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026970; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026973; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026992; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026998; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027004; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027025; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027037; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027038; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027039; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027042; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027045; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027056; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027057; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027082; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027093; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027111; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027112; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027141; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027142; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027152; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027157; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027171; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027174; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027177; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027234; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027235; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027278; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027282; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027283; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027292; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027293; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027295; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027300; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027301; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027306; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027308; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027322; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027324; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027325; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027326; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027330; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027331; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027332; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027333; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027335; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027337; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027338; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027339; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027343; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027345; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027347; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027348; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027352; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027353; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027355; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027359; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027362; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027364; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027365; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027367; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027369; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027370; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027374; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027375; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027376; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027378; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027380; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027381; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027385; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027386; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027388; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027389; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027392; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027393; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027668; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027671; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027688; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027694; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027700; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027721; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027733; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027734; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027735; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027738; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027742; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027753; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027754; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027761; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027777; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027788; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027806; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027807; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027837; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027848; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027853; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027868; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027876; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027933; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027934; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027963; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027978; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027982; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027983; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027993; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027995; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027998; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027999; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028004; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028006; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028020; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028022; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028023; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028026; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028027; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028028; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028032; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028033; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028036; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028038; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028039; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028041; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028043; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028045; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028046; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028049; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028050; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028052; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028054; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028058; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028061; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028063; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028064; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028066; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028069; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028071; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028072; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028074; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028077; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028078; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028079; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028081; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028082; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028084; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028085; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028089; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028090; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028092; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028096; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028097; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026564; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026567; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026583; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026584; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026589; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026598; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026621; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026633; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026634; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026635; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026639; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026643; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026654; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026655; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026663; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026678; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026689; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026708; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026709; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026738; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026739; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026749; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026755; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026769; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026770; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026833; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026834; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026864; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026873; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026877; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026879; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026888; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026889; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026891; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026896; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026897; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026905; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026919; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026925; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026926; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026927; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026931; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026932; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026933; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026937; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026938; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026939; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026942; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026943; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026947; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026948; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026950; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026955; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026957; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026958; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026959; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026961; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026962; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026964; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026965; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026966; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026968; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026969; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026974; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026975; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026979; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026983; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026984; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026894; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026897; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026916; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026922; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026928; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026949; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026961; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026962; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026963; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026966; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026971; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026982; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026983; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026992; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027009; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027020; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027039; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027068; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027069; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027079; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027084; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027098; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027099; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027106; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027163; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027164; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027192; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027206; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027212; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027221; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027222; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027224; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027229; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027230; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027235; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027237; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027239; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027251; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027254; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027255; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027256; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027257; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027258; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027262; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027263; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027265; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027266; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027267; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027269; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027270; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027272; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027274; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027276; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027277; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027281; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027283; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027285; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027289; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027292; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027294; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027295; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027296; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027299; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027304; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027305; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027308; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027310; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027311; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027314; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027315; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027317; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027318; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027322; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027323; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027021; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027024; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027040; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027046; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027052; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027073; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027085; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027086; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027087; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027090; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027093; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027104; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027105; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027114; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027130; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027141; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027159; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027160; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027190; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027191; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027201; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027206; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027220; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027221; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027223; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027225; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027228; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027286; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027287; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027330; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027334; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027335; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027344; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027345; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027347; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027351; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027352; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027359; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027373; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027375; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027379; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027380; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027384; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027386; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027390; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027392; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027393; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027394; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027396; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027398; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027400; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027403; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027404; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027406; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027408; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027412; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027414; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027417; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027419; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027420; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027422; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027424; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027425; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027427; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027431; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027432; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027433; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027435; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027437; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027438; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027442; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027443; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027445; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027446; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027449; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027450; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027015; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027018; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027036; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027037; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027042; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027048; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027070; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027082; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027083; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027084; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027087; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027102; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027103; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027112; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027125; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027136; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027154; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027155; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027184; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027185; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027195; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027200; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027213; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027214; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027221; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027278; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027279; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027305; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027315; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027319; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027320; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027329; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027330; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027332; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027336; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027338; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027343; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027345; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027359; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027361; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027362; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027365; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027366; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027367; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027371; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027373; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027375; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027376; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027377; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027379; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027380; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027383; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027385; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027386; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027389; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027390; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027391; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027393; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027398; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027400; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027401; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027402; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027404; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027407; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027408; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027412; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027413; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027414; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027418; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027419; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027423; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027424; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027426; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027427; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027431; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027432; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027133; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027136; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027155; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027161; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027167; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027188; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027200; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027201; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027202; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027205; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027210; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027221; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027222; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027231; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027247; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027258; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027276; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027277; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027306; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027307; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027317; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027322; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027336; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027337; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027339; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027344; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027402; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027403; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027431; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027445; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027449; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027450; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027460; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027462; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027465; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027466; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027471; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027473; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027487; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027489; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027490; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027491; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027492; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027493; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027494; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027498; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027500; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027501; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027502; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027504; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027505; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027507; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027508; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027510; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027512; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027515; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027516; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027520; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027522; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027526; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027527; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027532; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027534; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027535; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027536; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027538; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027539; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027542; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027543; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027544; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027548; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027549; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027551; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027552; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027555; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027556; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027558; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027559; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027561; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0027562; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026998; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027001; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027017; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027018; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027023; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027029; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027048; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027060; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027062; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027065; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027069; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027080; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027081; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027090; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027105; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027116; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027134; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027135; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027164; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027165; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027175; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027180; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027195; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027202; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027261; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027262; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027290; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027305; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027311; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027320; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027321; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027323; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027327; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027328; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027333; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027335; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027337; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027349; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027351; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027352; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027355; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027356; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027361; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027364; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027366; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027367; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027369; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027370; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027372; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027374; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027376; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027377; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027378; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027382; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027384; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027386; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027388; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027394; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027395; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027396; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027402; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027403; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027404; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027408; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027409; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027412; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027413; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027414; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027415; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027418; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027419; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027694; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027697; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027712; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027718; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027724; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027745; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027757; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027758; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027759; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027762; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027765; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027777; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027785; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027801; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027812; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027830; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027831; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027860; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027861; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027871; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027876; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027890; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027891; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027896; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027899; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027956; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027957; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027986; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028001; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028005; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028006; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028015; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028016; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028018; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028022; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028023; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028028; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028030; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028044; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028046; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028048; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028049; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028050; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028051; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028055; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028058; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028060; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028061; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028062; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028064; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028065; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028069; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028071; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028072; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028075; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028076; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028078; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028080; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028084; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028087; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028089; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028090; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028091; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028094; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028096; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028097; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028100; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028101; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028102; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028104; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028105; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028108; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028109; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028111; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028112; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028116; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028117; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026268; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026271; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026288; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026289; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026294; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026303; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026326; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026339; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026340; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026343; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026347; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026358; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026359; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026367; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026378; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026391; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026409; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026410; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026439; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026440; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026450; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026455; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026469; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026470; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026476; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026536; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026537; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026566; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026580; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026584; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026585; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026594; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026597; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026601; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026602; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026607; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026609; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026623; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026629; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026630; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026631; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026635; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026637; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026639; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026640; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026641; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026644; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026648; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026649; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026651; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026656; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026657; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026658; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026659; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026660; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026661; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026664; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026665; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026666; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026668; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026672; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026673; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026675; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026680; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026681; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026496; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026499; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026516; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026517; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026522; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026528; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026549; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026561; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026562; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026563; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026566; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026569; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026580; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026581; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026590; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026605; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026615; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026632; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026633; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026662; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026663; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026673; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026678; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026692; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026697; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026752; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026753; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026782; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026797; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026801; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026802; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026811; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026812; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026814; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026818; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026819; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026824; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026826; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026840; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026842; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026843; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026844; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026845; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026846; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026850; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026853; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026854; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026855; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026859; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026861; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026863; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026865; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026866; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026870; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026871; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026873; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026879; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026880; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026881; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026882; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026885; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026886; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026889; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026890; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026893; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026894; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026896; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026902; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026903; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12274004
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(<4072..>79053)
FT                   /locus_tag="mCG_1048748"
FT                   /note="gene_id=mCG1048748.0"
FT   mRNA            complement(join(<4072..4172,10736..10858,73900..73971,
FT                   76923..76957,78836..>79053))
FT                   /locus_tag="mCG_1048748"
FT                   /product="mCG1048748"
FT                   /note="gene_id=mCG1048748.0 transcript_id=mCT166452.0
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(<4072..4172,10736..10858,73900..73971,
FT                   76923..76957,78836..79053))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048748"
FT                   /product="mCG1048748"
FT                   /note="gene_id=mCG1048748.0 transcript_id=mCT166452.0
FT                   protein_id=mCP44586.0"
FT                   /protein_id="EDL24378.1"
FT                   /translation="MANEEPKQGVETEKNGHINSEAADRPVLLCPLRLRGAHEMPVRWA
FT                   TVNETNSPTRLEMEDEDTADVFQRQDRRSLSSSRVCGLEAHKADKPKGCRLAWNGAESM
FT                   AAGDGINILRCQGFSITNDLVREMAMAVSCLQLDAMEGDSAGRAVGGVSHCAMSIPIES
FT                   TTCGGLETPNSSHGSEIPAH"
FT   assembly_gap    6207..6659
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    8448..8801
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    10170..10434
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    11956..12082
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    14586..30517
FT                   /estimated_length=15932
FT                   /gap_type="unknown"
FT   assembly_gap    43013..43105
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            64882..66733
FT                   /pseudo
FT                   /locus_tag="mCG_1048775"
FT                   /note="gene_id=mCG1048775.0"
FT   mRNA            join(64882..65679,65741..66733)
FT                   /pseudo
FT                   /locus_tag="mCG_1048775"
FT                   /note="gene_id=mCG1048775.0 transcript_id=mCT166479.0
FT                   created on 14-AUG-2002"
FT   assembly_gap    75718..75903
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    79234..80577
FT                   /estimated_length=1344
FT                   /gap_type="unknown"
FT   assembly_gap    83530..84267
FT                   /estimated_length=738
FT                   /gap_type="unknown"
FT   assembly_gap    85423..85466
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    95496..100394
FT                   /estimated_length=4899
FT                   /gap_type="unknown"
FT   assembly_gap    103430..103519
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   gene            114485..119334
FT                   /gene="Ifng"
FT                   /locus_tag="mCG_1237"
FT                   /note="gene_id=mCG1237.1"
FT   mRNA            join(114485..114706,115901..115966,116054..116236,
FT                   118597..119334)
FT                   /gene="Ifng"
FT                   /locus_tag="mCG_1237"
FT                   /product="interferon gamma"
FT                   /note="gene_id=mCG1237.1 transcript_id=mCT8440.1 created on
FT                   14-AUG-2002"
FT   CDS             join(114596..114706,115901..115966,116054..116236,
FT                   118597..118704)
FT                   /codon_start=1
FT                   /gene="Ifng"
FT                   /locus_tag="mCG_1237"
FT                   /product="interferon gamma"
FT                   /note="gene_id=mCG1237.1 transcript_id=mCT8440.1
FT                   protein_id=mCP17348.2"
FT                   /protein_id="EDL24379.1"
FT                   /translation="MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVE
FT                   EKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFS
FT                   NSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC"
FT   assembly_gap    120697..120716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    142488..142507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    143587..143606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    149825..149844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    163544..163563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    170227..170378
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            complement(175427..229556)
FT                   /locus_tag="mCG_1048776"
FT                   /note="gene_id=mCG1048776.1"
FT   mRNA            complement(join(175427..175541,184411..184537,
FT                   187468..187610,198019..198145,229478..229556))
FT                   /locus_tag="mCG_1048776"
FT                   /product="mCG1048776"
FT                   /note="gene_id=mCG1048776.1 transcript_id=mCT166480.1
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(175439..175541,184411..184427))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048776"
FT                   /product="mCG1048776"
FT                   /note="gene_id=mCG1048776.1 transcript_id=mCT166480.1
FT                   protein_id=mCP44441.1"
FT                   /protein_id="EDL24380.1"
FT                   /translation="MLIKQSTRVLAGHTILHNEIMFLPLADVQSSAADMLQLQ"
FT   assembly_gap    176536..176561
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    179617..179636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    182235..182419
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    270466..270485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    282659..282678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    371282..372429
FT                   /estimated_length=1148
FT                   /gap_type="unknown"
FT   assembly_gap    382595..383318
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   gene            complement(384235..385480)
FT                   /locus_tag="mCG_1048777"
FT                   /note="gene_id=mCG1048777.1"
FT   mRNA            complement(join(384235..384336,385355..385480))
FT                   /locus_tag="mCG_1048777"
FT                   /product="mCG1048777"
FT                   /note="gene_id=mCG1048777.1 transcript_id=mCT166481.1
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(384281..384336,385355..385436))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048777"
FT                   /product="mCG1048777"
FT                   /note="gene_id=mCG1048777.1 transcript_id=mCT166481.1
FT                   protein_id=mCP44464.1"
FT                   /protein_id="EDL24381.1"
FT                   /translation="MVIYKTNKQKRWNFSTVTGKYKTRKPTGVPCSCGGFEVAPRVPHG
FT                   "
FT   gene            complement(387900..389182)
FT                   /locus_tag="mCG_147833"
FT                   /note="gene_id=mCG147833.0"
FT   mRNA            complement(join(387900..388456,388645..389182))
FT                   /locus_tag="mCG_147833"
FT                   /product="mCG147833"
FT                   /note="gene_id=mCG147833.0 transcript_id=mCT188096.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(388135..388329)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147833"
FT                   /product="mCG147833"
FT                   /note="gene_id=mCG147833.0 transcript_id=mCT188096.0
FT                   protein_id=mCP108207.0"
FT                   /protein_id="EDL24382.1"
FT                   /translation="MRSYQEYTHLTYTHHGILTCLAMDIHQPFSLLLPSGVFRLEINET
FT                   QQQYPGHRECLTEHWQRGG"
FT   assembly_gap    396869..396930
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    398650..398766
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    402993..403121
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    426031..426050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    441440..441638
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    450017..450036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(474151..475015)
FT                   /locus_tag="mCG_1048778"
FT                   /note="gene_id=mCG1048778.0"
FT   mRNA            complement(join(474151..474831,474934..475015))
FT                   /locus_tag="mCG_1048778"
FT                   /product="mCG1048778"
FT                   /note="gene_id=mCG1048778.0 transcript_id=mCT166482.0
FT                   created on 14-AUG-2002"
FT   CDS             complement(474369..474683)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048778"
FT                   /product="mCG1048778"
FT                   /note="gene_id=mCG1048778.0 transcript_id=mCT166482.0
FT                   protein_id=mCP44482.1"
FT                   /protein_id="EDL24383.1"
FT                   /translation="MFSFCECALDLRWFAAQVHTFSTGHSSICLVTLRLAQLETVKTLQ
FT                   DSPVTQRGGGKGLRGISWATLCKLPPFCTQCHKADFDPCKRTAGHTPHPDLSKDTPCGD
FT                   "
FT   assembly_gap    479736..480109
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    488304..489019
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    491928..491947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    520351..520370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(525288..>537796)
FT                   /gene="Dyrk2"
FT                   /locus_tag="mCG_50688"
FT                   /note="gene_id=mCG50688.2"
FT   mRNA            complement(join(525288..530838,537738..>537796))
FT                   /gene="Dyrk2"
FT                   /locus_tag="mCG_50688"
FT                   /product="dual-specificity tyrosine-(Y)-phosphorylation
FT                   regulated kinase 2"
FT                   /note="gene_id=mCG50688.2 transcript_id=mCT50871.2 created
FT                   on 01-NOV-2002"
FT   CDS             complement(join(529237..530838,537738..>537794))
FT                   /codon_start=1
FT                   /gene="Dyrk2"
FT                   /locus_tag="mCG_50688"
FT                   /product="dual-specificity tyrosine-(Y)-phosphorylation
FT                   regulated kinase 2"
FT                   /note="gene_id=mCG50688.2 transcript_id=mCT50871.2
FT                   protein_id=mCP30319.2"
FT                   /protein_id="EDL24384.1"
FT                   /translation="SPIALPPLRASNATTTAHTIGGSKHTMNDHLHLNSHGQIQVQQLF
FT                   EDNSNKRTVLTTQPNGLTTVGKTGLPGVPERQLESIHRRQGSSTSLKSMEGMGKVKASP
FT                   MTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQ
FT                   VPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILE
FT                   HLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAH
FT                   SILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYR
FT                   APEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDA
FT                   SKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPL
FT                   FLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTAVKRVTESTGAITSISKL
FT                   PPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS"
FT   assembly_gap    535104..535496
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    537124..537228
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    537797..539335
FT                   /estimated_length=1539
FT                   /gap_type="unknown"
FT   assembly_gap    541109..541179
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    542121..542296
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    544159..544279
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   gene            562575..563224
FT                   /pseudo
FT                   /locus_tag="mCG_1048749"
FT                   /note="gene_id=mCG1048749.1"
FT   mRNA            562575..563224
FT                   /pseudo
FT                   /locus_tag="mCG_1048749"
FT                   /note="gene_id=mCG1048749.1 transcript_id=mCT166453.1
FT                   created on 14-AUG-2002"
FT   assembly_gap    578279..578376
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    580564..580583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(583560..>590356)
FT                   /locus_tag="mCG_144742"
FT                   /note="gene_id=mCG144742.0"
FT   mRNA            complement(join(583560..584410,584442..585241,
FT                   588761..588855,589312..589821,590254..>590356))
FT                   /locus_tag="mCG_144742"
FT                   /product="mCG144742"
FT                   /note="gene_id=mCG144742.0 transcript_id=mCT184166.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(589523..589821,590254..>590335))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144742"
FT                   /product="mCG144742"
FT                   /note="gene_id=mCG144742.0 transcript_id=mCT184166.0
FT                   protein_id=mCP105306.0"
FT                   /protein_id="EDL24385.1"
FT                   /translation="PPQQNRKRAWVAVRNYCSTRPASSHAVVMGQPRKPVSPLTLELHA
FT                   IRTKASKSRNQQLKLELDAKVSGLHGMNGFLLVYTWRPGSFQKAENICAHTTTLPLTSA
FT                   SVSMFSLLLESSDSCGCLPYPG"
FT   assembly_gap    592937..593136
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    603459..604066
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    605628..607038
FT                   /estimated_length=1411
FT                   /gap_type="unknown"
FT   assembly_gap    615766..616090
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    618688..619003
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    626770..626789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    629568..630356
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   assembly_gap    664228..664247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(672444..675765)
FT                   /locus_tag="mCG_147837"
FT                   /note="gene_id=mCG147837.0"
FT   mRNA            complement(join(672444..673538,675055..675765))
FT                   /locus_tag="mCG_147837"
FT                   /product="mCG147837"
FT                   /note="gene_id=mCG147837.0 transcript_id=mCT188100.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(675194..675394)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147837"
FT                   /product="mCG147837"
FT                   /note="gene_id=mCG147837.0 transcript_id=mCT188100.0
FT                   protein_id=mCP108211.0"
FT                   /protein_id="EDL24386.1"
FT                   /translation="MPVGLTSSPIFALLRDTAGNVSWRPFGSFLPTGAKAEAWLYLLGH
FT                   ANTADSCLLSQLSQTGLLVYP"
FT   assembly_gap    696170..696301
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    722372..723659
FT                   /estimated_length=1288
FT                   /gap_type="unknown"
FT   assembly_gap    729041..748579
FT                   /estimated_length=19539
FT                   /gap_type="unknown"
FT   assembly_gap    753104..753233
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    756847..756866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    757925..757944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    759448..759467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <762832..773941
FT                   /locus_tag="mCG_1048780"
FT                   /note="gene_id=mCG1048780.0"
FT   mRNA            join(<762832..763061,765533..765763,773592..773941)
FT                   /locus_tag="mCG_1048780"
FT                   /product="mCG1048780"
FT                   /note="gene_id=mCG1048780.0 transcript_id=mCT166484.0
FT                   created on 14-AUG-2002"
FT   CDS             join(<762834..763061,765533..765565)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048780"
FT                   /product="mCG1048780"
FT                   /note="gene_id=mCG1048780.0 transcript_id=mCT166484.0
FT                   protein_id=mCP44500.0"
FT                   /protein_id="EDL24387.1"
FT                   /translation="VCISSCLQAPVLVSFSNGLCAVWGEAVSPNKPLPPHVDWVMTFYQ
FT                   SERNPDQDTRSIVKLNSLRKSHDRFTLHSTEGDGCGPIMSA"
FT   assembly_gap    763272..763798
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    770936..771078
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    777451..777470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    783812..783831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    793711..794134
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    801958..802814
FT                   /estimated_length=857
FT                   /gap_type="unknown"
FT   assembly_gap    807126..807696
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    809577..809596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    812878..813033
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    816872..816893
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    825796..826024
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    837495..837740
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   gene            complement(851759..891698)
FT                   /locus_tag="mCG_2224"
FT                   /note="gene_id=mCG2224.2"
FT   mRNA            complement(join(851759..854934,858453..858560,
FT                   859764..859928,860010..860179,861711..861806,
FT                   862392..863885,864177..864318,865284..865576,
FT                   866942..867087,867883..867988,868191..868447,
FT                   869681..869804,871330..871484,879119..879262,
FT                   891305..891698))
FT                   /locus_tag="mCG_2224"
FT                   /product="mCG2224"
FT                   /note="gene_id=mCG2224.2 transcript_id=mCT1705.2 created on
FT                   14-AUG-2002"
FT   CDS             complement(join(854710..854934,858453..858560,
FT                   859764..859928,860010..860179,861711..861806,
FT                   862392..863885,864177..864318,865284..865576,
FT                   866942..867087,867883..867988,868191..868447,
FT                   869681..869804,871330..871484,879119..879262,
FT                   891305..891372))
FT                   /codon_start=1
FT                   /locus_tag="mCG_2224"
FT                   /product="mCG2224"
FT                   /note="gene_id=mCG2224.2 transcript_id=mCT1705.2
FT                   protein_id=mCP7962.2"
FT                   /protein_id="EDL24388.1"
FT                   /translation="MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDS
FT                   ERKVVKMILRLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRD
FT                   ISSIGLKTVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLS
FT                   RQGGLLVNFHPSILTCLLPQLTSPRLAVRKRTIIALGHLVMSCGNIVFVDLIEHLLSEL
FT                   SKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEKIIPLVVKFCNVDDDELREYCIQAFES
FT                   FVRRCPKEVYPHVSTIINICLKYLTYDPNYNYDDEDEDENAMDADGGDDDDQGSDDEYS
FT                   DDDDMSWKVRRAAAKCLDAVVSTRHEMLPEFYKTVSPALIARFKEREENVKADVFHAYL
FT                   SLLKQTRPVQSWLCDPDAMEQGDTPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNML
FT                   TELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPHV
FT                   QALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRL
FT                   KAADIDQEVKERAISCMGQIICNLGDNLGPDLSNTLQIFLERLKNEITRLTTVKALTLI
FT                   AGSPLKIDLRPVLGEGVPILASFLRKNQRALKLGTLSALDILIKNYSDSLTAAMIDAVL
FT                   DELPPLISESDMHVSQMAISFLTTLAKVYPSSLSKISGSILNELIGLVRSPLLQGGALS
FT                   AMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAALTRACPK
FT                   EGPAVVGQFIQDVKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEE
FT                   VKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASVAGLKPYVE
FT                   NIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSVVTAV
FT                   KFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLLDSV
FT                   LPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFLN
FT                   HVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEF
FT                   EKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQISSNPELAAIFESIQKDSSSTNLE
FT                   SMDTS"
FT   assembly_gap    891201..891220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    899317..899336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    913751..913770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    916155..916174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    935748..935767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    947964..947991
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    954504..954940
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    961522..961867
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    965545..965564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <977715..984488
FT                   /locus_tag="mCG_1048782"
FT                   /note="gene_id=mCG1048782.0"
FT   mRNA            join(<977715..977944,983110..983211,984237..984488)
FT                   /locus_tag="mCG_1048782"
FT                   /product="mCG1048782"
FT                   /note="gene_id=mCG1048782.0 transcript_id=mCT166486.0
FT                   created on 14-AUG-2002"
FT   CDS             join(<977717..977944,983110..983124)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048782"
FT                   /product="mCG1048782"
FT                   /note="gene_id=mCG1048782.0 transcript_id=mCT166486.0
FT                   protein_id=mCP44518.0"
FT                   /protein_id="EDL24389.1"
FT                   /translation="NVLQQCLYIPKHLPTPSWRNTLRFLTSHRSSICLTWSEELSYQHG
FT                   HIRKERFNQRDVARCSVSRGPFIVMSLLKHDISLQ"
FT   assembly_gap    987141..987267
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            995103..995556
FT                   /pseudo
FT                   /locus_tag="mCG_1048783"
FT                   /note="gene_id=mCG1048783.0"
FT   mRNA            995103..995556
FT                   /pseudo
FT                   /locus_tag="mCG_1048783"
FT                   /note="gene_id=mCG1048783.0 transcript_id=mCT166487.1
FT                   created on 14-AUG-2002"
FT   assembly_gap    1005731..1006658
FT                   /estimated_length=928
FT                   /gap_type="unknown"
FT   assembly_gap    1024305..1024572
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    1025119..1025486
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    1030145..1030164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1043528..1043547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1065973..1079246
FT                   /locus_tag="mCG_140907"
FT                   /note="gene_id=mCG140907.0"
FT   mRNA            join(<1065973..1066152,1067118..1067195,1067652..1067898,
FT                   1078916..1079246)
FT                   /locus_tag="mCG_140907"
FT                   /product="mCG140907"
FT                   /note="gene_id=mCG140907.0 transcript_id=mCT172039.0
FT                   created on 14-AUG-2002"
FT   CDS             <1067686..1067892
FT                   /codon_start=1
FT                   /locus_tag="mCG_140907"
FT                   /product="mCG140907"
FT                   /note="gene_id=mCG140907.0 transcript_id=mCT172039.0
FT                   protein_id=mCP94958.0"
FT                   /protein_id="EDL24390.1"
FT                   /translation="AARIWWQLSDCYSWPPWPPFPCKAPAEVEGDSSFATSSAYIKPYS
FT                   GPFLPNEARRATSCCCLSLNQPK"
FT   assembly_gap    1085753..1086176
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    1106445..1106805
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    1143582..1143601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1148171..1148190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1186411..1186430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1194298..1194548
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    1195339..1195975
FT                   /estimated_length=637
FT                   /gap_type="unknown"
FT   assembly_gap    1200102..1200228
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    1201871..1205615
FT                   /estimated_length=3745
FT                   /gap_type="unknown"
FT   assembly_gap    1210402..1210421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1212062..1212081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1213530..1214370
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    1216943..1216962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1218324..1218860
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    1219874..1219893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1222580..1222599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1224855..1224874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1228851..1228870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1244998..1247360
FT                   /locus_tag="mCG_1048786"
FT                   /note="gene_id=mCG1048786.0"
FT   mRNA            join(1244998..1245019,1246610..1247360)
FT                   /locus_tag="mCG_1048786"
FT                   /product="mCG1048786"
FT                   /note="gene_id=mCG1048786.0 transcript_id=mCT166490.0
FT                   created on 14-AUG-2002"
FT   CDS             1246818..1247024
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048786"
FT                   /product="mCG1048786"
FT                   /note="gene_id=mCG1048786.0 transcript_id=mCT166490.0
FT                   protein_id=mCP44460.1"
FT                   /protein_id="EDL24391.1"
FT                   /translation="MREFNLESERTCQAMNWLVWGLCCGGCQIIDEYVTFQEEKSFQKK
FT                   PNNLIMICIMCNEDHLPIIGAHC"
FT   gene            1267518..1267909
FT                   /pseudo
FT                   /locus_tag="mCG_59474"
FT                   /note="gene_id=mCG59474.2"
FT   mRNA            1267518..1267909
FT                   /pseudo
FT                   /locus_tag="mCG_59474"
FT                   /note="gene_id=mCG59474.2 transcript_id=mCT59657.2 created
FT                   on 14-AUG-2002"
FT   assembly_gap    1283203..1283380
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    1320952..1322022
FT                   /estimated_length=1071
FT                   /gap_type="unknown"
FT   assembly_gap    1331318..1331401
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    1338283..1338302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1341584..1341603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1348339..1348358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1369221..1369240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1401791..>1417534)
FT                   /locus_tag="mCG_145401"
FT                   /note="gene_id=mCG145401.0"
FT   mRNA            complement(join(1401791..1402326,1415949..1416044,
FT                   1417441..>1417534))
FT                   /locus_tag="mCG_145401"
FT                   /product="mCG145401"
FT                   /note="gene_id=mCG145401.0 transcript_id=mCT184825.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1402122..>1402289)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145401"
FT                   /product="mCG145401"
FT                   /note="gene_id=mCG145401.0 transcript_id=mCT184825.0
FT                   protein_id=mCP105310.0"
FT                   /protein_id="EDL24392.1"
FT                   /translation="TLPRTKSLQSTWRKLLIPQKTELRCNLYRGRELRPHSTATWLSPV
FT                   NPMTTETSKD"
FT   assembly_gap    1420671..1423532
FT                   /estimated_length=2862
FT                   /gap_type="unknown"
FT   assembly_gap    1449200..1449219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1466936..1466955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1472370..1473046
FT                   /estimated_length=677
FT                   /gap_type="unknown"
FT   gene            <1473939..1731388
FT                   /gene="Grip1"
FT                   /locus_tag="mCG_19224"
FT                   /note="gene_id=mCG19224.2"
FT   mRNA            join(<1473939..1474061,1583249..1583384,1584593..1584738,
FT                   1591595..1591678,1596163..1596238,1598327..1598472,
FT                   1629322..1629469,1631803..1631972,1639873..1640025,
FT                   1653279..1653465,1654053..1654198,1663842..1663922,
FT                   1671707..1671776,1673594..1673739,1689436..1689580,
FT                   1692384..1692523,1692692..1692886,1703630..1703786,
FT                   1704284..1704395,1709112..1709345,1726888..1727034,
FT                   1729543..1729816)
FT                   /gene="Grip1"
FT                   /locus_tag="mCG_19224"
FT                   /product="glutamate receptor interacting protein 1,
FT                   transcript variant mCT192000"
FT                   /note="gene_id=mCG19224.2 transcript_id=mCT192000.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1473941..1474061,1583249..1583384,1584593..1584738,
FT                   1591595..1591678,1596163..1596238,1598327..1598472,
FT                   1629322..1629469,1631803..1631972,1639873..1640025,
FT                   1653279..1653465,1654053..1654198,1663842..1663922,
FT                   1671707..1671776,1673594..1673739,1689436..1689580,
FT                   1692384..1692523,1692692..1692886,1703630..1703786,
FT                   1704284..1704395,1709112..1709345,1726888..1727034,
FT                   1729543..1729770)
FT                   /codon_start=1
FT                   /gene="Grip1"
FT                   /locus_tag="mCG_19224"
FT                   /product="glutamate receptor interacting protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19224.2 transcript_id=mCT192000.0
FT                   protein_id=mCP112949.0 isoform=CRA_a"
FT                   /protein_id="EDL24393.1"
FT                   /translation="RSPLQPPEQSPCVHFAREQRARMIAVSFKCRCQILRRLTKEEFKG
FT                   STVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINL
FT                   AKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTVEVTLHKEGNTFGFVIRG
FT                   GAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCG
FT                   QEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTTSVCCNKQVIVIDKIKSA
FT                   SIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEILPHHQTRLALKGP
FT                   DHAAMVPSSSPTSMSAYSLSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSLSLASS
FT                   TVGLAGQVVHTETTEVVLTADPVTGFGIQLQGSVFATETLSSPPLISYIEADSPAERCG
FT                   VLQIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVK
FT                   LPKKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNC
FT                   SMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITISGTEEP
FT                   FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIK
FT                   KQTDAQSASSPKKFPIPGHSGDLGDGEEDPSPIQKPGKLSDAYPSTVPSVDSAVDSWDG
FT                   SGIDASYGSQGSTFQTSGYNYNTYDWRSPKQRTSLSPVPKPRSQTYPDVGLSNEDWDRS
FT                   TASGFVGASDSADAEQEENFWSQALEDLETCGQSGILRELEATIMSGSTMSLNHEAPMA
FT                   RSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELH
FT                   KVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGDVGGLKPYDRLLQVNHVRTRDF
FT                   DCCLVVPLIAESGNKLDLVISRNPLASQKSIEQPALPSDWSEQNSAFFQQPSHGGNLET
FT                   REPTNTL"
FT   mRNA            join(<1474007..1474061,1551102..1551182,1583249..1583384,
FT                   1584593..1584738,1591595..1591678,1596163..1596238,
FT                   1598327..1598472,1629322..1629469,1631803..1631972,
FT                   1639014..1639169,1639873..1640025,1653279..1653465,
FT                   1654053..1654198,1663842..1663922,1671707..1671776,
FT                   1673594..1673739,1689436..1689580,1692384..1692523,
FT                   1692692..1692886,1703630..1703786,1704284..1704395,
FT                   1704511..1704555,1709112..1709345,1726888..1727034,
FT                   1729543..1731387)
FT                   /gene="Grip1"
FT                   /locus_tag="mCG_19224"
FT                   /product="glutamate receptor interacting protein 1,
FT                   transcript variant mCT18175"
FT                   /note="gene_id=mCG19224.2 transcript_id=mCT18175.2 created
FT                   on 07-AUG-2002"
FT   CDS             join(1474007..1474061,1551102..1551182,1583249..1583384,
FT                   1584593..1584738,1591595..1591678,1596163..1596238,
FT                   1598327..1598472,1629322..1629469,1631803..1631972,
FT                   1639014..1639169,1639873..1640025,1653279..1653465,
FT                   1654053..1654198,1663842..1663922,1671707..1671776,
FT                   1673594..1673739,1689436..1689580,1692384..1692523,
FT                   1692692..1692886,1703630..1703786,1704284..1704395,
FT                   1704511..1704555,1709112..1709345,1726888..1727034,
FT                   1729543..1729770)
FT                   /codon_start=1
FT                   /gene="Grip1"
FT                   /locus_tag="mCG_19224"
FT                   /product="glutamate receptor interacting protein 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19224.2 transcript_id=mCT18175.2
FT                   protein_id=mCP7952.2 isoform=CRA_c"
FT                   /protein_id="EDL24395.1"
FT                   /translation="MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGTLAVRRQSIP
FT                   EEFKGSTVVELMKKEGTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAV
FT                   NGINLAKFRHDEIISLLKNVGERVVLEVEYELPPVSVQGSSVMFRTVEVTLHKEGNTFG
FT                   FVIRGGAHDDRNKSRPVVITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSI
FT                   LKQCGQEATLLIEYDVSVMDSVATASGPLLVEVAKTPGASLGVALTTSVCCNKQVIVID
FT                   KIKSASIADRCGALHVGDHILSIDGTSMEYCTLAEATQFLANTTDQVKLEILPHHQTRL
FT                   ALKGPDHVKIQRSDRQHPWDAWASNQCGVHTNHHHNTYHPDHCRVPALTFPKALPPNSP
FT                   PAMVPSSSPTSMSAYSLSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSLSLASSTV
FT                   GLAGQVVHTETTEVVLTADPVTGFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVL
FT                   QIGDRVMAINGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLP
FT                   KKHSVELGITISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSM
FT                   EDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITISGTEEPFD
FT                   PIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ
FT                   TDAQSASSPKKFPIPGHSGDLGDGEEDPSPIQKPGKLSDAYPSTVPSVDSAVDSWDGSG
FT                   IDASYGSQGSTFQTSGYNYNTYDWRSPKQRTSLSPVPKPRSQTYPDVGLSNEDWDRSTA
FT                   SGFVGASDSADAEQEENFWSQALEDLETCGQSGILRELEEKADRRVSLRNMTLLATIMS
FT                   GSTMSLNHEAPMARSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQE
FT                   IKEIMSPTPVELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRPAGPGDVGGLKPYD
FT                   RLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRNPLASQKSIEQPALPSDWSEQNSA
FT                   FFQQPSHGGNLETREPTNTL"
FT   assembly_gap    1477480..1477499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1491324..1491722
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   gene            complement(1501487..>1504981)
FT                   /locus_tag="mCG_1048791"
FT                   /note="gene_id=mCG1048791.0"
FT   mRNA            complement(join(1501487..1501698,1503245..1504028,
FT                   1504787..>1504981))
FT                   /locus_tag="mCG_1048791"
FT                   /product="mCG1048791"
FT                   /note="gene_id=mCG1048791.0 transcript_id=mCT166495.0
FT                   created on 14-AUG-2002"
FT   CDS             complement(join(1501552..1501698,1503245..>1503259))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048791"
FT                   /product="mCG1048791"
FT                   /note="gene_id=mCG1048791.0 transcript_id=mCT166495.0
FT                   protein_id=mCP44533.0"
FT                   /protein_id="EDL24396.1"
FT                   /translation="TPCINAVSRKVPSSPIVSGAEIQAFNMSLWKKSTIIIVTNSDVIA
FT                   WPRETRNA"
FT   mRNA            join(<1505078..1505121,1551102..1551182,1583249..1583384,
FT                   1584593..1584738,1591595..1591678,1596163..1596238,
FT                   1598327..1598472,1629322..1629469,1631803..1631972,
FT                   1639014..1640025,1653279..1653465,1654053..1654198,
FT                   1663842..1663922,1671707..1671776,1673594..1673739,
FT                   1689436..1689580,1692384..1692523,1703630..1703786,
FT                   1704284..1704395,1709112..1709345,1726888..1727034,
FT                   1729543..1731388)
FT                   /gene="Grip1"
FT                   /locus_tag="mCG_19224"
FT                   /product="glutamate receptor interacting protein 1,
FT                   transcript variant mCT192001"
FT                   /note="gene_id=mCG19224.2 transcript_id=mCT192001.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    1558114..1558234
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    1576509..1576578
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1595691..1595710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1602171..1602601
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    1613864..1613883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1618667..1618768
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1630621..1630655
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    1632579..1633444
FT                   /estimated_length=866
FT                   /gap_type="unknown"
FT   CDS             join(<1639764..1640025,1653279..1653465,1654053..1654198,
FT                   1663842..1663922,1671707..1671776,1673594..1673739,
FT                   1689436..1689580,1692384..1692523,1703630..1703786,
FT                   1704284..1704395,1709112..1709345,1726888..1727034,
FT                   1729543..1729770)
FT                   /codon_start=1
FT                   /gene="Grip1"
FT                   /locus_tag="mCG_19224"
FT                   /product="glutamate receptor interacting protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19224.2 transcript_id=mCT192001.0
FT                   protein_id=mCP112950.0 isoform=CRA_b"
FT                   /protein_id="EDL24394.1"
FT                   /translation="LTCDYVMSLWVIAGWQGAAGSGRIQDRSVPSLCSLTAAMVPSSSP
FT                   TSMSAYSLSSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSLSLASSTVGLAGQVVHT
FT                   ETTEVVLTADPVTGFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAI
FT                   NGIPTEDSTFEEANQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHSVELGI
FT                   TISSPSSRKPGDPLVISDIKKGSVAHRTGTLELGDKLLAIDNIRLDNCSMEDAVQILQQ
FT                   CEDLVKLKIRKDEDNSDEQESSGAIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTK
FT                   GGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDGSTFQTS
FT                   GYNYNTYDWRSPKQRTSLSPVPKPRSQTYPDVGLSNEDWDRSTASGFVGASDSADAEQE
FT                   ENFWSQALEDLETCGQSGILRELEATIMSGSTMSLNHEAPMARSQLGRQASFQERSSSR
FT                   PHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSGMEDFGFSV
FT                   ADGLLEKGVYVKNIRPAGPGDVGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLD
FT                   LVISRNPLASQKSIEQPALPSDWSEQNSAFFQQPSHGGNLETREPTNTL"
FT   assembly_gap    1655195..1655584
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    1666186..1666205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1678068..1679688
FT                   /estimated_length=1621
FT                   /gap_type="unknown"
FT   assembly_gap    1695229..1695293
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    1697886..1697905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1699282..1699301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1737725..1767009)
FT                   /gene="Helb"
FT                   /locus_tag="mCG_19221"
FT                   /note="gene_id=mCG19221.2"
FT   mRNA            complement(join(1737725..1739090,1743525..1743992,
FT                   1745726..1745869,1746601..1746805,1748344..1748403,
FT                   1749219..1749309,1752300..1752454,1755468..1755609,
FT                   1756840..1757014,1759230..1760108,1762958..1763127,
FT                   1764952..1765347,1766804..1767009))
FT                   /gene="Helb"
FT                   /locus_tag="mCG_19221"
FT                   /product="helicase (DNA) B"
FT                   /note="gene_id=mCG19221.2 transcript_id=mCT18172.2 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(1738929..1739090,1743525..1743992,
FT                   1745726..1745869,1746601..1746805,1748344..1748403,
FT                   1749219..1749309,1752300..1752454,1755468..1755609,
FT                   1756840..1757014,1759230..1760108,1762958..1763127,
FT                   1764952..1765347,1766804..1766981))
FT                   /codon_start=1
FT                   /gene="Helb"
FT                   /locus_tag="mCG_19221"
FT                   /product="helicase (DNA) B"
FT                   /note="gene_id=mCG19221.2 transcript_id=mCT18172.2
FT                   protein_id=mCP7968.2"
FT                   /db_xref="GOA:Q6NVF4"
FT                   /db_xref="InterPro:IPR027044"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="MGI:MGI:2152895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NVF4"
FT                   /protein_id="EDL24397.1"
FT                   /translation="MARQDRLRELLGPLHPYKSDDEEEDCAQEEEGEQEEEFVDAEELC
FT                   SGGIKAGSLPGRARVSIPDEYTKEKCTVYGRFPLKGPWWRVKVQVLKPQRSRSYQVQGF
FT                   PAYFLQVDMSPPDQKQICSLFLKECNLASERIQEFLKWVEKVSSFENLHFENLWETLRL
FT                   FYRETEKKDKKLSTPREQQGEEMRVEKSFAFISAMVALQFPKVMEFLPSLFPRHFKRLI
FT                   SSSSDWVLGCIEDVLGTQPWKLGFRRITYREMKLVRCEASWTAFSQCPSLLQLMTPLQK
FT                   NALVIYSKLRQTCREDGHTYIEVKDLTSGLSEHMSFEEACQSLAFLKDIDVVIYEKDYV
FT                   FLSELYEAEQDIASSICELMSRPPWHLKVDVKNVLASIRGAKPNDPGSAEAVEGSKPEE
FT                   VGSEQGDSVLDAQDGDDHVRSNGEHVANAEINDVPLDQDQVVALETICANAVTVLSGKG
FT                   GCGKTTIVSRLFKHMEHLEETEVQQACEDFEQDQEASEEWLDCPKQSPAGVDKAVEVLL
FT                   TAPTGKAAGLLRQRTDLPAYTLCQVNYSFYMWKTKNEVDKPWKFSTVRVLVVDEGSLVS
FT                   VGIFKSVLQLLCKHSKLSKLIILGDVRQLPSIEPGNMLQDVFETLKSRQCAIELKTNHR
FT                   TESQLIVDNATRISRRQFPKFDAELNICGNPTLPLSIQDKTFIFVRLPEEDSRSQSSKG
FT                   EHRSNLYTAVKTLLQGKDFCSFESSKTSQFIAFRRQDCDLINDCCCKHYTGHLIKDHEK
FT                   KLIFAVGDKICCTRNAYLSDLLPDKDQEAEGKGYGDAPDDDAKIKQDFESSTRLCNGEI
FT                   FFITRDVTDVTFKRKRLLTINNEAGLEVTVDFSKLMANCQIKHAWARTIHTFQGSEENT
FT                   VVYVVGKAGRQHWQHVYTAVTRGRSRVYIIAQESELRSATRKRGFPRQTRLKHFLQKKL
FT                   SGSCAPSTGFASQPSSPRVGGRPDTQPPASHLCRTPDNKATADSARGDERWLSASVNDD
FT                   VDTDEESAQLRGSKRIGDGFPFDEESPSKFRMVEAPSPQVSSVFQNMRLNTLTPRQLFK
FT                   PTDNQDTGTAGVADDANDPSNQEMEM"
FT   assembly_gap    1743391..1743410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1752734..1752807
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    1764128..1764147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1767807..1768233
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    1773419..1773936
FT                   /estimated_length=518
FT                   /gap_type="unknown"
FT   assembly_gap    1780393..1780520
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    1782316..1782354
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            complement(1795601..>1856344)
FT                   /gene="Irak3"
FT                   /locus_tag="mCG_19225"
FT                   /note="gene_id=mCG19225.2"
FT   mRNA            complement(join(1795601..1797129,1799415..1799579,
FT                   1799667..1799729,1800200..1800398,1819225..1819343,
FT                   1820659..1820773,1824557..1824621,1830468..1830619,
FT                   1832305..1832359,1832933..1833036,1836729..1836911,
FT                   1856221..>1856344))
FT                   /gene="Irak3"
FT                   /locus_tag="mCG_19225"
FT                   /product="interleukin-1 receptor-associated kinase 3,
FT                   transcript variant mCT192003"
FT                   /note="gene_id=mCG19225.2 transcript_id=mCT192003.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1795604..1797129,1799415..1799579,
FT                   1799667..1799729,1800200..1800398,1819225..1819343,
FT                   1820659..1820773,1824557..1824621,1830468..1830619,
FT                   1832305..1832359,1832933..1833036,1836729..1836911,
FT                   1855539..1855800))
FT                   /gene="Irak3"
FT                   /locus_tag="mCG_19225"
FT                   /product="interleukin-1 receptor-associated kinase 3,
FT                   transcript variant mCT18176"
FT                   /note="gene_id=mCG19225.2 transcript_id=mCT18176.2 created
FT                   on 14-AUG-2002"
FT   CDS             complement(join(1796653..1797129,1799415..1799579,
FT                   1799667..1799729,1800200..1800398,1819225..1819343,
FT                   1820659..1820773,1824557..1824621,1830468..1830619,
FT                   1832305..1832359,1832933..1833036,1836729..1836911,
FT                   1856221..>1856317))
FT                   /codon_start=1
FT                   /gene="Irak3"
FT                   /locus_tag="mCG_19225"
FT                   /product="interleukin-1 receptor-associated kinase 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19225.2 transcript_id=mCT192003.0
FT                   protein_id=mCP112951.0 isoform=CRA_b"
FT                   /protein_id="EDL24399.1"
FT                   /translation="STARKERETVVKPSGTTAGVAFCSKDEQFVCPAERLSNSWLDVRH
FT                   IEKYVNQGKSGTRELLWSWAQKNKTIGDLLEVLQDMGHQRAIHLIINYGVSWTPSVQTH
FT                   HELPFPSFPPEVKHACRENDPGPLEPANVTVDNVLVPEHNEKGTLQKTPISFQSILEGT
FT                   KHFHKDFLIGEGEIFEVYRVDIRNQAYAVKLFKQEKKMQLKKHWKRFLSELEVLLLFRH
FT                   PHILELAAYFTETEKLCLVYPYMSNGTLFDRLQCTNGTTPLSWHVRISVLIGIAKAIQY
FT                   LHNTQPCAVICGNVSSANILLDDQLQPKLTDFAAAHFRPNLEQQSSTINMTGGGRKHLW
FT                   YMPEEYIRQGRLSVKTDVYSFGIVIMEVLTGCKVVLDDPKHVQLRDLLMELMEKRGLDS
FT                   CLSFLDRKIPPCPRNFSAKLFSLAGRCVATKAKLRPTMDEVLSSLESTQPSLYFAEDPP
FT                   TSLKSFRCPSPLFLDNVPSIPVEDDENQNNHSVPPKEVLGTDRVTQKTPFECSQSEVTF
FT                   LGLDRNRGNRGSEADCNVPSSSHEECWSPELVAPSQDLSPTVISLGSSWEVPGHSYGSK
FT                   PMEKRCSSGLFCSEHEQSKKQ"
FT   CDS             complement(join(1796653..1797129,1799415..1799579,
FT                   1799667..1799729,1800200..1800398,1819225..1819343,
FT                   1820659..1820773,1824557..1824621,1830468..1830619,
FT                   1832305..1832359,1832933..1833036,1836729..1836911,
FT                   1855539..1855671))
FT                   /codon_start=1
FT                   /gene="Irak3"
FT                   /locus_tag="mCG_19225"
FT                   /product="interleukin-1 receptor-associated kinase 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19225.2 transcript_id=mCT18176.2
FT                   protein_id=mCP7960.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VB14"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR033610"
FT                   /db_xref="MGI:MGI:1921164"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VB14"
FT                   /protein_id="EDL24398.1"
FT                   /translation="MAGRCGARGALSPQLLLFDLPPALLGELCGILDSCDGPLGWRGLA
FT                   ERLSNSWLDVRHIEKYVNQGKSGTRELLWSWAQKNKTIGDLLEVLQDMGHQRAIHLIIN
FT                   YGVSWTPSVQTHHELPFPSFPPEVKHACRENDPGPLEPANVTVDNVLVPEHNEKGTLQK
FT                   TPISFQSILEGTKHFHKDFLIGEGEIFEVYRVDIRNQAYAVKLFKQEKKMQLKKHWKRF
FT                   LSELEVLLLFRHPHILELAAYFTETEKLCLVYPYMSNGTLFDRLQCTNGTTPLSWHVRI
FT                   SVLIGIAKAIQYLHNTQPCAVICGNVSSANILLDDQLQPKLTDFAAAHFRPNLEQQSST
FT                   INMTGGGRKHLWYMPEEYIRQGRLSVKTDVYSFGIVIMEVLTGCKVVLDDPKHVQLRDL
FT                   LMELMEKRGLDSCLSFLDRKIPPCPRNFSAKLFSLAGRCVATKAKLRPTMDEVLSSLES
FT                   TQPSLYFAEDPPTSLKSFRCPSPLFLDNVPSIPVEDDENQNNHSVPPKEVLGTDRVTQK
FT                   TPFECSQSEVTFLGLDRNRGNRGSEADCNVPSSSHEECWSPELVAPSQDLSPTVISLGS
FT                   SWEVPGHSYGSKPMEKRCSSGLFCSEHEQSKKQ"
FT   assembly_gap    1802786..1802805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1815214..1815597
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    1816141..1816291
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1819606..1819877
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    1833340..1833359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1838510..1838612
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    1839500..1839664
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    1858543..1860039
FT                   /estimated_length=1497
FT                   /gap_type="unknown"
FT   gene            1863483..1879992
FT                   /gene="Tmbim4"
FT                   /locus_tag="mCG_19220"
FT                   /note="gene_id=mCG19220.1"
FT   mRNA            join(1863483..1863651,1870255..1870363,1872582..1872687,
FT                   1875835..1875868,1877090..1877207,1878917..1878962,
FT                   1879700..1879992)
FT                   /gene="Tmbim4"
FT                   /locus_tag="mCG_19220"
FT                   /product="transmembrane BAX inhibitor motif containing 4"
FT                   /note="gene_id=mCG19220.1 transcript_id=mCT18171.2 created
FT                   on 15-AUG-2002"
FT   CDS             join(1863555..1863651,1870255..1870363,1872582..1872687,
FT                   1875835..1875868,1877090..1877207,1878917..1878962,
FT                   1879700..1879906)
FT                   /codon_start=1
FT                   /gene="Tmbim4"
FT                   /locus_tag="mCG_19220"
FT                   /product="transmembrane BAX inhibitor motif containing 4"
FT                   /note="gene_id=mCG19220.1 transcript_id=mCT18171.2
FT                   protein_id=mCP7964.2"
FT                   /protein_id="EDL24400.1"
FT                   /translation="MADTDPGYPRSSIEDDFNYGSCVASASVHIRMAFLRKVYSILSLQ
FT                   VLLTTVTSALFLYFQALRTFVHESPALIVVFALGSLGLIFALTLHRHTHPLNLYLLFAF
FT                   TLSESLAVAAVVTFYDVYLVLQAFIMTTAVFLGLTAYTLQSKRDFTKFGAGLFAGLWIL
FT                   CLAGFLKLFFYSETMELVLASLGALLFCGFIIYDTHSLMHRLSPEEYVIAAISLYMDII
FT                   NLFLHLLKFLEAVNKK"
FT   assembly_gap    1871949..1872435
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   gene            1882139..1887164
FT                   /locus_tag="mCG_19223"
FT                   /note="gene_id=mCG19223.0"
FT   mRNA            join(1882139..1882203,1883054..1883283,1886297..1887164)
FT                   /locus_tag="mCG_19223"
FT                   /product="mCG19223"
FT                   /note="gene_id=mCG19223.0 transcript_id=mCT18174.1 created
FT                   on 15-AUG-2002"
FT   CDS             join(1883061..1883283,1886297..1886466)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19223"
FT                   /product="mCG19223"
FT                   /note="gene_id=mCG19223.0 transcript_id=mCT18174.1
FT                   protein_id=mCP7947.1"
FT                   /db_xref="GOA:D3YXW1"
FT                   /db_xref="InterPro:IPR018784"
FT                   /db_xref="MGI:MGI:1913475"
FT                   /db_xref="UniProtKB/TrEMBL:D3YXW1"
FT                   /protein_id="EDL24401.1"
FT                   /translation="MAKSLRSKWKRKMRAEKRKKNAPRELNRLKSILRVDGDALMKDVE
FT                   EIATVVVAKPRQEKMQCEEGRCDGADEEKDDMKMETEIKRNRKTLLDQHGQYPVWMNQR
FT                   QRKRLKAKREKKRGKSRAKAAKGLAW"
FT   assembly_gap    1923306..1923325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1925908..1925963
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    1933008..1933178
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    1935355..1935374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1954111..1954355
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    1964969..1965098
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    1973448..1973728
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   gene            complement(2016905..2131699)
FT                   /locus_tag="mCG_19222"
FT                   /note="gene_id=mCG19222.1"
FT   mRNA            complement(join(2016905..2019109,2029472..2029504,
FT                   2117370..2117420,2127990..2128076,2130684..2131699))
FT                   /locus_tag="mCG_19222"
FT                   /product="mCG19222"
FT                   /note="gene_id=mCG19222.1 transcript_id=mCT18173.1 created
FT                   on 07-AUG-2002"
FT   gene            <2018983..2037625
FT                   /gene="1700006J14Rik"
FT                   /locus_tag="mCG_146002"
FT                   /note="gene_id=mCG146002.1"
FT   mRNA            join(<2018983..2019129,2024692..2024841,2036854..2037625)
FT                   /gene="1700006J14Rik"
FT                   /locus_tag="mCG_146002"
FT                   /product="RIKEN cDNA 1700006J14, transcript variant
FT                   mCT191990"
FT                   /note="gene_id=mCG146002.1 transcript_id=mCT191990.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<2018991..2019129,2024692..2024841,2026074..2026121,
FT                   2036854..2037478)
FT                   /gene="1700006J14Rik"
FT                   /locus_tag="mCG_146002"
FT                   /product="RIKEN cDNA 1700006J14, transcript variant
FT                   mCT186110"
FT                   /note="gene_id=mCG146002.1 transcript_id=mCT186110.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(2019065..2019109,2029472..2029504,
FT                   2117370..2117420,2127990..2128076,2130684..2130794))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19222"
FT                   /product="mCG19222"
FT                   /note="gene_id=mCG19222.1 transcript_id=mCT18173.1
FT                   protein_id=mCP7945.1"
FT                   /protein_id="EDL24402.1"
FT                   /translation="MSARGEGAGQPSTSAQGQPAAPVPQKRGRGRPRKQQQEPTCEPSP
FT                   KRPRGRPKGSKNKSPSKAAQKKAETIGEKRPRGRPRKWPQQVVQKKPAQETEETSSQES
FT                   AEED"
FT   CDS             <2036859..2037191
FT                   /codon_start=1
FT                   /gene="1700006J14Rik"
FT                   /locus_tag="mCG_146002"
FT                   /product="RIKEN cDNA 1700006J14, isoform CRA_a"
FT                   /note="gene_id=mCG146002.1 transcript_id=mCT186110.0
FT                   protein_id=mCP107352.0 isoform=CRA_a"
FT                   /protein_id="EDL24403.1"
FT                   /translation="RCWPSLRMLYRFPYSPSISIFPLFSPHSHGSLLRKFIHFLPLIPC
FT                   PEWSLCSPPDAVGTVTTHDTQFSPMVHCFATRKKLFRTAHFEPAYTYNVYAYLHQGMIT
FT                   SQRSQC"
FT   CDS             <2036859..2037191
FT                   /codon_start=1
FT                   /gene="1700006J14Rik"
FT                   /locus_tag="mCG_146002"
FT                   /product="RIKEN cDNA 1700006J14, isoform CRA_a"
FT                   /note="gene_id=mCG146002.1 transcript_id=mCT191990.0
FT                   protein_id=mCP112930.0 isoform=CRA_a"
FT                   /protein_id="EDL24404.1"
FT                   /translation="RCWPSLRMLYRFPYSPSISIFPLFSPHSHGSLLRKFIHFLPLIPC
FT                   PEWSLCSPPDAVGTVTTHDTQFSPMVHCFATRKKLFRTAHFEPAYTYNVYAYLHQGMIT
FT                   SQRSQC"
FT   assembly_gap    2040193..2040422
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    2044272..2044414
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            <2044423..2047639
FT                   /locus_tag="mCG_145402"
FT                   /note="gene_id=mCG145402.0"
FT   mRNA            join(<2044423..2044475,2044612..2044844,2045730..2047639)
FT                   /locus_tag="mCG_145402"
FT                   /product="mCG145402"
FT                   /note="gene_id=mCG145402.0 transcript_id=mCT184826.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2044674..2044844,2045730..2045924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145402"
FT                   /product="mCG145402"
FT                   /note="gene_id=mCG145402.0 transcript_id=mCT184826.0
FT                   protein_id=mCP105311.0"
FT                   /protein_id="EDL24405.1"
FT                   /translation="PVCGGHHTSTGKTGDLRWPCQSPSQGPLPRLWTQEMVPRAEKCSP
FT                   CGLSVQDYTKTRVWMRKASSKPVCYVLLLKLVTELKRAEREPQSSAVTPVRERNPGDAH
FT                   SETAMTHLVHIAVKQQY"
FT   assembly_gap    2054645..2054664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2064747..2064766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2071900..2071919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2074343..2074458
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    2087889..2087908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2150178..2150415
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    2156268..2156508
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    2162551..2162622
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2170328..2170353
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    2174860..2174879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2203873..2204191
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    2212611..2212630
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2226154..2226187
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    2229128..2229900
FT                   /estimated_length=773
FT                   /gap_type="unknown"
FT   assembly_gap    2253680..2253699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2266432..2266558
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    2269460..2269479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2273268..2273287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2292539..2292749
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    2296069..2296359
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    2325670..2325723
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    2336559..2336684
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    2338805..2338888
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    2343168..2343187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2357136..2357155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2361849..2362784
FT                   /estimated_length=936
FT                   /gap_type="unknown"
FT   assembly_gap    2364127..2364146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2365240..2365259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2371618..2372007
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    2378315..2378694
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    2379812..2380034
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    2390803..2391443
FT                   /estimated_length=641
FT                   /gap_type="unknown"
FT   assembly_gap    2403714..2403780
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    2413019..2413046
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            2424373..2437422
FT                   /locus_tag="mCG_140906"
FT                   /note="gene_id=mCG140906.0"
FT   mRNA            join(2424373..2424477,2429466..2429682,2436171..2437422)
FT                   /locus_tag="mCG_140906"
FT                   /product="mCG140906"
FT                   /note="gene_id=mCG140906.0 transcript_id=mCT172038.0
FT                   created on 15-AUG-2002"
FT   assembly_gap    2426867..2427001
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    2432517..2432536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             2437026..2437367
FT                   /codon_start=1
FT                   /locus_tag="mCG_140906"
FT                   /product="mCG140906"
FT                   /note="gene_id=mCG140906.0 transcript_id=mCT172038.0
FT                   protein_id=mCP94957.0"
FT                   /db_xref="GOA:Q9D5W2"
FT                   /db_xref="MGI:MGI:1918124"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5W2"
FT                   /protein_id="EDL24406.1"
FT                   /translation="MNINCCVDTEVLRNRASRSLSLTPTILLSKKTQSLSSFESYFLTC
FT                   LCLHPVRTPEKADDAKSLLALPSRLLPRPCEGSCQVWVMERAHLCLLEVSQGTLRGGAL
FT                   ENFQTTEAP"
FT   gene            complement(2442433..2529715)
FT                   /gene="Msrb3"
FT                   /locus_tag="mCG_10116"
FT                   /note="gene_id=mCG10116.1"
FT   mRNA            complement(join(2442433..2442779,2449941..2450038,
FT                   2483552..2483580,2508526..2508603,2510534..2510642,
FT                   2529590..2529715))
FT                   /gene="Msrb3"
FT                   /locus_tag="mCG_10116"
FT                   /product="methionine sulfoxide reductase B3"
FT                   /note="gene_id=mCG10116.1 transcript_id=mCT10362.0 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(2442609..2442779,2449941..2450038,
FT                   2483552..2483580,2508526..2508603,2510534..2510642,
FT                   2529590..2529665))
FT                   /codon_start=1
FT                   /gene="Msrb3"
FT                   /locus_tag="mCG_10116"
FT                   /product="methionine sulfoxide reductase B3"
FT                   /note="gene_id=mCG10116.1 transcript_id=mCT10362.0
FT                   protein_id=mCP7961.1"
FT                   /db_xref="GOA:A0A0R4J139"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="MGI:MGI:2443538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J139"
FT                   /protein_id="EDL24407.1"
FT                   /translation="MSAFNLLHLVTKSQPVAPRACGLPSGSCRDKKNCKVVFSQQELRK
FT                   RLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPAFHD
FT                   VISSEAIEFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSASLSFTPAD
FT                   SSEAEGSGIKESGSPAAADRAEL"
FT   assembly_gap    2453311..2453352
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    2484647..2484666
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2493340..2539508
FT                   /pseudo
FT                   /locus_tag="mCG_1048798"
FT                   /note="gene_id=mCG1048798.0"
FT   mRNA            join(2493340..2494518,2494656..2495012,2496653..2497613,
FT                   2497964..2498674,2539376..2539508)
FT                   /pseudo
FT                   /locus_tag="mCG_1048798"
FT                   /note="gene_id=mCG1048798.0 transcript_id=mCT166502.0
FT                   created on 15-AUG-2002"
FT   assembly_gap    2499894..2500027
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    2503784..2505886
FT                   /estimated_length=2103
FT                   /gap_type="unknown"
FT   assembly_gap    2538637..2538823
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    2554420..2555098
FT                   /estimated_length=679
FT                   /gap_type="unknown"
FT   gene            2555125..2557868
FT                   /locus_tag="mCG_1048799"
FT                   /note="gene_id=mCG1048799.1"
FT   mRNA            join(2555125..2555374,2557472..2557868)
FT                   /locus_tag="mCG_1048799"
FT                   /product="mCG1048799"
FT                   /note="gene_id=mCG1048799.1 transcript_id=mCT166503.1
FT                   created on 15-AUG-2002"
FT   CDS             join(2555367..2555374,2557472..2557661)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048799"
FT                   /product="mCG1048799"
FT                   /note="gene_id=mCG1048799.1 transcript_id=mCT166503.1
FT                   protein_id=mCP44334.1"
FT                   /protein_id="EDL24408.1"
FT                   /translation="MSRSILPWDRGTLANMDIGSPMGQRHTGKHGHRISHGTVAHWQTW
FT                   TSDLPWDSSTLANMDIGAGV"
FT   assembly_gap    2555639..2555712
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    2562653..2562695
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2567004..2567226
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   gene            complement(2581377..>2635454)
FT                   /locus_tag="mCG_10117"
FT                   /note="gene_id=mCG10117.2"
FT   mRNA            complement(join(2581377..2581712,2581923..2582001,
FT                   2582091..2582196,2584102..2584183,2587199..2587377,
FT                   2587878..2587980,2588085..2588186,2589961..2590106,
FT                   2590196..2590275,2603752..2603819,2605845..2605911,
FT                   2608766..2608803,2633806..2634733,2635032..>2635454))
FT                   /locus_tag="mCG_10117"
FT                   /product="mCG10117"
FT                   /note="gene_id=mCG10117.2 transcript_id=mCT10364.1 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(2581549..2581712,2581923..2582001,
FT                   2582091..2582196,2584102..2584183,2587199..2587377,
FT                   2587878..2587980,2588085..2588186,2589961..2590106,
FT                   2590196..2590275,2603752..2603819,2605845..2605911,
FT                   2608766..2608803,2633806..2634733,2635032..2635454))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10117"
FT                   /product="mCG10117"
FT                   /note="gene_id=mCG10117.2 transcript_id=mCT10364.1
FT                   protein_id=mCP7967.1"
FT                   /protein_id="EDL24409.1"
FT                   /translation="MAAATAAAAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLK
FT                   KLREEEQQQQQQQQQQQHRAGGRGNKTRNSNNNNTATAMGGRPGSGDLAYLRSPAGLGR
FT                   LSASAAESPVAGGSGGAAAVPAAGSKVLLGFSSDESDPPAAGSDGAAEDADEELADGED
FT                   RDPEAEEPLWASRTVNGSRLLPYSSCREHYSDSEEEEEEGEEDGDVAPARQVLKDDSLA
FT                   RHRPRRSHSKPFSALTAKSGGSRQETSVQGGGALAMNDRAAAAGSLDRSRNLEEAAAEP
FT                   GGGGGGGCGCDPVDSIPRYRAGAKKLAPLLSPPSPDGDSTLESPTGPLLKTNNHIGGGA
FT                   FGVDSPGLYANSLPPGATAAAAPGTLRINHANHTGSNHTYLKTAYGKPKLCEPEEELLQ
FT                   QFKREEVSPTGSFSAHYLSMFLLTAACLFFLILGLTYLGMRGTGVPEDGGLIKNPFDET
FT                   FGKIQESEKNLLMSTLYKLHDRLAQIAGDHECGSSSQRMLSVQEAAAYLKNLGPEYEDV
FT                   FNTSLLWIFKNGKDVGIRCVGYGPEEDLTNITDVQFLQSTRPQMPFWCRFRRAFITVTH
FT                   RLLLLCLGVVLVCVALRYMRYRWTKEEEETRQMYDMVVKIIDVLRSHNEACQETKDLQP
FT                   YMPLPHVRDSLIQPQDRKKMKKVWDRAVDFLAANESRVRTETRRVGGADFLVWRWIQPS
FT                   ASCDKTLVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDHWHLAIQEAI
FT                   LEKCSDNDGIVHIAVDRNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLD
FT                   RYHHRFPQALTCNTPLKPANKHMNSLSHLRLRTGLANSQGSS"
FT   gene            2584363..2585114
FT                   /pseudo
FT                   /locus_tag="mCG_113338"
FT                   /note="gene_id=mCG113338.1"
FT   mRNA            2584363..2585114
FT                   /pseudo
FT                   /locus_tag="mCG_113338"
FT                   /note="gene_id=mCG113338.1 transcript_id=mCT114420.1
FT                   created on 15-AUG-2002"
FT   assembly_gap    2589135..2589154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2620671..2621007
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    2634737..2635019
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   gene            complement(2640773..>2658709)
FT                   /locus_tag="mCG_1048800"
FT                   /note="gene_id=mCG1048800.0"
FT   mRNA            complement(join(2640773..2641155,2658614..>2658709))
FT                   /locus_tag="mCG_1048800"
FT                   /product="mCG1048800"
FT                   /note="gene_id=mCG1048800.0 transcript_id=mCT166504.0
FT                   created on 15-AUG-2002"
FT   CDS             complement(join(2641051..2641155,2658614..>2658658))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048800"
FT                   /product="mCG1048800"
FT                   /note="gene_id=mCG1048800.0 transcript_id=mCT166504.0
FT                   protein_id=mCP44348.0"
FT                   /protein_id="EDL24410.1"
FT                   /translation="VPNLTSFGDEQQCGSVSEKPKEISDQLGPFQEKLHSLAVVASELK
FT                   SSRS"
FT   assembly_gap    2651347..2651541
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    2652184..2654532
FT                   /estimated_length=2349
FT                   /gap_type="unknown"
FT   assembly_gap    2668955..2669066
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    2681775..2682325
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    2684117..2684469
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    2690653..2690719
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            2692080..2758343
FT                   /gene="Wif1"
FT                   /locus_tag="mCG_10113"
FT                   /note="gene_id=mCG10113.1"
FT   mRNA            join(2692080..2692340,2692795..2692934,2733037..2733145,
FT                   2739917..2740057,2741679..2741774,2742700..2742795,
FT                   2747931..2748026,2753697..2753792,2754339..2754434,
FT                   2757460..2758343)
FT                   /gene="Wif1"
FT                   /locus_tag="mCG_10113"
FT                   /product="Wnt inhibitory factor 1"
FT                   /note="gene_id=mCG10113.1 transcript_id=mCT10360.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(2692193..2692340,2692795..2692934,2733037..2733145,
FT                   2739917..2740057,2741679..2741774,2742700..2742795,
FT                   2747931..2748026,2753697..2753792,2754339..2754434,
FT                   2757460..2757581)
FT                   /codon_start=1
FT                   /gene="Wif1"
FT                   /locus_tag="mCG_10113"
FT                   /product="Wnt inhibitory factor 1"
FT                   /note="gene_id=mCG10113.1 transcript_id=mCT10360.1
FT                   protein_id=mCP7949.1"
FT                   /db_xref="GOA:Q3TYU1"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR003306"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013309"
FT                   /db_xref="MGI:MGI:1344332"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TYU1"
FT                   /protein_id="EDL24411.1"
FT                   /translation="MARRRAFPAFALRLWSILPCLLLLRADAGQPPEESLYLWIDAHQA
FT                   RVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFL
FT                   SLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNT
FT                   ILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGG
FT                   LCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQP
FT                   CRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKR
FT                   YGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIW"
FT   assembly_gap    2718058..2718077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2727806..2728102
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    2750736..2750755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2752373..2752392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2767903..2769151
FT                   /estimated_length=1249
FT                   /gap_type="unknown"
FT   assembly_gap    2776057..2776076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2777134..2777746
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    2780795..2780972
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    2783854..2790349
FT                   /estimated_length=6496
FT                   /gap_type="unknown"
FT   assembly_gap    2791800..2792678
FT                   /estimated_length=879
FT                   /gap_type="unknown"
FT   assembly_gap    2819339..2819358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2820525..2820544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2822936..2822955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2824062..2849361
FT                   /estimated_length=25300
FT                   /gap_type="unknown"
FT   assembly_gap    2852460..2852479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2895826..>2896668
FT                   /locus_tag="mCG_57215"
FT                   /note="gene_id=mCG57215.1"
FT   mRNA            join(2895826..2895863,2896136..2896242,2896358..>2896668)
FT                   /locus_tag="mCG_57215"
FT                   /product="mCG57215"
FT                   /note="gene_id=mCG57215.1 transcript_id=mCT57398.1 created
FT                   on 15-AUG-2002"
FT   CDS             2896467..>2896668
FT                   /codon_start=1
FT                   /locus_tag="mCG_57215"
FT                   /product="mCG57215"
FT                   /note="gene_id=mCG57215.1 transcript_id=mCT57398.1
FT                   protein_id=mCP30329.2"
FT                   /protein_id="EDL24412.1"
FT                   /translation="MLLHDYNCRLEEALKPGNEKEMNHITLPSGPWTVCLYGRQEATLW
FT                   KGSSVRHDLTCGSVFLSGIFSL"
FT   assembly_gap    2910487..2910506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2911943..2911962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2913014..2914067
FT                   /estimated_length=1054
FT                   /gap_type="unknown"
FT   assembly_gap    2915957..2915976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2921785..>2976190)
FT                   /locus_tag="mCG_10118"
FT                   /note="gene_id=mCG10118.2"
FT   mRNA            complement(join(2921785..2923924,2928236..2928442,
FT                   2931978..2932117,2935179..2935291,2948235..2948336,
FT                   2954006..2954175,2956113..2956257,2967063..2967248,
FT                   2969485..2969610,2971309..2971374,2971975..2972036,
FT                   2975813..2976165))
FT                   /locus_tag="mCG_10118"
FT                   /product="mCG10118, transcript variant mCT10365"
FT                   /note="gene_id=mCG10118.2 transcript_id=mCT10365.2 created
FT                   on 15-AUG-2002"
FT   mRNA            complement(join(2921969..2923924,2928236..2928442,
FT                   2931978..2932117,2935179..2935291,2948235..2948340,
FT                   2954006..2954175,2956113..2956281,2967063..2967248,
FT                   2969485..2969610,2971309..2971374,2971975..2972036,
FT                   2975813..>2976190))
FT                   /locus_tag="mCG_10118"
FT                   /product="mCG10118, transcript variant mCT191999"
FT                   /note="gene_id=mCG10118.2 transcript_id=mCT191999.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2923632..2923924,2928236..2928442,
FT                   2931978..2932117,2935179..2935291,2948235..2948336,
FT                   2954006..2954175,2956113..2956257,2967063..2967248,
FT                   2969485..2969610,2971309..2971374,2971975..2972036,
FT                   2975813..2975969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10118"
FT                   /product="mCG10118, isoform CRA_b"
FT                   /note="gene_id=mCG10118.2 transcript_id=mCT10365.2
FT                   protein_id=mCP7970.2 isoform=CRA_b"
FT                   /protein_id="EDL24414.1"
FT                   /translation="MRQDKLTGSLRRGGRCLKRQGGGGVGTILSNVLKKRSCISRTAPR
FT                   LLCTLEPGVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHY
FT                   LHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVL
FT                   LAYARWNKNVGYCQGFNILAALILEVMEGNEGDALKVLPESYFVNNLRALSVDMAVFRD
FT                   LLRLKLPELSQHLDTLQRTANKESGGGYEPPLTNVFTMQWFLTLFATCLPNHTVLKIWD
FT                   SVFFEGSEIIPEGVAGHLGKAGRIECCETADEFYGTMGRLTQEMLEQDLLQSHELMQTV
FT                   YSMAPFPFPQLAELREKYTYNITPFPATIKPTSVSGRHSKARDSDDENGPDDEDAVASA
FT                   VGCLGPLSGLLAPELQKYQKQIKEATEEQTLRSNNIAELSPGAINSCRSEYHAAFNSMM
FT                   MERMTTDINALKRQYSRIKKKQQQQLHQVYIRADKGPVTSILPSQANSSPVINHLLLGK
FT                   KMKITNRAAKNAVIHVPGHPGGKISPVPYEDIKTKLNFSMADSHPSPQKEHAEDQESSR
FT                   LRRHGRADRRTE"
FT   assembly_gap    2924472..2924609
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    2934873..2935042
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    2938566..2938585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2939781..2939800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2941236..2941255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(2948245..2948340,2954006..2954175,
FT                   2956113..2956281,2967063..2967248,2969485..2969610,
FT                   2971309..2971374,2971975..2972036,2975813..>2976188))
FT                   /codon_start=1
FT                   /locus_tag="mCG_10118"
FT                   /product="mCG10118, isoform CRA_a"
FT                   /note="gene_id=mCG10118.2 transcript_id=mCT191999.0
FT                   protein_id=mCP112918.0 isoform=CRA_a"
FT                   /protein_id="EDL24413.1"
FT                   /translation="SAVRAPHCRCQPVSRSSAAFSDPLDSRSSGCALATLQGASPAWTR
FT                   RALREESFRRRSRSRSSSEQPGGGRRCRMRQDKLTGSLRRGGRCLKRQGGGGVGTILSN
FT                   VLKKRSCISRTAPRLLCTLEPGVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPK
FT                   EWRRKVWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCG
FT                   QEAEQDRVVLKRVLLAYARWNKNVGYCQGFNILAALILEVMEGNEGDALKIMIYLIDKV
FT                   LPESYFVNNLRALSVDMAVFRDLLRLKLPELSQHLDTLQRTANKESGGGYEPPLTNVFT
FT                   MQWFLTLFATCLPNHTVLKIWDSVFFEGSEIIPEGVAGHLGKAGRADRMLRDSRRILRH
FT                   HGAPHPGDARAGSATEP"
FT   assembly_gap    2949956..2950349
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    2959842..2959861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2961032..2961051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2962735..2962754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2965473..2965641
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    2984323..2984342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3006193..3006269
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   gene            3008270..3008836
FT                   /pseudo
FT                   /locus_tag="mCG_10114"
FT                   /note="gene_id=mCG10114.0"
FT   mRNA            3008270..3008836
FT                   /pseudo
FT                   /locus_tag="mCG_10114"
FT                   /note="gene_id=mCG10114.0 transcript_id=mCT10361.0 created
FT                   on 15-AUG-2002"
FT   gene            complement(<3012232..>3016511)
FT                   /locus_tag="mCG_51016"
FT                   /note="gene_id=mCG51016.1"
FT   mRNA            complement(join(<3012232..3012398,3016151..>3016511))
FT                   /locus_tag="mCG_51016"
FT                   /product="mCG51016"
FT                   /note="gene_id=mCG51016.1 transcript_id=mCT51199.1 created
FT                   on 15-AUG-2002"
FT   CDS             complement(join(<3012232..3012398,3016151..3016511))
FT                   /codon_start=1
FT                   /locus_tag="mCG_51016"
FT                   /product="mCG51016"
FT                   /note="gene_id=mCG51016.1 transcript_id=mCT51199.1
FT                   protein_id=mCP30333.1"
FT                   /protein_id="EDL24415.1"
FT                   /translation="MEVLPAGRTWDPQQSEEAAGHPADEGDLEPQPDGRTSRTASLVSG
FT                   LLTELYSCTEEEEVAAGGDRASQGRPLRRDSLDSSTETSGSDAFLGGRGAGDSRVLQEL
FT                   RERPSLRLQMQYLQRKDSSELKTVLRELKYRIGIQSAKLLRQLKQKDRLLHKVQKNCDI
FT                   VTACLQAVSQKRS"
FT   assembly_gap    3023305..3023621
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   gene            <3030194..3070709
FT                   /gene="Gns"
FT                   /locus_tag="mCG_10112"
FT                   /note="gene_id=mCG10112.2"
FT   mRNA            join(<3030194..3030463,3036246..3036305,3039446..3039652,
FT                   3041296..3041361,3041724..3041822,3043110..3043277,
FT                   3045206..3045288,3046261..3046379,3048428..3048531,
FT                   3059473..3059574,3061996..3062103,3062742..3062852,
FT                   3066144..3066304,3068511..3070708)
FT                   /gene="Gns"
FT                   /locus_tag="mCG_10112"
FT                   /product="glucosamine (N-acetyl)-6-sulfatase, transcript
FT                   variant mCT191988"
FT                   /note="gene_id=mCG10112.2 transcript_id=mCT191988.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(3030197..3030463,3036246..3036305,3039446..3039652,
FT                   3041296..3041361,3041724..3041822,3043110..3043277,
FT                   3045206..3045288,3046261..3046379,3048428..3048531,
FT                   3056737..3056838,3059473..3059574,3061996..3062103,
FT                   3062742..3062852,3064626..3064733,3066144..3066304,
FT                   3068511..3070709)
FT                   /gene="Gns"
FT                   /locus_tag="mCG_10112"
FT                   /product="glucosamine (N-acetyl)-6-sulfatase, transcript
FT                   variant mCT10359"
FT                   /note="gene_id=mCG10112.2 transcript_id=mCT10359.1 created
FT                   on 15-AUG-2002"
FT   CDS             join(<3030206..3030463,3036246..3036305,3039446..3039652,
FT                   3041296..3041361,3041724..3041822,3043110..3043277,
FT                   3045206..3045288,3046261..3046379,3048428..3048531,
FT                   3059473..3059574,3061996..3062103,3062742..3062852,
FT                   3066144..3066304,3068511..3068589)
FT                   /codon_start=1
FT                   /gene="Gns"
FT                   /locus_tag="mCG_10112"
FT                   /product="glucosamine (N-acetyl)-6-sulfatase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG10112.2 transcript_id=mCT191988.0
FT                   protein_id=mCP112916.0 isoform=CRA_b"
FT                   /protein_id="EDL24417.1"
FT                   /translation="SRLGRESLTPSPALTGVSPQLSVPPRSLAAMRLPSAAGPRPGRPR
FT                   RLPALLLLPLLGGCLGLVGAARRPNVLLLLTDDQDAELGGMTPLKKTKALIGEKGMTFS
FT                   SAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKAWQKIQEPYTFPAILKSVCG
FT                   YQTFFAGKYLNEYGAPDAGGLEHIPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYS
FT                   VDYLTDVLANLSLDFLDYKSNSEPFFMMISTPAPHSPWTAAPQYQKAFQNVIAPRNKNF
FT                   NIHGTNKHWLIRQAKTPMTNSSIRFLDDAFRRRWQTLLSVDDLVEKLVKRLDSTGELDN
FT                   TYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVSNIDLGPT
FT                   ILDLAGYDLNKTQMDGMSLLPILKGDRNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVS
FT                   QCFPDCVCEDAYNNTYACVRTLSSLWNLQYCEFDDQEVFVEVYNITADPDQITNIAKSI
FT                   DPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDLRLMFNSHGSVRTRRFSKHPL"
FT   CDS             join(3030296..3030463,3036246..3036305,3039446..3039652,
FT                   3041296..3041361,3041724..3041822,3043110..3043277,
FT                   3045206..3045288,3046261..3046379,3048428..3048531,
FT                   3056737..3056838,3059473..3059574,3061996..3062103,
FT                   3062742..3062852,3064626..3064733,3066144..3066304,
FT                   3068511..3068589)
FT                   /codon_start=1
FT                   /gene="Gns"
FT                   /locus_tag="mCG_10112"
FT                   /product="glucosamine (N-acetyl)-6-sulfatase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG10112.2 transcript_id=mCT10359.1
FT                   protein_id=mCP7957.2 isoform=CRA_a"
FT                   /protein_id="EDL24416.1"
FT                   /translation="MRLPSAAGPRPGRPRRLPALLLLPLLGGCLGLVGAARRPNVLLLL
FT                   TDDQDAELGGMTPLKKTKALIGEKGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNN
FT                   TLEGNCSSKAWQKIQEPYTFPAILKSVCGYQTFFAGKYLNEYGAPDAGGLEHIPLGWSY
FT                   WYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANLSLDFLDYKSNSEPFFMMIS
FT                   TPAPHSPWTAAPQYQKAFQNVIAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIRFLDDAF
FT                   RRRWQTLLSVDDLVEKLVKRLDSTGELDNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDI
FT                   KVPLLVRGPGIKPNQTSKMLVSNIDLGPTILDLAGYDLNKTQMDGMSLLPILMLVSNID
FT                   LGPTILDLAGYDLNKTQMDGMSLLPILKGDRNLTWRSDVLVEYQGEGRNVTDPTCPSLS
FT                   PGVSQCFPDCVCEDAYNNTYACVRTLSSLWNLQYCEFDDQEKGDRNLTWRSDVLVEYQG
FT                   EGRNVTDPTCPSLSPGVSVFVEVYNITADPDQITNIAKSIDPELLGKMNYRLMMLQSCS
FT                   GPTCRTPGVFDPGYRFDLRLMFNSHGSVRTRRFSKHPL"
FT   assembly_gap    3050371..3050488
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    3051942..3051961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3053266..3053285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3054553..3054572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3056327..3056346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3057856..3057875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3063404..3063423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3065252..3065271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3077673..3077692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3084048..3153903)
FT                   /gene="Rassf3"
FT                   /locus_tag="mCG_49016"
FT                   /note="gene_id=mCG49016.1"
FT   mRNA            complement(join(3084048..3086779,3088116..3088198,
FT                   3090713..3090935,3091724..3091831,3153634..3153903))
FT                   /gene="Rassf3"
FT                   /locus_tag="mCG_49016"
FT                   /product="Ras association (RalGDS/AF-6) domain family 3"
FT                   /note="gene_id=mCG49016.1 transcript_id=mCT49199.2 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(3086630..3086779,3088116..3088198,
FT                   3090713..3090935,3091724..3091831,3153634..3153741))
FT                   /codon_start=1
FT                   /gene="Rassf3"
FT                   /locus_tag="mCG_49016"
FT                   /product="Ras association (RalGDS/AF-6) domain family 3"
FT                   /note="gene_id=mCG49016.1 transcript_id=mCT49199.2
FT                   protein_id=mCP30316.2"
FT                   /protein_id="EDL24418.1"
FT                   /translation="MSSGYSSLEEDEDFFFTARTSFFRRAPPGKSRSGQPDVEKEKETH
FT                   NYLSKEEIKEKVHKYNSAVTDKLKMTLNSNGIYTGFIKVQMELCKPAQPSPEPSSGGCM
FT                   NTLHISSTNTVGEVIEALLRKFLVTESPTKFALYKRCHREDQEHPLYLRLVAGPRTDTL
FT                   SFVLREHEIGEWEAFSLPELQNFLRILDKEEDEQLQSLKRRYTAYRQKLEEALGEVWKP
FT                   G"
FT   assembly_gap    3088206..3088225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3089838..3089857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3112081..3114009
FT                   /estimated_length=1929
FT                   /gap_type="unknown"
FT   assembly_gap    3115268..3115287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3117363..3117382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3118576..3118595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3123151..3123256
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    3150767..3151142
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    3155875..3155894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3158659..3158678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3159631..3160346
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    3162292..3163967
FT                   /estimated_length=1676
FT                   /gap_type="unknown"
FT   assembly_gap    3172895..3173097
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    3176505..3176764
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    3177221..3177321
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    3181913..3182042
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    3183444..3183463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3184327..3203831
FT                   /locus_tag="mCG_1048803"
FT                   /note="gene_id=mCG1048803.0"
FT   mRNA            join(<3184327..3184450,3188148..3188438,3203364..3203831)
FT                   /locus_tag="mCG_1048803"
FT                   /product="mCG1048803"
FT                   /note="gene_id=mCG1048803.0 transcript_id=mCT166507.1
FT                   created on 15-AUG-2002"
FT   CDS             join(<3184328..3184450,3188148..3188297)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048803"
FT                   /product="mCG1048803"
FT                   /note="gene_id=mCG1048803.0 transcript_id=mCT166507.1
FT                   protein_id=mCP44386.1"
FT                   /protein_id="EDL24419.1"
FT                   /translation="DLGLLIASSRQQGSQVCLTCDPQLRLCRAKDEAKGSADARQASLK
FT                   SICPTVASPSCCLEASGGGERINYPTSAAAACAPATPMKLRLMWT"
FT   assembly_gap    3190687..3190706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3193628..3194750
FT                   /estimated_length=1123
FT                   /gap_type="unknown"
FT   assembly_gap    3205674..3205693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3213338..3213390
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    3218693..3219250
FT                   /estimated_length=558
FT                   /gap_type="unknown"
FT   gene            complement(3224377..3260479)
FT                   /gene="Tbk1"
FT                   /locus_tag="mCG_10115"
FT                   /note="gene_id=mCG10115.1"
FT   mRNA            complement(join(3224377..3224955,3229298..3229369,
FT                   3229534..3229640,3230247..3230343,3230455..3230556,
FT                   3231076..3231115,3231792..3231868,3231950..3232071,
FT                   3234027..3234105,3235242..3235343,3238127..3238218,
FT                   3238521..3238579,3239887..3240083,3245418..3245597,
FT                   3246934..3247044,3249536..3249696,3250748..3250929,
FT                   3253638..3253767,3255494..3255634,3260355..3260479))
FT                   /gene="Tbk1"
FT                   /locus_tag="mCG_10115"
FT                   /product="TANK-binding kinase 1, transcript variant
FT                   mCT10363"
FT                   /note="gene_id=mCG10115.1 transcript_id=mCT10363.0 created
FT                   on 07-AUG-2002"
FT   mRNA            complement(join(<3224904..3224955,3229298..3229369,
FT                   3229534..3229640,3230247..3230343,3230455..3230556,
FT                   3231076..3231115,3231792..3231868,3231950..3232071,
FT                   3234027..3234105,3235242..3235343,3238127..3238218,
FT                   3238521..3238579,3239887..3240083,3242240..3242419,
FT                   3246934..3247044,3249536..3249696,3250748..3250929,
FT                   3253638..3253767,3255494..3255634,3260355..>3260452))
FT                   /gene="Tbk1"
FT                   /locus_tag="mCG_10115"
FT                   /product="TANK-binding kinase 1, transcript variant
FT                   mCT191998"
FT                   /note="gene_id=mCG10115.1 transcript_id=mCT191998.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3224904..3224955,3229298..3229369,
FT                   3229534..3229640,3230247..3230343,3230455..3230556,
FT                   3231076..3231115,3231792..3231868,3231950..3232071,
FT                   3234027..3234105,3235242..3235343,3238127..3238218,
FT                   3238521..3238579,3239887..3240083,3242240..3242419,
FT                   3246934..3247044,3249536..3249696,3250748..3250929,
FT                   3253638..3253767,3255494..3255634,3260355..>3260450))
FT                   /codon_start=1
FT                   /gene="Tbk1"
FT                   /locus_tag="mCG_10115"
FT                   /product="TANK-binding kinase 1, isoform CRA_b"
FT                   /note="gene_id=mCG10115.1 transcript_id=mCT191998.0
FT                   protein_id=mCP112917.0 isoform=CRA_b"
FT                   /protein_id="EDL24421.1"
FT                   /translation="QAEMQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNN
FT                   ISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEP
FT                   SNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGA
FT                   ARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSL
FT                   PFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLT
FT                   PVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHE
FT                   LVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEK
FT                   ISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYN
FT                   ETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGT
FT                   IESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAER
FT                   RLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLS
FT                   LTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMK
FT                   KLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL"
FT   CDS             complement(join(3224904..3224955,3229298..3229369,
FT                   3229534..3229640,3230247..3230343,3230455..3230556,
FT                   3231076..3231115,3231792..3231868,3231950..3232071,
FT                   3234027..3234105,3235242..3235343,3238127..3238218,
FT                   3238521..3238579,3239887..3240083,3245418..3245597,
FT                   3246934..3247044,3249536..3249696,3250748..3250929,
FT                   3253638..3253767,3255494..3255634,3260355..3260441))
FT                   /codon_start=1
FT                   /gene="Tbk1"
FT                   /locus_tag="mCG_10115"
FT                   /product="TANK-binding kinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG10115.1 transcript_id=mCT10363.0
FT                   protein_id=mCP7954.1 isoform=CRA_a"
FT                   /db_xref="GOA:A1L361"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1929658"
FT                   /db_xref="UniProtKB/TrEMBL:A1L361"
FT                   /protein_id="EDL24420.1"
FT                   /translation="MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISF
FT                   LRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNA
FT                   YGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARE
FT                   LEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFR
FT                   PFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVL
FT                   ANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVY
FT                   KQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISL
FT                   PKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETV
FT                   HKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIES
FT                   SLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLA
FT                   YNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTN
FT                   QCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLK
FT                   EEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL"
FT   assembly_gap    3228424..3228443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3245069..3245088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3262709..3262728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3264933..3298042)
FT                   /locus_tag="mCG_114193"
FT                   /note="gene_id=mCG114193.1"
FT   mRNA            complement(join(3264933..3266379,3273100..3273216,
FT                   3274086..3274275,3274885..3275170,3276200..3276438,
FT                   3277436..3277505,3278095..3278189,3278575..3278694,
FT                   3278853..3278997,3279365..3279489,3280985..3281047,
FT                   3281561..3281599,3283232..3283468,3284905..3285073,
FT                   3285169..3285353,3286665..3286910,3288300..3288369,
FT                   3288817..3288873,3290778..3290860,3294565..3294698,
FT                   3297829..3298042))
FT                   /locus_tag="mCG_114193"
FT                   /product="mCG114193"
FT                   /note="gene_id=mCG114193.1 transcript_id=mCT115285.1
FT                   created on 15-AUG-2002"
FT   CDS             complement(join(3266123..3266379,3273100..3273216,
FT                   3274086..3274275,3274885..3275170,3276200..3276438,
FT                   3277436..3277505,3278095..3278189,3278575..3278694,
FT                   3278853..3278997,3279365..3279489,3280985..3281047,
FT                   3281561..3281599,3283232..3283468,3284905..3285073,
FT                   3285169..3285353,3286665..3286910,3288300..3288369,
FT                   3288817..3288873,3290778..3290860,3294565..3294624))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114193"
FT                   /product="mCG114193"
FT                   /note="gene_id=mCG114193.1 transcript_id=mCT115285.1
FT                   protein_id=mCP44621.1"
FT                   /protein_id="EDL24422.1"
FT                   /translation="MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQK
FT                   TYSDDHVKFFCFQVLEHQVKYKYSELSTAQQQLIRETLLSWLQAQMQNPQPEKTFIRNK
FT                   AAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSE
FT                   ASGLECMAGEARRNTLIKDTMREQCIPNLVESWYQILHNYQYTNSEVLCQCLEVVGAYV
FT                   SWIDLSLIANDRFINMLLGHMSVEVLREEACDCLFEIVNKGMDPVDKMKLVESLCQVLQ
FT                   TAGFFSIDQEEDLDFVARFSKLVNGMGQSLIVSWTKLIKNGAVKNAQEALEAIETKVPL
FT                   MLQLLVHEDDDISSNIIGFCYDYLHILKQLPVLSDQQKANVEAIMLAVMKKLTYDEEYN
FT                   FENEGEDEAMFVEYRKQLKLLLDRLAQVSPELVLASVRRVFSATLQNWQTTRFMEVEVA
FT                   VRLLYMLAEALPVSHGAHFSGDVSKASALQDMMRTLVTSGVSSYQHTSVTLEFFETVVR
FT                   YEKFFTVEPQHIPCVLMAFLDHRGLWHSSAKVRSRTAYLFSRFVKSLNKQMNPYIEEIL
FT                   NRIQDLLALSPPENGYQSLLSSDDQLFIYETAGALIVNSEYPAENKQALMKDLLTPLME
FT                   RFKVLLEKLMMAQDEERQASLADSLNHAVGFASRTSKAFSNKQTVKQCGCSQVYLDCLQ
FT                   TFLPALSCPLQKDVLRSGVRTFLHRMIICLEEEVLPFIPSASEHMLKDCEAKDLQEFIP
FT                   LINQITAKFKMQVSPFLQQMFMPLLHAIFEVLLRPAEDNDQSAALEKQMLRRSYFAFLQ
FT                   TVTGSGMSEVIANQGAENVERVLVTIIQGAVDYPDPIAQKTCFIILSKLVELWGVLPES
FT                   KTLRTGPPGPCHDQELQFIIYKEAVCVCVGVCVLASAIHTGPLALFPSYCSVCGIFCKM
FT                   GVIFPLKRCVTTREVACMPV"
FT   assembly_gap    3268018..3268037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3269337..3272848
FT                   /estimated_length=3512
FT                   /gap_type="unknown"
FT   assembly_gap    3280835..3280854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3282422..3283056
FT                   /estimated_length=635
FT                   /gap_type="unknown"
FT   assembly_gap    3286009..3286028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3305018..3305204
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   gene            <3313391..3347364
FT                   /locus_tag="mCG_10106"
FT                   /note="gene_id=mCG10106.2"
FT   mRNA            join(<3313391..3313470,3334779..3334851,3342043..3342290,
FT                   3344780..3344853,3347315..3347364)
FT                   /locus_tag="mCG_10106"
FT                   /product="mCG10106"
FT                   /note="gene_id=mCG10106.2 transcript_id=mCT10143.2 created
FT                   on 15-AUG-2002"
FT   CDS             join(<3313446..3313470,3334779..3334851,3342043..3342290,
FT                   3344780..3344826)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10106"
FT                   /product="mCG10106"
FT                   /note="gene_id=mCG10106.2 transcript_id=mCT10143.2
FT                   protein_id=mCP7958.2"
FT                   /protein_id="EDL24423.1"
FT                   /translation="SCSAHRCVVKQENNGPTFWRRKVSRTLNESSLRSQQESSTPFKDP
FT                   TSHPSDLKELSPAGQGTSRPLPTLSSCQSMAATDMPVCSLSLASSTNEPQELPDPRDAP
FT                   REGSFRLDGNQKSHSFTGSSMCQRAQ"
FT   assembly_gap    3323877..3323896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3325202..3325221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3334002..3334631
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    3337651..3337670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3339133..3339152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3342307..3344510
FT                   /estimated_length=2204
FT                   /gap_type="unknown"
FT   assembly_gap    3351301..3351320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3364482..3364501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3365735..3365754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3385498..3389461
FT                   /estimated_length=3964
FT                   /gap_type="unknown"
FT   assembly_gap    3394019..3394038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3415798..3415817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3417785..3429350
FT                   /gene="BC048403"
FT                   /locus_tag="mCG_10107"
FT                   /note="gene_id=mCG10107.1"
FT   mRNA            join(3417785..3418049,3423166..3423451,3428145..3429350)
FT                   /gene="BC048403"
FT                   /locus_tag="mCG_10107"
FT                   /product="cDNA sequence BC048403, transcript variant
FT                   mCT10144"
FT                   /note="gene_id=mCG10107.1 transcript_id=mCT10144.2 created
FT                   on 15-AUG-2002"
FT   mRNA            join(3417786..3418049,3423333..3423451,3428145..3428449)
FT                   /gene="BC048403"
FT                   /locus_tag="mCG_10107"
FT                   /product="cDNA sequence BC048403, transcript variant
FT                   mCT172030"
FT                   /note="gene_id=mCG10107.1 transcript_id=mCT172030.0 created
FT                   on 15-AUG-2002"
FT   CDS             join(3417815..3418049,3423166..3423451,3428145..3428961)
FT                   /codon_start=1
FT                   /gene="BC048403"
FT                   /locus_tag="mCG_10107"
FT                   /product="cDNA sequence BC048403, isoform CRA_a"
FT                   /note="gene_id=mCG10107.1 transcript_id=mCT10144.2
FT                   protein_id=mCP7943.2 isoform=CRA_a"
FT                   /protein_id="EDL24424.1"
FT                   /translation="MGESIPLAAPVPVEQAVLETFFSHLGIFSYDKAKDNVEKEREANK
FT                   SAGGSWLSLLAALAHLAAAEKVYHSLTYLGQKLGGQSFFSRKDSIRTIYTSLHNELKKV
FT                   VAGRGAPGGTAPHVEELLPHLSEQLCFFVQARMEIADFYEKMYALSTQKFINTEELVST
FT                   LDTILKKYSSRFHHPILSPLESSFQLEVGVLSHLLKAQAQISEWKFLPSLVTLHNAHTK
FT                   LQSWGQTFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKTMLLAKFSFYFHEALSRQT
FT                   TASEMKALTAKANPDLFGKISSFIRKYDAANVSLIFDNRGSESFQGHGYHHPHSYREAP
FT                   KGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRASDLNSLEKVVHFYDDKVQSTYFLTRPE
FT                   PHFTIVVIFESKKSERDSHFISFLNELSLALKNPKVFASLKPGSKG"
FT   CDS             join(3417815..3418049,3423333..3423451,3428145..3428315)
FT                   /codon_start=1
FT                   /gene="BC048403"
FT                   /locus_tag="mCG_10107"
FT                   /product="cDNA sequence BC048403, isoform CRA_b"
FT                   /note="gene_id=mCG10107.1 transcript_id=mCT172030.0
FT                   protein_id=mCP94949.0 isoform=CRA_b"
FT                   /protein_id="EDL24425.1"
FT                   /translation="MGESIPLAAPVPVEQAVLETFFSHLGIFSYDKAKDNVEKEREANK
FT                   SAGGSWLSLLAALAHLAAAEKVYHSLTYLGQKLGSDGDRRLLREDVRPQHTEVHQHRRA
FT                   GQHLGYHPQEVQLQVSPPHPQPSGEQFPAGSGRAESSPQGAGADLGVEVPPVPGYLAQR
FT                   SHEASELGPDL"
FT   assembly_gap    3429352..3429371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3433562..3433581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3435856..3436098
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    3441510..3441529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3446261..3446280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3449557..3449576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3451508..3454104
FT                   /estimated_length=2597
FT                   /gap_type="unknown"
FT   gene            complement(3463233..3610852)
FT                   /locus_tag="mCG_114195"
FT                   /note="gene_id=mCG114195.0"
FT   mRNA            complement(join(3463233..3463769,3470200..3470539,
FT                   3470669..3470803,3472621..3472801,3478826..3478905,
FT                   3482805..3483029,3485853..3485958,3500977..3501111,
FT                   3503354..3503431,3503572..3503632,3506657..3506690,
FT                   3509814..3509841,3518035..3518119,3518770..3518967,
FT                   3531620..3531721,3533274..3533495,3548301..3548429,
FT                   3548912..3549094,3575349..3575411,3605151..3605313,
FT                   3610657..3610852))
FT                   /locus_tag="mCG_114195"
FT                   /product="mCG114195"
FT                   /note="gene_id=mCG114195.0 transcript_id=mCT115287.1
FT                   created on 31-OCT-2002"
FT   CDS             complement(join(3463392..3463769,3470200..3470539,
FT                   3470669..3470803,3472621..3472801,3478826..3478905,
FT                   3482805..3483029,3485853..3485958,3500977..3501111,
FT                   3503354..3503431,3503572..3503632,3506657..3506690,
FT                   3509814..3509841,3518035..3518119,3518770..3518967,
FT                   3531620..3531721,3533274..3533495,3548301..3548429,
FT                   3548912..3549094,3575349..3575411,3605151..3605313,
FT                   3610657..3610799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114195"
FT                   /product="mCG114195"
FT                   /note="gene_id=mCG114195.0 transcript_id=mCT115287.1
FT                   protein_id=mCP44430.1"
FT                   /protein_id="EDL24426.1"
FT                   /translation="MRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTKDHQ
FT                   QFKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKKSK
FT                   EIAFQLHEDLMKVLNELYTVMKTYHMYHSESISAESKLKEAEKQEEKQIGRSGDPVFHI
FT                   RLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDL
FT                   SDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRSDKQRFMEM
FT                   YPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRNQQLQSRLATLKIESEEVKKTT
FT                   EATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYLSKPSIAKRRANQQETEQFY
FT                   FMKLREFLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTSRGRRNSHARHQDSGQVIPL
FT                   IVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENPLSDEQSNHDINSVAGVL
FT                   KLYFRGLENPLFPKERFTDLISCIRIDNLYERALHIRKLLLTLPRSVLIVMRYLFAFLN
FT                   HLSQYSDENMMDPYNLAICFGPTLMPVPEIQDQVSCQAHVNEIVKTIIIHHETIFPDAK
FT                   ELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECEPIEAIAKFDYVGR
FT                   SARELSFKKGASLLLYHRASEDWWEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADS
FT                   EASSGPVTEDKSSSKDMNSPTDRHSDSYLARQRKRGEPPPPGRRPGRTSDGHCPLHPPH
FT                   ALSNSSIDLGSPNLASHPRGLLQNRGLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPP
FT                   IRRSTSSGQYTGFNDHKPLDPETIAQDIEETMNTALNELRELERQSTVKHAPDVVLDTL
FT                   EQVKNSPTPATSTESLSPLHNVALRGSEPQIRRSTSSSSETMSTFKPMVAPRMGVQLKP
FT                   PALRPKPAVLPKTNPTMGPAAPSQGPTDKSCTM"
FT   assembly_gap    3513516..3513647
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    3535785..3536494
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    3537650..3539151
FT                   /estimated_length=1502
FT                   /gap_type="unknown"
FT   assembly_gap    3554950..3555273
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    3567757..3568931
FT                   /estimated_length=1175
FT                   /gap_type="unknown"
FT   assembly_gap    3578874..3578893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3580725..3580744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3588684..3588703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3615267..3615286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3620936..3620955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3622573..3622592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3655018..3655056
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    3674044..3674063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3676849..3676868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3699298..3699317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3707037..3707056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3729836..3729908
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    3733523..3733542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3748493..>3749260
FT                   /locus_tag="mCG_57219"
FT                   /note="gene_id=mCG57219.1"
FT   mRNA            <3748493..>3749260
FT                   /locus_tag="mCG_57219"
FT                   /product="mCG57219"
FT                   /note="gene_id=mCG57219.1 transcript_id=mCT57402.1 created
FT                   on 15-AUG-2002"
FT   CDS             <3748493..>3749260
FT                   /codon_start=1
FT                   /locus_tag="mCG_57219"
FT                   /product="mCG57219"
FT                   /note="gene_id=mCG57219.1 transcript_id=mCT57402.1
FT                   protein_id=mCP30309.1"
FT                   /protein_id="EDL24427.1"
FT                   /translation="GSNSILPNQMPITTVKAKAPTYADRSTGLDRGPLITADMQKEISS
FT                   ALGPGPKDEILCRAFKMAITREDMRTLRDTEWLNDTVINFYMNLLMARNQTQGYPALFA
FT                   FNTFFYTKLQSGGYKSVKRWTKAVDLFAKELILVPVNLNMHWSLVVTYMREKTIVYLDS
FT                   MGHKRPEVLQLIFHYLQEESKARKNVDLNPLDWKQHSMPAEEIPQQETNSDCGMFTCKY
FT                   ADYISRGQPITFSQQHMPLFRKKMVWELLHQCLL"
FT   gene            complement(3760358..3779632)
FT                   /gene="Tmem5"
FT                   /locus_tag="mCG_10111"
FT                   /note="gene_id=mCG10111.2"
FT   mRNA            complement(join(3760358..3763935,3771125..3771295,
FT                   3772706..3773020,3776836..3776938,3778185..3778381,
FT                   3779611..3779632))
FT                   /gene="Tmem5"
FT                   /locus_tag="mCG_10111"
FT                   /product="transmembrane protein 5, transcript variant
FT                   mCT185345"
FT                   /note="gene_id=mCG10111.2 transcript_id=mCT185345.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3760358..3763935,3771125..3771295,
FT                   3772706..3773020,3776836..3776938,3778185..3778340,
FT                   3779147..3779417))
FT                   /gene="Tmem5"
FT                   /locus_tag="mCG_10111"
FT                   /product="transmembrane protein 5, transcript variant
FT                   mCT10149"
FT                   /note="gene_id=mCG10111.2 transcript_id=mCT10149.3 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3760358..3763935,3771125..3771295,
FT                   3772706..3773020,3776836..3776938,3778185..3778340,
FT                   3778594..3778707,3779147..3779403))
FT                   /gene="Tmem5"
FT                   /locus_tag="mCG_10111"
FT                   /product="transmembrane protein 5, transcript variant
FT                   mCT185344"
FT                   /note="gene_id=mCG10111.2 transcript_id=mCT185344.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(3763518..3763935,3771125..3771295,
FT                   3772706..3773020,3776836..3776938,3778185..3778340,
FT                   3779147..3779318))
FT                   /codon_start=1
FT                   /gene="Tmem5"
FT                   /locus_tag="mCG_10111"
FT                   /product="transmembrane protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG10111.2 transcript_id=mCT10149.3
FT                   protein_id=mCP7946.2 isoform=CRA_a"
FT                   /protein_id="EDL24428.1"
FT                   /translation="MRLTRTRLCSLLVALYCLFSIYAAYHVFFGRRRRPLGTTSRNSRK
FT                   AAAAQAKERRGREQSALESEEWNPWEGDEKNEQRHRVKTNLQILNKSTKEKIEHRVQIW
FT                   GKAAIGLYLWEHIFEGTLDPADVTAQWREGQSVVGRTHYSFITGPAVVPGYFSIDVDNV
FT                   VLVLNGREKAKIFHATQWLIYAQNLMKTQKLQHLAVVLLGNEHCENDWIMQFLKRNGGF
FT                   VDLLFITYDSPWINGADILQWPLGVATYRQFPVVEASWTMLHDERPYICNFLGTAYENS
FT                   SRQALMNILKQDGNDKLCWVSAREQWQPQETNESLKNYQDALLHSDLTLCPVGVNTECY
FT                   RIYEACSFGSIPVVEDVMTAGHCGNTTSQHSAPLQLLKAMGAPFIFIKNWKELPAILEK
FT                   EKTISLQEKIQRRKVLLHWYQHFKTELKWKFTKILESSFFINNKV"
FT   CDS             complement(join(3763518..3763935,3771125..3771295,
FT                   3772706..3772887))
FT                   /codon_start=1
FT                   /gene="Tmem5"
FT                   /locus_tag="mCG_10111"
FT                   /product="transmembrane protein 5, isoform CRA_b"
FT                   /note="gene_id=mCG10111.2 transcript_id=mCT185344.0
FT                   protein_id=mCP106604.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BVJ1"
FT                   /db_xref="MGI:MGI:2384919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BVJ1"
FT                   /protein_id="EDL24429.1"
FT                   /translation="MKTQKLQHLAVVLLGNEHCENDWIMQFLKRNGGFVDLLFITYDSP
FT                   WINGADILQWPLGVATYRQFPVVEASWTMLHDERPYICNFLGTAYENSSRQALMNILKQ
FT                   DGNDKLCWVSAREQWQPQETNESLKNYQDALLHSDLTLCPVGVNTECYRIYEACSFGSI
FT                   PVVEDVMTAGHCGNTTSQHSAPLQLLKAMGAPFIFIKNWKELPAILEKEKTISLQEKIQ
FT                   RRKVLLHWYQHFKTELKWKFTKILESSFFINNKV"
FT   CDS             complement(join(3763518..3763935,3771125..3771295,
FT                   3772706..3772887))
FT                   /codon_start=1
FT                   /gene="Tmem5"
FT                   /locus_tag="mCG_10111"
FT                   /product="transmembrane protein 5, isoform CRA_b"
FT                   /note="gene_id=mCG10111.2 transcript_id=mCT185345.0
FT                   protein_id=mCP106603.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BVJ1"
FT                   /db_xref="MGI:MGI:2384919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BVJ1"
FT                   /protein_id="EDL24430.1"
FT                   /translation="MKTQKLQHLAVVLLGNEHCENDWIMQFLKRNGGFVDLLFITYDSP
FT                   WINGADILQWPLGVATYRQFPVVEASWTMLHDERPYICNFLGTAYENSSRQALMNILKQ
FT                   DGNDKLCWVSAREQWQPQETNESLKNYQDALLHSDLTLCPVGVNTECYRIYEACSFGSI
FT                   PVVEDVMTAGHCGNTTSQHSAPLQLLKAMGAPFIFIKNWKELPAILEKEKTISLQEKIQ
FT                   RRKVLLHWYQHFKTELKWKFTKILESSFFINNKV"
FT   assembly_gap    3785129..3785148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3791155..3793796
FT                   /estimated_length=2642
FT                   /gap_type="unknown"
FT   assembly_gap    3799232..3799402
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    3827417..3827716
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    3832609..3832628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3835869..3837951
FT                   /estimated_length=2083
FT                   /gap_type="unknown"
FT   assembly_gap    3844740..3846065
FT                   /estimated_length=1326
FT                   /gap_type="unknown"
FT   gene            3850553..3851756
FT                   /pseudo
FT                   /locus_tag="mCG_49173"
FT                   /note="gene_id=mCG49173.3"
FT   mRNA            3850553..3851756
FT                   /pseudo
FT                   /locus_tag="mCG_49173"
FT                   /note="gene_id=mCG49173.3 transcript_id=mCT49356.3 created
FT                   on 26-JUN-2003"
FT   assembly_gap    3862325..3862429
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    3878128..3878147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3898498..3898646
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    3909273..3909393
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    3917518..3918106
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    3934882..3935168
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    3953027..3953046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3954624..3954643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3956638..3956657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3958267..3958286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3980747..3980766
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3981804..3983242
FT                   /estimated_length=1439
FT                   /gap_type="unknown"
FT   assembly_gap    3990403..3990469
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    4008543..4008805
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    4012377..4012396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4013580..4013599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4015461..4015480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4017282..4017301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4018453..4018745
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    4042798..4044375
FT                   /estimated_length=1578
FT                   /gap_type="unknown"
FT   assembly_gap    4045585..4045604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4053688..4053743
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    4069535..4073138
FT                   /estimated_length=3604
FT                   /gap_type="unknown"
FT   assembly_gap    4084746..4084765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4094257..4094320
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    4100878..4100900
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    4106969..4107091
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            4123214..4128174
FT                   /gene="Avpr1a"
FT                   /locus_tag="mCG_10108"
FT                   /note="gene_id=mCG10108.1"
FT   mRNA            join(4123214..4124506,4126795..4128174)
FT                   /gene="Avpr1a"
FT                   /locus_tag="mCG_10108"
FT                   /product="arginine vasopressin receptor 1A"
FT                   /note="gene_id=mCG10108.1 transcript_id=mCT10146.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(4123522..4124506,4126795..4127081)
FT                   /codon_start=1
FT                   /gene="Avpr1a"
FT                   /locus_tag="mCG_10108"
FT                   /product="arginine vasopressin receptor 1A"
FT                   /note="gene_id=mCG10108.1 transcript_id=mCT10146.1
FT                   protein_id=mCP7965.1"
FT                   /db_xref="GOA:Q3U1H9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001224"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1859216"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1H9"
FT                   /protein_id="EDL24431.1"
FT                   /translation="MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDV
FT                   RNEELAKLEVTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQ
FT                   VLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQP
FT                   ARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWM
FT                   TSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCV
FT                   SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL
FT                   LASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSP
FT                   TNSTGTWKDSPKSSKSIRFIPVST"
FT   assembly_gap    4139929..4139948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4151431..4151599
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    4183039..4183058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4198554..4198573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4202409..4202428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4217256..4217275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4219092..4219111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4224679..4224698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4237077..4237096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4239495..>4244335)
FT                   /locus_tag="mCG_145403"
FT                   /note="gene_id=mCG145403.0"
FT   mRNA            complement(join(4239495..4241849,4242263..4242402,
FT                   4244283..>4244335))
FT                   /locus_tag="mCG_145403"
FT                   /product="mCG145403"
FT                   /note="gene_id=mCG145403.0 transcript_id=mCT184827.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(4240183..>4240710)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145403"
FT                   /product="mCG145403"
FT                   /note="gene_id=mCG145403.0 transcript_id=mCT184827.0
FT                   protein_id=mCP105312.0"
FT                   /protein_id="EDL24432.1"
FT                   /translation="SSGKMQIKTALRFHLTPVRMAKIKNSGDRRCWRGCGERGTLLHCW
FT                   WDCKLVQLLWKSVWRFLRKLDIVLTEDPTIPLLGIYPEDVPTGKKDTCSTMFIAALFII
FT                   ARSWKEPRCPSTEEWIQKMWYIYTMEYYSAIKKNEFMKFLGKWMDLEDIILSEVTQSQK
FT                   NSHDMYLLISRY"
FT   assembly_gap    4243746..4243873
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    4246214..4246277
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    4260553..4260572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4267746..4267765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4276161..4276426
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    4277486..4277505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4303775..4304028
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    4309572..4310317
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   assembly_gap    4311596..4312659
FT                   /estimated_length=1064
FT                   /gap_type="unknown"
FT   assembly_gap    4348773..4350504
FT                   /estimated_length=1732
FT                   /gap_type="unknown"
FT   gene            4353308..4614399
FT                   /gene="Ppm1h"
FT                   /locus_tag="mCG_12026"
FT                   /note="gene_id=mCG12026.2"
FT   mRNA            join(4353308..4353977,4464421..4464583,4481456..4481800,
FT                   4490691..4490803,4530841..4530925,4551085..4551203,
FT                   4576777..4576840,4580433..4580540,4593608..4593759,
FT                   4613055..4614399)
FT                   /gene="Ppm1h"
FT                   /locus_tag="mCG_12026"
FT                   /product="protein phosphatase 1H (PP2C domain containing),
FT                   transcript variant mCT12527"
FT                   /note="gene_id=mCG12026.2 transcript_id=mCT12527.2 created
FT                   on 16-JUN-2003"
FT   mRNA            join(4353308..4353977,4464421..4464583,4481456..4481800,
FT                   4490691..4490803,4530841..4530925,4551085..4551203,
FT                   4576777..4576840,4580433..4580540,4593608..4594888)
FT                   /gene="Ppm1h"
FT                   /locus_tag="mCG_12026"
FT                   /product="protein phosphatase 1H (PP2C domain containing),
FT                   transcript variant mCT166461"
FT                   /note="gene_id=mCG12026.2 transcript_id=mCT166461.2 created
FT                   on 16-JUN-2003"
FT   CDS             join(4353733..4353977,4464421..4464583,4481456..4481800,
FT                   4490691..4490803,4530841..4530925,4551085..4551203,
FT                   4576777..4576840,4580433..4580540,4593608..4593759,
FT                   4613055..4613202)
FT                   /codon_start=1
FT                   /gene="Ppm1h"
FT                   /locus_tag="mCG_12026"
FT                   /product="protein phosphatase 1H (PP2C domain containing),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG12026.2 transcript_id=mCT12527.2
FT                   protein_id=mCP7969.2 isoform=CRA_a"
FT                   /protein_id="EDL24433.1"
FT                   /translation="MLTRVKSAVANFMGGIMAGSSGSEHGGSGCGGSDLPLRFPYGRPE
FT                   FLGLSQDEVECSADHIARPILILKETRRLPWATGYAEVINAGKSTHNEDQASCEVLTVK
FT                   KKAGTITSTPNRNSKRRSSLPNGEGLQLKENSESEGISCHYWSLFDGHAGSGAAVVASR
FT                   LLQHHITQQLQDIVEILKNSAILPPTCLGEEPESTPAHGRTLTRAASLRGGVGAPGSPS
FT                   TPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSAYNISGGCTALIVVCLLGKLY
FT                   VANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQR
FT                   KELGKKMLYRDFNMTGWAYKTIEDDDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVH
FT                   DSNIYIKPFLSSAPEVRVYDLSRYEHGADDVLILATDGLWDVLSNEEVAEAITQFLPNC
FT                   DPDDPHRYTLAAQDLVMRARGVLKDRGWRISNDRLGSGDDISVYVIPLIHGNKLS"
FT   CDS             join(4353733..4353977,4464421..4464583,4481456..4481800,
FT                   4490691..4490803,4530841..4530925,4551085..4551203,
FT                   4576777..4576840,4580433..4580540,4593608..4593775)
FT                   /codon_start=1
FT                   /gene="Ppm1h"
FT                   /locus_tag="mCG_12026"
FT                   /product="protein phosphatase 1H (PP2C domain containing),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG12026.2 transcript_id=mCT166461.2
FT                   protein_id=mCP44421.2 isoform=CRA_b"
FT                   /protein_id="EDL24434.1"
FT                   /translation="MLTRVKSAVANFMGGIMAGSSGSEHGGSGCGGSDLPLRFPYGRPE
FT                   FLGLSQDEVECSADHIARPILILKETRRLPWATGYAEVINAGKSTHNEDQASCEVLTVK
FT                   KKAGTITSTPNRNSKRRSSLPNGEGLQLKENSESEGISCHYWSLFDGHAGSGAAVVASR
FT                   LLQHHITQQLQDIVEILKNSAILPPTCLGEEPESTPAHGRTLTRAASLRGGVGAPGSPS
FT                   TPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSAYNISGGCTALIVVCLLGKLY
FT                   VANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQR
FT                   KELGKKMLYRDFNMTGWAYKTIEDDDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVH
FT                   DSNIYIKPFLSSAPEVRVYDLSRYEHGADDVLILATDGLWDVLSNEEVAEAITQFLPNC
FT                   DPDDPHRFVPL"
FT   assembly_gap    4354777..4355421
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    4381135..4381410
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    4391251..4391387
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    4406234..4406262
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    4417911..4417930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4421848..4421867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4423301..4423320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4425572..4425591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4456478..4456915
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    4461054..4461200
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    4464287..4464306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4465456..4465475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4470894..4471462
FT                   /estimated_length=569
FT                   /gap_type="unknown"
FT   assembly_gap    4474009..4474205
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    4475647..4475816
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    4476200..4476342
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    4484874..4485120
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    4513913..4513932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4515772..4515791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4533085..4533554
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    4544982..4545001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4555700..4555839
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    4579451..4580090
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    4611546..4611565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4622822..4623057
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    4624328..4624347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4632452..4632500
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    4636582..4636680
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    4657286..4657402
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    4659316..4659665
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   gene            complement(4667952..>4749519)
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /note="gene_id=mCG119477.2"
FT   mRNA            complement(join(4667952..4669272,4673098..4673180,
FT                   4676136..4676337,4679451..4679574,4681513..4681767,
FT                   4682944..4683072,4683682..4683838,4686804..4687431,
FT                   4688382..4688580,4689704..4689913,4691516..4691678,
FT                   4693745..4693911,4696284..4696394,4697360..4697461,
FT                   4699536..4699626,4699710..4699783,4699863..4699943,
FT                   4700365..4700469,4702575..4702687,4703566..4703766,
FT                   4705979..4706205,4707761..4707878,4708916..4709052,
FT                   4709460..4709584,4711907..4712101,4715678..4715803,
FT                   4716422..4716516,4719745..4719874,4724652..4724783,
FT                   4725200..4725327,4732204..4732267,4748866..4749399))
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /product="MON2 homolog (yeast), transcript variant
FT                   mCT172031"
FT                   /note="gene_id=mCG119477.2 transcript_id=mCT172031.0
FT                   created on 16-AUG-2002"
FT   mRNA            complement(join(4667952..4669272,4673098..4673180,
FT                   4676136..4676343,4679451..4679574,4680413..4680473,
FT                   4681577..4681767,4682944..4683072,4683935..4684078,
FT                   4686809..4687387,4689704..4689997,4691516..4691678,
FT                   4693745..4693920,4696284..4696394,4699536..4699626,
FT                   4699710..4699783,4702589..4702701,4703566..4703750,
FT                   4704496..4704580,4705979..4706205,4707761..4707914,
FT                   4708916..4709052,4709460..4709584,4711907..4712101,
FT                   4715678..4715803,4716422..4716516,4719745..4719874,
FT                   4724652..4724783,4748866..4749389))
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /product="MON2 homolog (yeast), transcript variant
FT                   mCT120630"
FT                   /note="gene_id=mCG119477.2 transcript_id=mCT120630.0
FT                   created on 16-AUG-2002"
FT   mRNA            complement(join(4668602..4669272,4673098..4673180,
FT                   4676136..4676343,4679451..4679574,4680413..4680473,
FT                   4681577..4681767,4682944..4683072,4683354..4683371,
FT                   4683935..4684078,4686809..4687431,4688382..4688580,
FT                   4689704..4689997,4691516..4691678,4693745..4693920,
FT                   4696284..4696394,4697355..4697461,4699536..4699626,
FT                   4699710..4699783,4699863..4699943,4700365..4700469,
FT                   4702589..4702701,4703566..4703750,4704496..4704577,
FT                   4705979..4706205,4707761..4707914,4708916..4709052,
FT                   4709460..4709584,4711907..4712101,4715678..4715803,
FT                   4716422..4716516,4719745..4719874,4724652..4724783,
FT                   4725200..4725327,4732204..4732267,4748866..>4749519))
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /product="MON2 homolog (yeast), transcript variant
FT                   mCT191981"
FT                   /note="gene_id=mCG119477.2 transcript_id=mCT191981.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(4668788..4669272,4673098..4673180,
FT                   4676136..4676343,4679451..4679574,4680413..4680473,
FT                   4681577..4681767,4682944..4683072,4683935..4684078,
FT                   4686809..4687431,4688382..4688580,4689704..4689997,
FT                   4691516..4691678,4693745..4693920,4696284..4696394,
FT                   4697360..4697461,4699536..4699626,4699710..4699783,
FT                   4699863..4699943,4700365..4700469,4702589..4702701,
FT                   4703566..4703750,4704496..4704577,4705979..4706205,
FT                   4707761..4707914,4708916..4709052,4709460..4709584,
FT                   4711907..4712101,4715678..4715803,4716422..4716516,
FT                   4719745..4719874,4724652..4724783,4725200..4725327,
FT                   4732204..4732267,4748866..>4749041))
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /product="MON2 homolog (yeast), transcript variant
FT                   mCT191982"
FT                   /note="gene_id=mCG119477.2 transcript_id=mCT191982.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(4669109..4669272,4673098..4673180,
FT                   4676136..4676343,4679451..4679574,4680413..4680473,
FT                   4681577..4681767,4682944..4683072,4683935..4684078,
FT                   4686809..4687431,4688382..4688580,4689704..4689997,
FT                   4691516..4691678,4693745..4693920,4696284..4696394,
FT                   4697360..4697461,4699536..4699626,4699710..4699783,
FT                   4699863..4699943,4700365..4700469,4702589..4702701,
FT                   4703566..4703750,4704496..4704577,4705979..4706205,
FT                   4707761..4707914,4708916..4709052,4709460..4709584,
FT                   4711907..4712101,4715678..4715803,4716422..4716516,
FT                   4719745..4719874,4724652..4724783,4725200..4725327,
FT                   4732204..4732267,4748866..>4748988))
FT                   /codon_start=1
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /product="MON2 homolog (yeast), isoform CRA_d"
FT                   /note="gene_id=mCG119477.2 transcript_id=mCT191982.0
FT                   protein_id=mCP112920.0 isoform=CRA_d"
FT                   /protein_id="EDL24438.1"
FT                   /translation="PGGTMSCTNSPEAVKKLLENMQSDLRALSLECKKKFPPVKEAAES
FT                   GIIKVKTIAARNTEILAALKENSSEVVQPFLMGCGTKEPKITQLCLAAIQRLMSHEVVS
FT                   ETAAGNIINMLWQLMENSLEELKLLQTVLVLLTTNTVVHDEALSKAIVLCFRLHFTKDN
FT                   ITNNTAAATVRQVVTVVFERMVAEDDRHRDIEPPVPIQGNSNRRSVSTLRPCAKDAYML
FT                   FQDLCQLVNADAPYWLVGMTEMTRTFGLELLESVLNDFPQVFLQHQEFSFLLKERVCPL
FT                   VIKLFSPNIKFRQGSSTSSSPAPVEKPYFPICMRLLRVVSVLIKQFYSLLVTECEIFLS
FT                   LLVKFLDSDKPQWLRAVAVESIHRLCVQPQLLRSFCQSYDMKQHSTKVFRDIVNALGSF
FT                   IQSLFLVPPTGNPATANQAGNNNAGGPASAPANSGVVGVGGGVTLLPAFEYRGAWIPIL
FT                   TVTVQGSAKATYLEMLDKVEPPTIPEGYAMSVAFHCLLDLVRGITTMIEGELGEVEAEG
FT                   PSVTEGASSQSSERRDEQAASDPMDQETVSRAVWEEMVSACWCGLLAALSLLLDASTDE
FT                   AATENILKAELTMAALCGRLGLVTSRDAFITAICKGSLPPHYALTVLNATTAATLSNKS
FT                   YSIQGQSVMMISPSSESHQQVVAVGQPLAVQPQGTVMLTSKNIQCMRTLLNLAHCHGAV
FT                   LGTSWQLVLATLQHLVWILGLKPSSGGALKPGRAVEGPSTVLTTAVMTDLPVISNILSR
FT                   LFESSQYLDDVSLHHLINALCSLSLEAMDMAYGNNKEPSLFAVAKLLETGLVNMHRIEI
FT                   LWRPLTGHLLEVCQHPNSRMREWGAEALTSLIRAGLTFSHEPPLPQNQRLQLLLLNPLK
FT                   EMSNINHPDIRLKQLECVLQILQSQGDSLGPGWPLVLGVMGAIRNDQGESLIRTAFQCL
FT                   QLVVTDFLPTMPCSCLQIVVDVAGSFGLHNQELNISLTSIGLLWNISDYFFQRGETIEK
FT                   ELNKEEAAQQKQAEEKGVSLNRPFHPAPPFDCLWLCLYAKLGELCVDPRPAVRKSAGQT
FT                   LFSTIGAHGTLLQHSTWHTVIWKVLFHLLDRVRESSTTADKEKIESGGGNILIHHSRDT
FT                   AEKQWAETWVLTLAGVARIFNTRRYLLQPLGDFSRAWDVLLDHIQSAALSKNNEVSLAA
FT                   LKSFQEILQIVSPVRDSEKPEPPAVSVPVPVLLGNLSGPGLSRPFVRTDSIGEKLGRCG
FT                   SETPVVTDELEDLKLWWAAWNTWHRTGSESTEPPSSVDELTFIPSQPFLTALVQIFPAL
FT                   YQHIKAGFSMADLQKLGVILHSAVSVPISSDASPFILPSYTEAVLTSLQEAVLTALDVL
FT                   QKAICVGPENMQIMYPAIFDQLLAFVEFSCKPPQYGQLETKHIANAKYNQAEWVALNYV
FT                   PFAERSLEVVVDLYQKTACHKAVVNEKVLQNIIKTLRVPLSLKYSCPSESTWKLAVASL
FT                   LKVLSIGLPVARQHASSGKFDSMWPELASTLEDFLFTKSIPPDNLSIQEFQRNESIDVE
FT                   VVQLISAEILPYANLIPKAFVGQMMTMLNKGSIHSQPCSFTEAEIDIRLREEFSKMCFE
FT                   TLLQFSFSNKVTTPQEGYISRMALSVLLKRSQDVLHRYIEDERLSGKCPLPRQQVTEII
FT                   FVLKAVSTLIDSLKKTQPENVDGNTWSQVIALYPTLVECITCSSSDVGSALKEALAPFK
FT                   DFMQPPASRVQNGES"
FT   CDS             complement(join(4669109..4669272,4673098..4673180,
FT                   4676136..4676343,4679451..4679574,4680413..4680473,
FT                   4681577..4681767,4682944..4683072,4683935..4684078,
FT                   4686809..4687387,4689704..4689997,4691516..4691678,
FT                   4693745..4693920,4696284..4696394,4699536..4699626,
FT                   4699710..4699783,4702589..4702701,4703566..4703750,
FT                   4704496..4704580,4705979..4706205,4707761..4707914,
FT                   4708916..4709052,4709460..4709584,4711907..4712101,
FT                   4715678..4715803,4716422..4716516,4719745..4719874,
FT                   4724652..4724783,4748866..4748976))
FT                   /codon_start=1
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /product="MON2 homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG119477.2 transcript_id=mCT120630.0
FT                   protein_id=mCP44551.1 isoform=CRA_a"
FT                   /protein_id="EDL24435.1"
FT                   /translation="MSCTNSPEAVKKLLENMQSDLRALSLECKKKFPPVKETAAGNIIN
FT                   MLWQLMENSLEELKLLQTVLVLLTTNTVVHDEALSKAIVLCFRLHFTKDNITNNTAAAT
FT                   VRQVVTVVFERMVAEDDRHRDIEPPVPIQGNSNRRSVSTLRPCAKDAYMLFQDLCQLVN
FT                   ADAPYWLVGMTEMTRTFGLELLESVLNDFPQVFLQHQEFSFLLKERVCPLVIKLFSPNI
FT                   KFRQGSSTSSSPAPVEKPYFPICMRLLRVVSVLIKQFYSLLVTECEIFLSLLVKFLDSD
FT                   KPQWLRAVAVESIHRLCVQPQLLRSFCQSYDMKQHSTKVFRDIVNALGSFIQSLFLVPP
FT                   TGNPATANQAGNNNAGGPASAPANSGVVGVGGGVTLLPAFEYRGAWIPILTVTVQGSAK
FT                   ATYLEMLDKVEPPTIPEGYAMSVAFHCLLDLVRGITTMIEGELGEVEAEGPSVTEGASS
FT                   QSSERRDEQAASDPMDQETAVSRAVWEEMVSACWCGLLAALSLLLDASTDEAATENILK
FT                   AELTMAALCGRLGLVTSRDAFITAICKGSLPPHYALTVLNATTAATLSNKSYSIQGQSV
FT                   MMISPSSESHQQVVAVGQPLAVQPQGTVMVLTTAVMTDLPVISNILSRLFESSQYLDDV
FT                   SLHHLINALCSLSLEAMDMAYGNNKVCQHPNSRMREWGAEALTSLIRAGLTFSHEPPLP
FT                   QNQRLQLLLLNPLKEMSNINHPDIRLKQLECVLQILQSQGDSLGPGWPLVLGVMGAIRN
FT                   DQGESLIRTAFQCLQLVVTDFLPTMPCSCLQIVVDVAGSFGLHNQELNISLTSIGLLWN
FT                   ISDYFFQRGETIEKELNKEEAAQQKQAEEKGVSLNRPFHPAPPFDCLWLCLYAKLGELC
FT                   VDPRPAVRKSAGQTLFSTIGAHGTLLQHSTWHTVIWKSAALSKNNEVSLAALKSFQEIL
FT                   QIVSPVRDSEKPEPPAVSVPVPVLLGNLSGPGLSRPFVRTDSIGEKLGRCGSETPVVTD
FT                   ELEDLKLWWAAWNTWHRTGSESTEPPSSVDELTFIPSQPFLTALVQIFPALYQHIKAGF
FT                   SMADLQKLGVILHSAVSVPISSDASPFILPSYTEAVLTSLQEAVLTALDVLQKAICVGP
FT                   ENMQIMYPAIFDQLLAFVEFSCKPPQYGQLETKHIANAKYNQAEWVALNYVPFAERSLE
FT                   VVVDLYQKTACHKAVVNEKVLQNIIKTLRVPLSLKYSCPSESTWKLAVASLLKVLSIGL
FT                   PVARQHASSGKFDSMWPELASTLEDFLFTKSIPPDNLSIQEFQRNESIDVEVVQLISAE
FT                   ILPYANLIPKAFVGQMMTMLNKGSIHSQPCSFTEAEIDIRLREEFSKMCFETLLQFSFS
FT                   NKVTTPQEGYISRMALSVLLKRSQDVLHRYIEDERLSGKCPLPRQQVTEIIFVLKAVST
FT                   LIDSLKKTQPENVDGNTWSQVIALYPTLVECITCSSSDVGSALKEALAPFKDFMQPPAS
FT                   RVQNGES"
FT   CDS             complement(join(4669109..4669272,4673098..4673180,
FT                   4676136..4676337,4679451..4679574,4681513..4681767,
FT                   4682944..4683072,4683682..4683838,4686804..4687431,
FT                   4688382..4688580,4689704..4689913,4691516..4691678,
FT                   4693745..4693911,4696284..4696394,4697360..4697461,
FT                   4699536..4699626,4699710..4699783,4699863..4699943,
FT                   4700365..4700469,4702575..4702687,4703566..4703766,
FT                   4705979..4706205,4707761..4707878,4708916..4709052,
FT                   4709460..4709584,4711907..4712101,4715678..4715803,
FT                   4716422..4716516,4719745..4719874,4724652..4724783,
FT                   4725200..4725327,4732204..4732267,4748866..4748976))
FT                   /codon_start=1
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /product="MON2 homolog (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG119477.2 transcript_id=mCT172031.0
FT                   protein_id=mCP94950.0 isoform=CRA_b"
FT                   /protein_id="EDL24436.1"
FT                   /translation="MSCTNSPEAVKKLLENMQSDLRALSLECKKKFPPVKEAAESGIIK
FT                   VKTIAARNTEILAALKENSSEVVQPFLMGCGTKEPKITQLCLAAIQRLMSHEVVSETAA
FT                   GNIINMLWQLMENSLEELKLLQTVLVLLTTNTVVHDEALSKAIVLCFRLHFTKDNITNN
FT                   TAAATVRQVVTVVFERMVAEDDRHRDIEPPVPIQGNSNRRSVSTLRPCAKDAYMLFQDL
FT                   CQLVNADAPYWLVGMTEMTRTFGLELLESVLNDFPQVFLQHQEFSFLLKERVCPLVIKL
FT                   FSPNIKFRQGSSTSSSPAPVEKPYFPICMRLLRVVSVLIKQFYSLLVTECEIFLSLLVK
FT                   FLDSDKPQWLRAVAVESIHRLCVQPQLLRSFCQSYDMKQHSTKVFRDIVNALGSFIQSL
FT                   FLVPPTGNPATANQAANSGVVGVGGGVTLLPAFEYRGAWIPILTVTVQGSAKATYLEML
FT                   DKVEPPTIPEGYAMSVAFHCLLDLVRGITTMIEGELGEVEAEGPSVTEGASSQSSERRD
FT                   EQAASDPMDQETERLSSSTDEAATENILKAELTMAALCGRLGLVTSRDAFITAICKGSL
FT                   PPHYALTVLNATTAATLSNKWPKCYDDQPVQRVSPASCGRGSASCSAASRNSDGNLTRL
FT                   TSKNIQCMRTLLNLAHCHGAVLGTSWQLVLATLQHLVWILGLKPSSGGALKPGRAVEGP
FT                   STVLTTAVMTDLPVISNILSRLFESSQYLDDVSLHHLINALCSLSLEAMDMAYGNNKEP
FT                   SLFAVAKLLETGLVNMHRIEILWRPLTGHLLEVCQHPNSRMREWGAEALTSLIRAGLTF
FT                   SHEPPLPQNQLLLLNPLKEMSNINHPDIRLKQLECVLQILQSQGDSLGPGWPLVLGVMG
FT                   AIRNDQGESLIRTAFQCLQLVVTDFLPTMPCSCLQIVVDVAGSFGLHNQELNISLTSIG
FT                   LLAEEKGVSLNRPFHPAPPFDCLWLCLYAKLGELCVDPRPAVRKSAGQTLFSTIGAHGT
FT                   LLQHSTWHTVIWKVLFHLLDRVRESSTTADKEKIESGGGNILIHHSRDTAEKQWAETWV
FT                   LTLAGVARIFNTRRYLLQPLGDFSRAWDVLLDHIQSAALSKNNEVSLAALKSFQEILQI
FT                   VSPVRDSEKPEPPAVSVPVPVLLGNLSGPGLSRPFVRTDSIGEKLGRCGSETPVVTDEL
FT                   EDLKLWWAAWNTWHRTGSESTEPPSSVDELTFIPSQPFLTALVQIFPALYQHIKAGFSM
FT                   ADLQKLGVILHSAVSVPISSDASPFILPSYTEAVLTSLQEAVLTALDVLQKVMCPLQNT
FT                   SVTRDIALSLQRVLLRGRPALRSLLSSEVRAPFHPFSLQPHSSTNWAEWVALNYVPFAE
FT                   RSLEVVVDLYQKTACHKAVVNEKVLQNIIKTLRVPLSLKYSCPSESTWKLAVASLLKVL
FT                   SIGLPVARQHASSGKFDSMWPELASTLEDFLFTKRSGHWSKMEREPLRRWETMSATVVQ
FT                   LISAEILPYANLIPKAFVGQMMTMLNKGSIHSQPCSFTEIDIRLREEFSKMCFETLLQF
FT                   SFSNKVTTPQEGYISRMALSVLLKRSQDVLHRYIEDERLSGKCPLPRQQVTEIIFVLKA
FT                   VSTLIDSLKKTQPENVDGNTWSQVIALYPTLVECITCSSSDVGSALKEALAPFKDFMQP
FT                   PASRVQNGES"
FT   CDS             complement(join(4669109..4669272,4673098..4673180,
FT                   4676136..4676343,4679451..4679574,4680413..4680473,
FT                   4681577..4681767,4682944..4683072,4683354..4683371,
FT                   4683935..4684078,4686809..4687431,4688382..4688580,
FT                   4689704..4689997,4691516..4691678,4693745..4693920,
FT                   4696284..4696394,4697355..>4697360))
FT                   /codon_start=1
FT                   /gene="Mon2"
FT                   /locus_tag="mCG_119477"
FT                   /product="MON2 homolog (yeast), isoform CRA_c"
FT                   /note="gene_id=mCG119477.2 transcript_id=mCT191981.0
FT                   protein_id=mCP112919.0 isoform=CRA_c"
FT                   /protein_id="EDL24437.1"
FT                   /translation="GEVCQHPNSRMREWGAEALTSLIRAGLTFSHEPPLPQNQRLQLLL
FT                   LNPLKEMSNINHPDIRLKQLECVLQILQSQGDSLGPGWPLVLGVMGAIRNDQGESLIRT
FT                   AFQCLQLVVTDFLPTMPCSCLQIVVDVAGSFGLHNQELNISLTSIGLLWNISDYFFQRG
FT                   ETIEKELNKEEAAQQKQAEEKGVSLNRPFHPAPPFDCLWLCLYAKLGELCVDPRPAVRK
FT                   SAGQTLFSTIGAHGTLLQHSTWHTVIWKVLFHLLDRVRESSTTADKEKIESGGGNILIH
FT                   HSRDTAEKQWAETWVLTLAGVARIFNTRRYLLQPLGDFSRAWDVLLDHIQSAALSKNNE
FT                   VSLAALKSFQEILQIVSPVRDSEKPEPPAVSVPVPVLLGNLSGPGLSRPFVRTDSIGEK
FT                   LGRCGSETPVVTDELEDLKLWWAAWNTWHRTGSESTEPPSSVDELTFIPSQPFLTALVQ
FT                   IFPALYQHIKAGFSMADLQKLGVILHSAVSVPISSDASPFILPSYTEAVLTSLQEAVLT
FT                   ALDVLQKAICVGPENMQIMYPAIFDQLLAFVEFSCKPPQYGQLETKHIANAKYNQIQLF
FT                   APAEWVALNYVPFAERSLEVVVDLYQKTACHKAVVNEKVLQNIIKTLRVPLSLKYSCPS
FT                   ESTWKLAVASLLKVLSIGLPVARQHASSGKFDSMWPELASTLEDFLFTKSIPPDNLSIQ
FT                   EFQRNESIDVEVVQLISAEILPYANLIPKAFVGQMMTMLNKGSIHSQPCSFTEAEIDIR
FT                   LREEFSKMCFETLLQFSFSNKVTTPQEGYISRMALSVLLKRSQDVLHRYIEDERLSGKC
FT                   PLPRQQVTEIIFVLKAVSTLIDSLKKTQPENVDGNTWSQVIALYPTLVECITCSSSDVG
FT                   SALKEALAPFKDFMQPPASRVQNGES"
FT   assembly_gap    4755260..4755279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4763688..4763744
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   gene            complement(4785208..4872708)
FT                   /gene="Usp15"
FT                   /locus_tag="mCG_12027"
FT                   /note="gene_id=mCG12027.2"
FT   mRNA            complement(join(4785208..4787159,4792580..4792668,
FT                   4795043..4795146,4797407..4797556,4797985..4798100,
FT                   4798435..4798505,4798884..4799156,4799284..4799399,
FT                   4801145..4801336,4801431..4801525,4801616..4801699,
FT                   4804470..4804694,4804781..4804939,4806473..4806646,
FT                   4822291..4822435,4839101..4839162,4843736..4843881,
FT                   4846637..4846763,4851161..4851291,4856991..4857118,
FT                   4872576..>4872683))
FT                   /gene="Usp15"
FT                   /locus_tag="mCG_12027"
FT                   /product="ubiquitin specific peptidase 15, transcript
FT                   variant mCT192002"
FT                   /note="gene_id=mCG12027.2 transcript_id=mCT192002.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(4785209..4787159,4792580..4792668,
FT                   4795043..4795146,4797407..4797556,4797985..4798100,
FT                   4798435..4798505,4798884..4799156,4799284..4799399,
FT                   4801145..4801336,4801431..4801525,4801616..4801699,
FT                   4804470..4804694,4804781..4804939,4806473..4806646,
FT                   4822291..4822435,4828582..4828668,4839101..4839162,
FT                   4843736..4843881,4846637..4846763,4851161..4851291,
FT                   4856991..4857118,4872576..4872708))
FT                   /gene="Usp15"
FT                   /locus_tag="mCG_12027"
FT                   /product="ubiquitin specific peptidase 15, transcript
FT                   variant mCT12528"
FT                   /note="gene_id=mCG12027.2 transcript_id=mCT12528.2 created
FT                   on 16-AUG-2002"
FT   CDS             complement(join(4786977..4787159,4792580..4792668,
FT                   4795043..4795146,4797407..4797556,4797985..4798100,
FT                   4798435..4798505,4798884..4799156,4799284..4799399,
FT                   4801145..4801336,4801431..4801525,4801616..4801699,
FT                   4804470..4804694,4804781..4804939,4806473..4806646,
FT                   4822291..4822435,4839101..4839162,4843736..4843881,
FT                   4846637..4846763,4851161..4851291,4856991..4857118,
FT                   4872576..>4872673))
FT                   /codon_start=1
FT                   /gene="Usp15"
FT                   /locus_tag="mCG_12027"
FT                   /product="ubiquitin specific peptidase 15, isoform CRA_c"
FT                   /note="gene_id=mCG12027.2 transcript_id=mCT192002.0
FT                   protein_id=mCP112921.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8R5H1"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR006615"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028134"
FT                   /db_xref="InterPro:IPR028135"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR029346"
FT                   /db_xref="InterPro:IPR035927"
FT                   /db_xref="MGI:MGI:101857"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R5H1"
FT                   /protein_id="EDL24441.1"
FT                   /translation="WKKMAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWK
FT                   KYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLV
FT                   SWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDT
FT                   IEKEIRKIFNIPDEKEARLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGT
FT                   WPRGPSTPNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCL
FT                   SNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQV
FT                   GRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWEN
FT                   HLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERSLEVYLVRMD
FT                   PLAKPMQYKVIVPKIGNILDLCTALSALSGVPADKMIVTDIYNHRFHRIFAVDENLSSI
FT                   MERDDIYVFEININRAEDTEHVVIPVCLREKFRHSSYTHHTGSSLFGQPFLMAIPRNNT
FT                   EDKLYNLLLLRMCRYVKMSTETEETDGHLRCCEDQNINGNGPNGLHEEGSPSEMETDEP
FT                   DDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLTGHKKRLFTFQFNNLG
FT                   NNDINYIKDDTSHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYK
FT                   PPKRPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRF
FT                   SYSRYMRDKLDTLVDFPISDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAK
FT                   NKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATG
FT                   IPLESDEDSNDNDNDLENENCMHTN"
FT   CDS             complement(join(4786977..4787159,4792580..4792668,
FT                   4795043..4795146,4797407..4797556,4797985..4798100,
FT                   4798435..4798505,4798884..4799156,4799284..4799399,
FT                   4801145..4801336,4801431..4801525,4801616..4801699,
FT                   4804470..4804694,4804781..4804939,4806473..4806646,
FT                   4822291..4822435,4828582..4828668,4839101..4839162,
FT                   4843736..4843881,4846637..4846763,4851161..4851291,
FT                   4856991..4857118,4872576..4872664))
FT                   /codon_start=1
FT                   /gene="Usp15"
FT                   /locus_tag="mCG_12027"
FT                   /product="ubiquitin specific peptidase 15, isoform CRA_a"
FT                   /note="gene_id=mCG12027.2 transcript_id=mCT12528.2
FT                   protein_id=mCP7971.2 isoform=CRA_a"
FT                   /protein_id="EDL24439.1"
FT                   /translation="MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYV
FT                   GFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWY
FT                   TLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEK
FT                   EIRKIFNIPDEKEARLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPR
FT                   GPSTPKSPGASNFSTLPKISPSSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEPGR
FT                   NNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAK
FT                   SYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRI
FT                   RKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTF
FT                   DPFCYLTLPLPMKKERSLEVYLVRMDPLAKPMQYKVIVPKIGNILDLCTALSALSGVPA
FT                   DKMIVTDIYNHRFHRIFAVDENLSSIMERDDIYVFEININRAEDTEHVVIPVCLREKFR
FT                   HSSYTHHTGSSLFGQPFLMAIPRNNTEDKLYNLLLLRMCRYVKMSTETEETDGHLRCCE
FT                   DQNINGNGPNGLHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDNDSENGL
FT                   CTEETCKGQLTGHKKRLFTFQFNNLGNNDINYIKDDTSHIRFDDRQLRLDERSFLALDW
FT                   DPDLKKRYFDENAAEDFEKHESVEYKPPKRPFVKLKDCIELFTTKEKLGAEDPWYCPNC
FT                   KEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPISDLDMSEFLINPNAG
FT                   PCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFY
FT                   QRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDLENENCMHTN"
FT   mRNA            complement(join(4794957..4795146,4797407..4797556,
FT                   4797985..4798100,4798435..4798505,4798884..4799156,
FT                   4799284..4799399,4801145..4801336,4801431..4801525,
FT                   4801616..4801699,4804470..4804694,4804781..4804939,
FT                   4806473..4806646,4822291..4822435,4822744..4822828))
FT                   /gene="Usp15"
FT                   /locus_tag="mCG_12027"
FT                   /product="ubiquitin specific peptidase 15, transcript
FT                   variant mCT172032"
FT                   /note="gene_id=mCG12027.2 transcript_id=mCT172032.0 created
FT                   on 16-AUG-2002"
FT   CDS             complement(join(4794972..4795146,4797407..4797556,
FT                   4797985..4798100,4798435..4798505,4798884..4799156,
FT                   4799284..4799399,4801145..4801336,4801431..4801525,
FT                   4801616..4801699,4804470..4804694,4804781..4804939,
FT                   4806473..4806646,4822291..4822435,4822744..4822760))
FT                   /codon_start=1
FT                   /gene="Usp15"
FT                   /locus_tag="mCG_12027"
FT                   /product="ubiquitin specific peptidase 15, isoform CRA_b"
FT                   /note="gene_id=mCG12027.2 transcript_id=mCT172032.0
FT                   protein_id=mCP94951.0 isoform=CRA_b"
FT                   /protein_id="EDL24440.1"
FT                   /translation="MIDCCSVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGN
FT                   TCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFS
FT                   YVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRP
FT                   DKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKE
FT                   RSLEVYLVRMDPLAKPMQYKVIVPKIGNILDLCTALSALSGVPADKMIVTDIYNHRFHR
FT                   IFAVDENLSSIMERDDIYVFEININRAEDTEHVVIPVCLREKFRHSSYTHHTGSSLFGQ
FT                   PFLMAIPRNNTEDKLYNLLLLRMCRYVKMSTETEETDGHLRCCEDQNINGNGPNGLHEE
FT                   GSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLTGHKK
FT                   RLFTFQFNNLGNNDINYIKDDTSHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAE
FT                   DFEKHESVEYKPPKRPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSL
FT                   PPVLVVHLKRFSYSRYMRDKLDTLVDFPISDLDMSEFLINPNAGPCRYNLIAVSNHYGG
FT                   MGGGHCKLTFYILTFSCTFSCNIVSTFK"
FT   assembly_gap    4802759..4802778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4808363..4808382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4809605..4809644
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    4810716..4812356
FT                   /estimated_length=1641
FT                   /gap_type="unknown"
FT   assembly_gap    4814300..4814319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4815535..4815554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4817574..4817593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4862033..4862052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4879590..4879710
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    4883655..4883702
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    4887953..4888411
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    4890845..4890864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4914671..4914690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4926651..4926670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4930739..4930758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4937628..4937667
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   gene            4940005..5413933
FT                   /gene="AI851790"
FT                   /locus_tag="mCG_145706"
FT                   /note="gene_id=mCG145706.0"
FT   mRNA            join(4940005..4941356,5106553..5106764,5266351..5266457,
FT                   5377339..5377491,5378679..5378803,5411767..5413933)
FT                   /gene="AI851790"
FT                   /locus_tag="mCG_145706"
FT                   /product="expressed sequence AI851790"
FT                   /note="gene_id=mCG145706.0 transcript_id=mCT185267.0
FT                   created on 13-JUN-2003"
FT   assembly_gap    4956431..4956450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4966693..4966723
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    4983193..4983212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5019537..5019556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5021352..5022781
FT                   /estimated_length=1430
FT                   /gap_type="unknown"
FT   assembly_gap    5042194..5042213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5045555..5045574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5055791..5055810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5060708..5060727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5076231..5076443
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    5080659..5080678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5094402..5094421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5097863..5098275
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    5101309..5101328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(5106754..5106764,5266351..5266457,5377339..5377491,
FT                   5378679..5378803,5411767..5411778)
FT                   /codon_start=1
FT                   /gene="AI851790"
FT                   /locus_tag="mCG_145706"
FT                   /product="expressed sequence AI851790"
FT                   /note="gene_id=mCG145706.0 transcript_id=mCT185267.0
FT                   protein_id=mCP106525.0"
FT                   /db_xref="InterPro:IPR020350"
FT                   /db_xref="MGI:MGI:2143691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0M7"
FT                   /protein_id="EDL24442.1"
FT                   /translation="MITKMNKRYLQKATQGKLLIIIFIVTLWGKAVSSANHHKAHHVRT
FT                   GTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQP
FT                   CLEGEECKVLPDRKGWSCSSGNKVKTTRVTH"
FT   assembly_gap    5114595..5114691
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    5149058..5149159
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    5160370..5161033
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    5170445..5170464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5190469..5190542
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    5191979..5193336
FT                   /estimated_length=1358
FT                   /gap_type="unknown"
FT   assembly_gap    5199369..5200091
FT                   /estimated_length=723
FT                   /gap_type="unknown"
FT   assembly_gap    5201302..5201806
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    5209210..5209229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5215420..5215439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5222022..5222516
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    5301542..5301679
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    5371651..5371670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5415634..5415653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5436690..5436889
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    5442334..5442499
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    5481697..5481716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5487269..5487578
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    5535207..5537774
FT                   /estimated_length=2568
FT                   /gap_type="unknown"
FT   assembly_gap    5558935..5558954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5562524..5563607)
FT                   /pseudo
FT                   /locus_tag="mCG_55566"
FT                   /note="gene_id=mCG55566.2"
FT   mRNA            complement(5562524..5563607)
FT                   /pseudo
FT                   /locus_tag="mCG_55566"
FT                   /note="gene_id=mCG55566.2 transcript_id=mCT55749.2 created
FT                   on 16-AUG-2002"
FT   assembly_gap    5596557..5596781
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    5638475..5638494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5641064..5641083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5642215..5642234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5716252..5716271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5740518..5740537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5741908..5741927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5743530..5743549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5745487..5745506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5748290..5748309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5749915..5750158
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    5751430..5751864
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    5761331..5761350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5800816..5800903
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    5804962..5805173
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    5805970..5806391
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   assembly_gap    5841963..5843351
FT                   /estimated_length=1389
FT                   /gap_type="unknown"
FT   assembly_gap    5872178..5872306
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   gene            5898669..5899235
FT                   /pseudo
FT                   /locus_tag="mCG_51899"
FT                   /note="gene_id=mCG51899.2"
FT   mRNA            5898669..5899235
FT                   /pseudo
FT                   /locus_tag="mCG_51899"
FT                   /note="gene_id=mCG51899.2 transcript_id=mCT52082.2 created
FT                   on 16-AUG-2002"
FT   assembly_gap    5911565..5913362
FT                   /estimated_length=1798
FT                   /gap_type="unknown"
FT   assembly_gap    5975993..5976012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5983446..5983541
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    5984940..5984959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5986000..5986019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5992387..5992683
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   gene            6022453..6094055
FT                   /pseudo
FT                   /locus_tag="mCG_1048820"
FT                   /note="gene_id=mCG1048820.0"
FT   mRNA            join(6022453..6024647,6093955..6094055)
FT                   /pseudo
FT                   /locus_tag="mCG_1048820"
FT                   /note="gene_id=mCG1048820.0 transcript_id=mCT166524.1
FT                   created on 16-AUG-2002"
FT   assembly_gap    6025561..6025580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6048261..6048492
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    6049324..6049496
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    6079646..6079665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6080861..6080880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6082956..6082975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6084422..6084441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6086026..6086045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6087142..6087161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6098295..6100042
FT                   /estimated_length=1748
FT                   /gap_type="unknown"
FT   assembly_gap    6100986..6101005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6115334..6116464
FT                   /estimated_length=1131
FT                   /gap_type="unknown"
FT   assembly_gap    6122927..6122961
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    6136067..6136086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6153851..6153893
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    6155043..6155062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6156762..6212923
FT                   /locus_tag="mCG_4532"
FT                   /note="gene_id=mCG4532.3"
FT   mRNA            join(<6156762..6156813,6164880..6164911,6183898..6184093,
FT                   6211873..6212923)
FT                   /locus_tag="mCG_4532"
FT                   /product="mCG4532"
FT                   /note="gene_id=mCG4532.3 transcript_id=mCT3451.3 created on
FT                   06-JUN-2003"
FT   assembly_gap    6159363..6159382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6168675..6168768
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    6185852..6185871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6193843..6193862
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <6211889..6212224
FT                   /codon_start=1
FT                   /locus_tag="mCG_4532"
FT                   /product="mCG4532"
FT                   /note="gene_id=mCG4532.3 transcript_id=mCT3451.3
FT                   protein_id=mCP19155.2"
FT                   /protein_id="EDL24443.1"
FT                   /translation="RSSITMKYNLLFTVAKDPLFNVCCSDNGERLGTYMGHTGPVWCVD
FT                   ADWDTKHVLTGSADNNCCLWDCETGKQLSLLKTNSAVRTCGFDFGGQHHYVLHRQADGV
FT                   SMFCKLL"
FT   assembly_gap    6219116..6219215
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    6255251..6255345
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    6267023..6267042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6292393..6293345
FT                   /estimated_length=953
FT                   /gap_type="unknown"
FT   assembly_gap    6301402..6301824
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    6331844..6331863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6332891..6332910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6336900..6336919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6338985..6339004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6362620..6362639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6363761..6363780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6369888..6375773
FT                   /estimated_length=5886
FT                   /gap_type="unknown"
FT   assembly_gap    6384427..6384446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6391604..6391623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6409744..6409763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6446656..6446776
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    6490813..6491051
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    6508915..6508934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6521356..6521375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6521983..6522002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6533261..6533280
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6555039..6555058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6563017..6563036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6564611..6572364
FT                   /estimated_length=7754
FT                   /gap_type="unknown"
FT   assembly_gap    6574122..6574141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6576569..6576588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6577670..6578779
FT                   /estimated_length=1110
FT                   /gap_type="unknown"
FT   assembly_gap    6580121..6580615
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    6591030..6591349
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    6604840..6604859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6611797..6611816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6613806..6613884
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    6622758..6622777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6650202..6650450
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    6654155..6654318
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    6658258..6658814
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    6704419..6704438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6719310..6721440
FT                   /estimated_length=2131
FT                   /gap_type="unknown"
FT   assembly_gap    6731306..6732240
FT                   /estimated_length=935
FT                   /gap_type="unknown"
FT   assembly_gap    6748136..6748684
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    6772891..6772910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6788235..6788338
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    6815904..6815972
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    6823438..6824061
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    6827416..6827435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6828200..6828442
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    6832194..6832233
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    6845694..6845713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6852021..6852040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6856420..6857789
FT                   /estimated_length=1370
FT                   /gap_type="unknown"
FT   assembly_gap    6890391..6890410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6893963..6894434
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    6915042..6915272
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   gene            complement(6923689..7005133)
FT                   /gene="Slc16a7"
FT                   /locus_tag="mCG_21748"
FT                   /note="gene_id=mCG21748.2"
FT   mRNA            complement(join(6923689..6924492,6926797..6927609,
FT                   6929637..6929780,6990926..6991175,6998294..6998418,
FT                   7005030..7005133))
FT                   /gene="Slc16a7"
FT                   /locus_tag="mCG_21748"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 7, transcript variant mCT171134"
FT                   /note="gene_id=mCG21748.2 transcript_id=mCT171134.0 created
FT                   on 09-AUG-2002"
FT   mRNA            complement(join(6923689..6924492,6926797..6927609,
FT                   6929637..6929780,6990926..6991175,6994954..6995034,
FT                   6998294..6998418))
FT                   /gene="Slc16a7"
FT                   /locus_tag="mCG_21748"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 7, transcript variant mCT20683"
FT                   /note="gene_id=mCG21748.2 transcript_id=mCT20683.2 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(6924215..6924492,6926797..6927609,
FT                   6929637..6929780,6990926..6991145))
FT                   /codon_start=1
FT                   /gene="Slc16a7"
FT                   /locus_tag="mCG_21748"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 7, isoform CRA_a"
FT                   /note="gene_id=mCG21748.2 transcript_id=mCT171134.0
FT                   protein_id=mCP94052.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q149G3"
FT                   /db_xref="InterPro:IPR004743"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR027178"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="MGI:MGI:1330284"
FT                   /db_xref="UniProtKB/TrEMBL:Q149G3"
FT                   /protein_id="EDL24444.1"
FT                   /translation="MPSEPSAPLPQPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFF
FT                   KDIQEIFNTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCIGMILA
FT                   SYSNSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFYRRRPLANGCAMAGSPVFLSTLA
FT                   PFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLMRPVGPSPNTKKSKSKVGSRHDSTLKK
FT                   ASKVSTAQKVNRFLDFSLFMHRGFLIYLSGNVILFLGIFAPIIFLAQYAKHIGVDDYNS
FT                   AFLLSVMAFIDMFARPSVGLIANTSLIRPRIQYLFSSAIIFTGICHLLCPLATTYSALV
FT                   VYVVFFGLGFGSISSLLFECLMDIVGATRFSSAVGLTTIVECCPVLFGPPLAGKLLDIT
FT                   GEYKYLYIASGTVVLVSGTYLLIGNAINYRLLDKERKREKAKKKKSASHASREMEALNR
FT                   SKQDEVTVKASNAHNPPSDRDKESNI"
FT   CDS             complement(join(6924215..6924492,6926797..6927609,
FT                   6929637..6929780,6990926..6991145))
FT                   /codon_start=1
FT                   /gene="Slc16a7"
FT                   /locus_tag="mCG_21748"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 7, isoform CRA_a"
FT                   /note="gene_id=mCG21748.2 transcript_id=mCT20683.2
FT                   protein_id=mCP22001.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q149G3"
FT                   /db_xref="InterPro:IPR004743"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR027178"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="MGI:MGI:1330284"
FT                   /db_xref="UniProtKB/TrEMBL:Q149G3"
FT                   /protein_id="EDL24445.1"
FT                   /translation="MPSEPSAPLPQPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFF
FT                   KDIQEIFNTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCIGMILA
FT                   SYSNSVIELYLTVGFIGGLGLAFNLQPALTIIGKYFYRRRPLANGCAMAGSPVFLSTLA
FT                   PFNQYLFNNYGWKGSFLILGGIFLHSCVAGCLMRPVGPSPNTKKSKSKVGSRHDSTLKK
FT                   ASKVSTAQKVNRFLDFSLFMHRGFLIYLSGNVILFLGIFAPIIFLAQYAKHIGVDDYNS
FT                   AFLLSVMAFIDMFARPSVGLIANTSLIRPRIQYLFSSAIIFTGICHLLCPLATTYSALV
FT                   VYVVFFGLGFGSISSLLFECLMDIVGATRFSSAVGLTTIVECCPVLFGPPLAGKLLDIT
FT                   GEYKYLYIASGTVVLVSGTYLLIGNAINYRLLDKERKREKAKKKKSASHASREMEALNR
FT                   SKQDEVTVKASNAHNPPSDRDKESNI"
FT   assembly_gap    6933141..6933160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6972345..6972737
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   gene            7005210..7006992
FT                   /locus_tag="mCG_1048826"
FT                   /note="gene_id=mCG1048826.0"
FT   mRNA            join(7005210..7005364,7006583..7006992)
FT                   /locus_tag="mCG_1048826"
FT                   /product="mCG1048826"
FT                   /note="gene_id=mCG1048826.0 transcript_id=mCT166530.0
FT                   created on 19-AUG-2002"
FT   CDS             7006640..7006861
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048826"
FT                   /product="mCG1048826"
FT                   /note="gene_id=mCG1048826.0 transcript_id=mCT166530.0
FT                   protein_id=mCP44449.1"
FT                   /protein_id="EDL24446.1"
FT                   /translation="MQILTANHWTEVRDPYGRLRRAEGDGNPIGRPTVSTNWTPGSSQR
FT                   VNRQPKIINGLVRAIQHMCSKGLPCWPS"
FT   gene            complement(7035448..>7085769)
FT                   /locus_tag="mCG_1048827"
FT                   /note="gene_id=mCG1048827.0"
FT   mRNA            complement(join(7035448..7035542,7038090..7038159,
FT                   7073875..7073978,7085688..>7085769))
FT                   /locus_tag="mCG_1048827"
FT                   /product="mCG1048827"
FT                   /note="gene_id=mCG1048827.0 transcript_id=mCT166531.0
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(7035479..7035542,7038090..7038159,
FT                   7073875..>7073947))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048827"
FT                   /product="mCG1048827"
FT                   /note="gene_id=mCG1048827.0 transcript_id=mCT166531.0
FT                   protein_id=mCP44466.0"
FT                   /protein_id="EDL24447.1"
FT                   /translation="EIRLTLVKCREEADTSHTIGNTWTDNSAPCVNVNAVLTELHHTSY
FT                   VTRSQAWHVVFSCGDLHKGIQAP"
FT   assembly_gap    7056691..7056957
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    7090689..7090763
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    7120945..7121018
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    7124679..7125388
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    7127269..7127288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7129388..7129407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7143679..7143698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7151543..7151562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7152686..7152705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7174062..7174166
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    7181304..7181369
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    7186316..7187266
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    7199075..7199146
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    7202697..7202725
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    7204381..7204400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7211873..7212319
FT                   /pseudo
FT                   /locus_tag="mCG_117778"
FT                   /note="gene_id=mCG117778.1"
FT   mRNA            7211873..7212319
FT                   /pseudo
FT                   /locus_tag="mCG_117778"
FT                   /note="gene_id=mCG117778.1 transcript_id=mCT118923.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    7252196..7252215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7265959..7266075
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    7275981..7276000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7281910..7282003
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    7302445..7302480
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    7324664..7325335
FT                   /estimated_length=672
FT                   /gap_type="unknown"
FT   assembly_gap    7336178..7336884
FT                   /estimated_length=707
FT                   /gap_type="unknown"
FT   assembly_gap    7414212..7419359
FT                   /estimated_length=5148
FT                   /gap_type="unknown"
FT   assembly_gap    7475138..7475157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7518469..7518488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7545799..7545818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7556109..7556246
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    7593717..7593777
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    7600363..7600488
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    7603335..7603354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7605693..7606055
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    7618206..7618371
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    7642125..7642144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7653943..7653962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7667120..7716518
FT                   /gene="Lrig3"
FT                   /locus_tag="mCG_21242"
FT                   /note="gene_id=mCG21242.2"
FT   mRNA            join(7667120..7667614,7673020..7673091,7673297..7673371,
FT                   7695428..7695559,7696460..7696603,7697641..7697784,
FT                   7698088..7698231,7698630..7698773,7699973..7700053,
FT                   7701112..7701183,7703539..7703610,7704080..7704243,
FT                   7707826..7708146,7709605..7709886,7710922..7711374,
FT                   7712036..7712194,7714170..7714313,7714412..7714681,
FT                   7715836..7716518)
FT                   /gene="Lrig3"
FT                   /locus_tag="mCG_21242"
FT                   /product="leucine-rich repeats and immunoglobulin-like
FT                   domains 3"
FT                   /note="gene_id=mCG21242.2 transcript_id=mCT20677.2 created
FT                   on 19-AUG-2002"
FT   CDS             join(7667379..7667614,7673020..7673091,7673297..7673371,
FT                   7695428..7695559,7696460..7696603,7697641..7697784,
FT                   7698088..7698231,7698630..7698773,7699973..7700053,
FT                   7701112..7701183,7703539..7703610,7704080..7704243,
FT                   7707826..7708146,7709605..7709886,7710922..7711374,
FT                   7712036..7712194,7714170..7714313,7714412..7714681,
FT                   7715836..7716080)
FT                   /codon_start=1
FT                   /gene="Lrig3"
FT                   /locus_tag="mCG_21242"
FT                   /product="leucine-rich repeats and immunoglobulin-like
FT                   domains 3"
FT                   /note="gene_id=mCG21242.2 transcript_id=mCT20677.2
FT                   protein_id=mCP22002.2"
FT                   /protein_id="EDL24448.1"
FT                   /translation="MGAPGLRAATAALGLLLCAGLGRAGPAGSGGHGAPGQILDDDAQR
FT                   PCPAACHCLGDLLDCSRRRLVRLPDPLPAWVTRLDLSHNRLSFIQTSSLSHLQSLQEVK
FT                   LNNNELETIPNLGSISANIRQLSLAGNAIDKILPEQLEAFQSLETLDLSNNNISELRTA
FT                   FPPLQLKYLYINNNRVSSMEPGYFDNLASTLLVLKLNRNRISAIPPKMFKLPQLQHLEL
FT                   NRNKIKNVDGLTFQGLGALKSLKMQRNGVTKLMDGAFWGLSNMEVLQLDHNNLTEITKG
FT                   WLYGLLMLRELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNAL
FT                   HIGNNKVSYIADCAFRGLTSLKTLDLRNNEISWTIEDMSGAFSGLDRLRQLILQGNRIR
FT                   SITKKAFAGLDTLEHLDLSGNAIMSLQSNAFSQMKKLQQLHLNTSSLLCDCQLRWLPQW
FT                   VAENNFQSFVNASCAHPQLLKGRSIFTVSPDGFVCDDFPKPQITVQPETQSAIKGSDVS
FT                   FTCSAASSSDSPMTFAWKKDNEALQDAEMENYAHLRAQGGELMEYTTILRLRNVEFTSE
FT                   GKYQCVISNHFGSSYSVKAKLTINMLPSFTKTPMDLTIRAGAMARLECAAVGHPAPQIA
FT                   WQKDGGTDFPAARERRMHVMPEDDVFFIVDVKIEDIGVYSCTAQNSAGSVSANATLTVL
FT                   ETPSFLRPLLDRTVTKGETAVLQCIAGGSPPPRLNWTKDDSPLVVTERHFFAAGNQLLI
FT                   IVDSDVSDAGKYTCEMSNTLGTERGNVRLSVIPTPTCDSPHMTAPSLDGDGWATVGVVI
FT                   IAVVCCVVGTSLVWVVIIYHTRRRNEDCSITNTDETNLPADIPSYLSSQGTLADRQDGY
FT                   ISSESGSHHQFVTSSGGGFFLPQHDGAGTCHFDDSSEADVEAASDPFLCPFVGSTGPVY
FT                   LQGNLYSPDPFEVYLPGCSSDPRTALMDHCESSYVKQDRFSCARPSEEPCERSLKSIPW
FT                   PHSRKLTDSTYPPNEGHTVQTLCLNKSSVDFSTGPEPGSATSSNSFMGTFGKPLRRPHL
FT                   DAFSSFAQPPDCQPRPCHGKSLSSPELDSESEENDKERTDFREENHRCTYQQIFHTYRT
FT                   PDCQPCDSDT"
FT   assembly_gap    7674654..7674673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7678394..7678413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7680553..7681160
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    7736986..7737409
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    7774541..7774560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7797021..7797386
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    7799818..7800332
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    7807919..7807938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7810075..7810385
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    7812925..7812944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7822649..7822668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7852490..7853587
FT                   /estimated_length=1098
FT                   /gap_type="unknown"
FT   assembly_gap    7860822..7860841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7865263..7865282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7870851..7871602
FT                   /estimated_length=752
FT                   /gap_type="unknown"
FT   gene            7885588..7886020
FT                   /pseudo
FT                   /locus_tag="mCG_53613"
FT                   /note="gene_id=mCG53613.2"
FT   mRNA            7885588..7886020
FT                   /pseudo
FT                   /locus_tag="mCG_53613"
FT                   /note="gene_id=mCG53613.2 transcript_id=mCT53796.2 created
FT                   on 19-AUG-2002"
FT   assembly_gap    7889525..7889753
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    7890858..7891241
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    7892524..7893069
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    7905785..7905942
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    7915543..7915816
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    7938529..7938548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7942177..7943069
FT                   /estimated_length=893
FT                   /gap_type="unknown"
FT   assembly_gap    7974068..7974405
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    7980083..7980102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7981460..7982314
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    7984835..7984885
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            <7995726..7996272
FT                   /locus_tag="mCG_1048764"
FT                   /note="gene_id=mCG1048764.0"
FT   mRNA            join(<7995726..7995897,7995921..7996272)
FT                   /locus_tag="mCG_1048764"
FT                   /product="mCG1048764"
FT                   /note="gene_id=mCG1048764.0 transcript_id=mCT166468.0
FT                   created on 19-AUG-2002"
FT   CDS             <7995728..7995889
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048764"
FT                   /product="mCG1048764"
FT                   /note="gene_id=mCG1048764.0 transcript_id=mCT166468.0
FT                   protein_id=mCP44394.0"
FT                   /protein_id="EDL24449.1"
FT                   /translation="RKPPRIECSDNSWDQQGLHLKFPNLRSQGQGLRVLAIVPILVSCI
FT                   VHLPLRPL"
FT   assembly_gap    7997220..7997499
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    8007788..8007807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8009241..8009260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8019785..8019804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8039894..8040543
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    8042939..8042958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8050918..8050937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8062784..8063401
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   gene            8067766..8070859
FT                   /locus_tag="mCG_147839"
FT                   /note="gene_id=mCG147839.0"
FT   mRNA            join(8067766..8067852,8069772..8070859)
FT                   /locus_tag="mCG_147839"
FT                   /product="mCG147839"
FT                   /note="gene_id=mCG147839.0 transcript_id=mCT188102.0
FT                   created on 13-JAN-2004"
FT   CDS             8070446..8070646
FT                   /codon_start=1
FT                   /locus_tag="mCG_147839"
FT                   /product="mCG147839"
FT                   /note="gene_id=mCG147839.0 transcript_id=mCT188102.0
FT                   protein_id=mCP108213.0"
FT                   /protein_id="EDL24450.1"
FT                   /translation="MFNEKIETVAYTFIFVYSAQAKAKCAINSSKYIQEKKNQSINHNC
FT                   FPEMKSISSFCINLCFVSNVF"
FT   assembly_gap    8070997..8071624
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    8088374..8088688
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    8104302..8104325
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    8123115..8123134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8128392..8128411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8130994..8131514
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    8133192..8133211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8134934..8134953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8136874..8136893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8138723..8138742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8157036..8158028
FT                   /estimated_length=993
FT                   /gap_type="unknown"
FT   assembly_gap    8160993..8161012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8162613..8164967
FT                   /estimated_length=2355
FT                   /gap_type="unknown"
FT   assembly_gap    8169014..8169214
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    8171510..8171651
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    8173238..8173257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8193913..8193932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8195070..8195223
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    8216234..8216253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8218276..8218341
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    8225521..8225552
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    8237071..8239284
FT                   /estimated_length=2214
FT                   /gap_type="unknown"
FT   assembly_gap    8240740..8240953
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    8247802..8247821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8253732..8253751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8257940..>8298381)
FT                   /locus_tag="mCG_1048838"
FT                   /note="gene_id=mCG1048838.0"
FT   mRNA            complement(join(8257940..8258618,8298287..>8298381))
FT                   /locus_tag="mCG_1048838"
FT                   /product="mCG1048838"
FT                   /note="gene_id=mCG1048838.0 transcript_id=mCT166542.0
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(8258451..8258618,8298287..>8298379))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048838"
FT                   /product="mCG1048838"
FT                   /note="gene_id=mCG1048838.0 transcript_id=mCT166542.0
FT                   protein_id=mCP44625.0"
FT                   /protein_id="EDL24451.1"
FT                   /translation="DITSKSDSQREEFIVGYGSRRIWASWQGSLEMFPLPSFCPAGFLK
FT                   SWQWIRTDGSKERPRALTGIFHAHSRSAWHRQGFCSRTSAP"
FT   assembly_gap    8284360..8284530
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    8287510..8287989
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    8307256..8307275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8311567..8311586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8312602..8312621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8313861..8313880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8317024..8317116
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    8344006..8344025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8354992..8364948
FT                   /locus_tag="mCG_54513"
FT                   /note="gene_id=mCG54513.2"
FT   mRNA            join(<8354992..8355020,8364706..8364948)
FT                   /locus_tag="mCG_54513"
FT                   /product="mCG54513"
FT                   /note="gene_id=mCG54513.2 transcript_id=mCT54696.2 created
FT                   on 19-AUG-2002"
FT   CDS             join(<8355015..8355020,8364706..8364783)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54513"
FT                   /product="mCG54513"
FT                   /note="gene_id=mCG54513.2 transcript_id=mCT54696.2
FT                   protein_id=mCP27419.2"
FT                   /protein_id="EDL24452.1"
FT                   /translation="GLGLRATWEQISRIIQHRFVMMGRPYV"
FT   assembly_gap    8356352..8356639
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    8360355..8360553
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    8363551..8364638
FT                   /estimated_length=1088
FT                   /gap_type="unknown"
FT   assembly_gap    8367697..8368658
FT                   /estimated_length=962
FT                   /gap_type="unknown"
FT   assembly_gap    8370379..8370398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8372795..8374636
FT                   /estimated_length=1842
FT                   /gap_type="unknown"
FT   assembly_gap    8379150..8379169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8390084..8390353
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    8391227..8392097
FT                   /estimated_length=871
FT                   /gap_type="unknown"
FT   assembly_gap    8428762..8431095
FT                   /estimated_length=2334
FT                   /gap_type="unknown"
FT   assembly_gap    8438265..8438284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8447014..8447033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8468668..8468915
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    8470112..8470594
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   assembly_gap    8471483..8471502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8473242..>8478085)
FT                   /locus_tag="mCG_146003"
FT                   /note="gene_id=mCG146003.0"
FT   mRNA            complement(join(8473242..8473593,8474455..8474541,
FT                   8476491..8476625,8476921..>8478085))
FT                   /locus_tag="mCG_146003"
FT                   /product="mCG146003"
FT                   /note="gene_id=mCG146003.0 transcript_id=mCT186111.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(8477025..>8477258)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146003"
FT                   /product="mCG146003"
FT                   /note="gene_id=mCG146003.0 transcript_id=mCT186111.0
FT                   protein_id=mCP107353.0"
FT                   /protein_id="EDL24453.1"
FT                   /translation="LPTGYLLKFNLSPKEKMTYSSVVQPGMETTSRGRSISRATASQGF
FT                   RRKALGAHYWITELGRTTVPSALCFICRLQFV"
FT   assembly_gap    8481007..8481522
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    8495879..8496227
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    8506586..8506605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8535071..8535614
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    8536792..8537151
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    8547920..8547939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8552467..8585258)
FT                   /gene="Xrcc6bp1"
FT                   /locus_tag="mCG_5195"
FT                   /note="gene_id=mCG5195.2"
FT   mRNA            complement(join(8552467..8552762,8575569..8575652,
FT                   8578154..8578291,8582790..8582871,8583484..8583529,
FT                   8585005..8585258))
FT                   /gene="Xrcc6bp1"
FT                   /locus_tag="mCG_5195"
FT                   /product="XRCC6 binding protein 1, transcript variant
FT                   mCT172455"
FT                   /note="gene_id=mCG5195.2 transcript_id=mCT172455.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(8552694..8552762,8575569..8575652,
FT                   8578154..8578291,8582790..8582871,8583484..8583529,
FT                   8585005..8585191))
FT                   /codon_start=1
FT                   /gene="Xrcc6bp1"
FT                   /locus_tag="mCG_5195"
FT                   /product="XRCC6 binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG5195.2 transcript_id=mCT172455.0
FT                   protein_id=mCP95374.0 isoform=CRA_a"
FT                   /protein_id="EDL24454.1"
FT                   /translation="MAGAPGGGELGPAAGEPLLQRPDSGQGSPEPPAHGKPQQGFLSSL
FT                   FTRDQSCPLMLQKTLDTNPYVKLLLDAMKHSGCAVNRGRHFSCEVCDGNVSGGFDASTS
FT                   QIVLCENNIRNQAHMGRVVTHELIHAFDHCRAHVHWFTNIRHLACSEIRAASLSGDCSL
FT                   VNELFRLRFGLKQHHQIETSCVSRPAMNSQSCLGLVSA"
FT   assembly_gap    8558627..8559028
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    8559899..8560005
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    8561438..8561759
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   mRNA            complement(join(8571148..8571623,8575569..8575652,
FT                   8578154..8578291,8582790..8582871,8583484..8583529,
FT                   8585005..8585257))
FT                   /gene="Xrcc6bp1"
FT                   /locus_tag="mCG_5195"
FT                   /product="XRCC6 binding protein 1, transcript variant
FT                   mCT3894"
FT                   /note="gene_id=mCG5195.2 transcript_id=mCT3894.2 created on
FT                   19-AUG-2002"
FT   CDS             complement(join(8571420..8571623,8575569..8575652,
FT                   8578154..8578291,8582790..8582871,8583484..8583529,
FT                   8585005..8585191))
FT                   /codon_start=1
FT                   /gene="Xrcc6bp1"
FT                   /locus_tag="mCG_5195"
FT                   /product="XRCC6 binding protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG5195.2 transcript_id=mCT3894.2
FT                   protein_id=mCP4420.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3UW46"
FT                   /db_xref="InterPro:IPR019165"
FT                   /db_xref="MGI:MGI:1916984"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW46"
FT                   /protein_id="EDL24455.1"
FT                   /translation="MAGAPGGGELGPAAGEPLLQRPDSGQGSPEPPAHGKPQQGFLSSL
FT                   FTRDQSCPLMLQKTLDTNPYVKLLLDAMKHSGCAVNRGRHFSCEVCDGNVSGGFDASTS
FT                   QIVLCENNIRNQAHMGRVVTHELIHAFDHCRAHVHWFTNIRHLACSEIRAASLSGDCSL
FT                   VNELFRLRFGLKQHHQTCVRDRAVLSILAVRNVSREEAQKAVDEVFQTCFNDREPFGRI
FT                   PHNQTYARYAHRDFQNRDRYYSNI"
FT   gene            8577042..8577840
FT                   /pseudo
FT                   /locus_tag="mCG_5200"
FT                   /note="gene_id=mCG5200.0"
FT   mRNA            8577042..8577840
FT                   /pseudo
FT                   /locus_tag="mCG_5200"
FT                   /note="gene_id=mCG5200.0 transcript_id=mCT3888.1 created on
FT                   19-AUG-2002"
FT   assembly_gap    8593534..8593745
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    8597521..8597695
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    8598405..8598525
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    8601803..8601822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8605706..8605725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8607898..8611157
FT                   /estimated_length=3260
FT                   /gap_type="unknown"
FT   assembly_gap    8614378..8614665
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    8618987..8619142
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    8641748..8643022
FT                   /estimated_length=1275
FT                   /gap_type="unknown"
FT   assembly_gap    8644127..8644244
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    8647954..8648141
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   gene            8651000..8662199
FT                   /locus_tag="mCG_147832"
FT                   /note="gene_id=mCG147832.0"
FT   mRNA            join(8651000..8651025,8659941..8662199)
FT                   /locus_tag="mCG_147832"
FT                   /product="mCG147832"
FT                   /note="gene_id=mCG147832.0 transcript_id=mCT188095.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    8651170..8651189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8653033..8653052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8658172..8658242
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   CDS             8661050..8661370
FT                   /codon_start=1
FT                   /locus_tag="mCG_147832"
FT                   /product="mCG147832"
FT                   /note="gene_id=mCG147832.0 transcript_id=mCT188095.0
FT                   protein_id=mCP108206.0"
FT                   /protein_id="EDL24456.1"
FT                   /translation="MTSFRECLEKGSRLGVVASAFNPSRGRGRQISEFEASLVYKVSSR
FT                   TARATQRNPVSEKPKKKKERKKEKGSRSHDEDIPVIPGLRGLRQEDRCSSGYHELCGNA
FT                   RL"
FT   assembly_gap    8662828..8663023
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   gene            8663724..8681562
FT                   /gene="Ctdsp2"
FT                   /locus_tag="mCG_5178"
FT                   /note="gene_id=mCG5178.2"
FT   mRNA            join(8663724..8663888,8664000..8664071,8676408..8676553,
FT                   8677476..8677514,8677885..8677986,8678723..8678779,
FT                   8680726..8680818,8680897..8681082,8681232..8681562)
FT                   /gene="Ctdsp2"
FT                   /locus_tag="mCG_5178"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase 2"
FT                   /note="gene_id=mCG5178.2 transcript_id=mCT3910.2 created on
FT                   19-AUG-2002"
FT   CDS             join(8664008..8664071,8676408..8676553,8677476..8677514,
FT                   8677885..8677986,8678723..8678779,8680726..8680818,
FT                   8680897..8681082,8681232..8681357)
FT                   /codon_start=1
FT                   /gene="Ctdsp2"
FT                   /locus_tag="mCG_5178"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase 2"
FT                   /note="gene_id=mCG5178.2 transcript_id=mCT3910.2
FT                   protein_id=mCP4465.2"
FT                   /protein_id="EDL24457.1"
FT                   /translation="MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRSIFKALLCCF
FT                   HTQHVVQSSSSTELTHKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEQDQGRICVV
FT                   IDLDETLVHSSFKPINNADFIVPVEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTA
FT                   SLAKYADPVTDLLDRCGVFRARLFREACVFHQGCYVKDLSRLGRDLRKTVILDNSPASY
FT                   IFHPENAVPVQSWFDDMADTELLNLIPVFEELSGTDDVYTSLGQLRAP"
FT   assembly_gap    8664288..8664437
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    8669025..8669109
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            8685610..>8705408
FT                   /gene="Avil"
FT                   /locus_tag="mCG_5183"
FT                   /note="gene_id=mCG5183.2"
FT   mRNA            join(8685610..8685702,8688237..8688321,8689568..8689642,
FT                   8691366..8691562,8692412..8692520,8692611..8692721,
FT                   8693003..8693205,8693634..8693712,8693832..8693930,
FT                   8694600..8694753,8694848..8694948,8695393..8695530,
FT                   8695772..8695930,8696570..8696749,8698379..8698524,
FT                   8698970..8699114,8701149..8701337,8701803..8701871,
FT                   8703230..8703355,8705295..>8705408)
FT                   /gene="Avil"
FT                   /locus_tag="mCG_5183"
FT                   /product="advillin"
FT                   /note="gene_id=mCG5183.2 transcript_id=mCT3906.2 created on
FT                   07-AUG-2002"
FT   CDS             join(8688256..8688321,8689568..8689642,8691366..8691562,
FT                   8692412..8692520,8692611..8692721,8693003..8693205,
FT                   8693634..8693712,8693832..8693930,8694600..8694753,
FT                   8694848..8694948,8695393..8695530,8695772..8695930,
FT                   8696570..8696749,8698379..8698524,8698970..8699114,
FT                   8701149..8701337,8701803..8701871,8703230..8703355,
FT                   8705295..8705408)
FT                   /codon_start=1
FT                   /gene="Avil"
FT                   /locus_tag="mCG_5183"
FT                   /product="advillin"
FT                   /note="gene_id=mCG5183.2 transcript_id=mCT3906.2
FT                   protein_id=mCP4421.1"
FT                   /db_xref="GOA:O88398"
FT                   /db_xref="InterPro:IPR003128"
FT                   /db_xref="InterPro:IPR007122"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="InterPro:IPR036180"
FT                   /db_xref="InterPro:IPR036886"
FT                   /db_xref="MGI:MGI:1333798"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88398"
FT                   /protein_id="EDL24458.1"
FT                   /translation="MSLSSAFRAVSNDPRIITWRIEKMELALVPLSAHGNFYEGDCYIV
FT                   LSTRRVGSLLSQNIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTF
FT                   RGYFKQGIIYKKGGVASGMKHVETNTYDVKRLLHVKGKRNIQATEVEMSWDSFNRGDVF
FT                   LLDLGMVIIQWNGPESNSGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPGLMTV
FT                   LQDTLGRRSMIKPAVSDEIMDQQQKSSIMLYHVSDTAGQLSVTEVATRPLVQDLLNHDD
FT                   CYILDQSGTKIYVWKGKGATKVEKQAAMSKALDFIKMKGYPSSTNVETVNDGAESAMFK
FT                   QLFQKWSVKDQTTGLGKIFSTGKIAKIFQDKFDVSLLHTKPEVAAQERMVDDGKGQVEV
FT                   WRIENLELVPVEYQWHGFFYGGDCYLVLYTYDVNGKPHYILYIWQGRHASRDELAASAY
FT                   RAVEVDQQFDGAPVQVRVSMGKEPRHFMAIFKGKLVIYEGGTSRKGNEEPDPPVRLFQI
FT                   HGNDKSNTKAVEVSASASSLNSNDVFLLRTQAEHYLWYGKGSSGDERAMAKELVDLLCD
FT                   GNADTVAEGQEPPEFWDLLGGKTAYANDKRLQQETLDVQVRLFECSNKTGRFLVTEVTD
FT                   FTQEDLSPGDVMLLDTWDQVFLWIGAEANATEKKGALSTAQEYLVTHPSGRDPDTPILI
FT                   IKQGFEPPTFTGWFLAWDPHIWSEGKSYEQLKNELGDATAIVRITADMKNATLYLNPSD
FT                   GEPKYYPVEVLLKGQNQELPEDVDPAKKENYLSEQDFVSVFGITRGQFTALPGWKQLQL
FT                   KKERGLF"
FT   assembly_gap    8706493..8706678
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            complement(8707173..>8715665)
FT                   /gene="Tsfm"
FT                   /locus_tag="mCG_5185"
FT                   /note="gene_id=mCG5185.1"
FT   mRNA            complement(join(8707173..8707773,8709783..8709870,
FT                   8713212..8713334,8714401..8714529,8715310..8715483,
FT                   8715591..>8715665))
FT                   /gene="Tsfm"
FT                   /locus_tag="mCG_5185"
FT                   /product="Ts translation elongation factor, mitochondrial,
FT                   transcript variant mCT3898"
FT                   /note="gene_id=mCG5185.1 transcript_id=mCT3898.1 created on
FT                   19-AUG-2002"
FT   CDS             complement(join(8707367..8707773,8709783..8709870,
FT                   8713212..8713334,8714401..8714529,8715310..8715483,
FT                   8715591..8715665))
FT                   /codon_start=1
FT                   /gene="Tsfm"
FT                   /locus_tag="mCG_5185"
FT                   /product="Ts translation elongation factor, mitochondrial,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5185.1 transcript_id=mCT3898.1
FT                   protein_id=mCP4452.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A1S6GWJ9"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="MGI:MGI:1913649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S6GWJ9"
FT                   /protein_id="EDL24460.1"
FT                   /translation="MGGRARGMSLLRSLRFFPVACTGRSARAVLLQPSQPWLTFHAGPS
FT                   LSSAASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEDWLHKQAQKEGWSKAAKLH
FT                   GRKTKEGLIGLLQEGNTAVLVEVNCETDFVSRNLKFQQLVQQVALGTMAHCQNLTDRLS
FT                   TYSKGFLNSSELSELAAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSY
FT                   VHGVTQSPSLQNLVLGKYGALVICETPEQIANLEEVGRRLGQHVVGMAPLSVGSLDDEP
FT                   GGETETRMLPQPYLLDPSITLGQYVQPQGVTVVDFVRFECGEDEQVAEAE"
FT   mRNA            complement(join(8709082..8709870,8713212..8713334,
FT                   8714401..8714529,8715310..8715483,8715591..>8715665))
FT                   /gene="Tsfm"
FT                   /locus_tag="mCG_5185"
FT                   /product="Ts translation elongation factor, mitochondrial,
FT                   transcript variant mCT172454"
FT                   /note="gene_id=mCG5185.1 transcript_id=mCT172454.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(8709769..8709870,8713212..8713334,
FT                   8714401..8714529,8715310..8715483,8715591..8715665))
FT                   /codon_start=1
FT                   /gene="Tsfm"
FT                   /locus_tag="mCG_5185"
FT                   /product="Ts translation elongation factor, mitochondrial,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5185.1 transcript_id=mCT172454.0
FT                   protein_id=mCP95373.0 isoform=CRA_a"
FT                   /protein_id="EDL24459.1"
FT                   /translation="MGGRARGMSLLRSLRFFPVACTGRSARAVLLQPSQPWLTFHAGPS
FT                   LSSAASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEDWLHKQAQKEGWSKAAKLH
FT                   GRKTKEGLIGLLQEGNTAVLVEVNCETDFVSRNLKFQQLVQQVALGTMAHCQNLTDRLS
FT                   TYSKGFLNSSELSELAAGPDREGSLKDQLALAIGEYL"
FT   assembly_gap    8717632..8717651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<8717728..8726249)
FT                   /locus_tag="mCG_5197"
FT                   /note="gene_id=mCG5197.1"
FT   mRNA            complement(join(<8717728..8718137,8725796..8725907,
FT                   8726026..8726249))
FT                   /locus_tag="mCG_5197"
FT                   /product="mCG5197"
FT                   /note="gene_id=mCG5197.1 transcript_id=mCT3897.1 created on
FT                   19-AUG-2002"
FT   CDS             complement(join(8717728..8718137,8725796..8725907,
FT                   8726026..8726202))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5197"
FT                   /product="mCG5197"
FT                   /note="gene_id=mCG5197.1 transcript_id=mCT3897.1
FT                   protein_id=mCP4430.2"
FT                   /db_xref="GOA:D3YWP0"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:3645330"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3YWP0"
FT                   /protein_id="EDL24461.1"
FT                   /translation="MASSRTDPETEPESVFPREIRLFTDSYSESSRFCFCGHELSITQN
FT                   FGSRLGVAARVWDAALSLCDYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITD
FT                   LPVALEQIQDNVHANVPPGGRARVCALSWGIDQHVFPGNYDLVLGADIVYLEPTFPLLL
FT                   GTLRHLCGPHGTIYLASKMRAEHGAETFFRRLLPQHFHLELAQRDEDVNVNIYRARHRE
FT                   VAPAGQHPFC"
FT   assembly_gap    8724409..8724428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8726740..8730269
FT                   /gene="Mettl1"
FT                   /locus_tag="mCG_5186"
FT                   /note="gene_id=mCG5186.1"
FT   mRNA            join(8726740..8726878,8727868..8728031,8729275..8729459,
FT                   8729564..8729677,8729834..8729935,8730087..8730269)
FT                   /gene="Mettl1"
FT                   /locus_tag="mCG_5186"
FT                   /product="methyltransferase-like 1"
FT                   /note="gene_id=mCG5186.1 transcript_id=mCT3907.0 created on
FT                   07-AUG-2002"
FT   CDS             join(8726787..8726878,8727868..8728031,8729275..8729459,
FT                   8729564..8729677,8729834..8729935,8730087..8730236)
FT                   /codon_start=1
FT                   /gene="Mettl1"
FT                   /locus_tag="mCG_5186"
FT                   /product="methyltransferase-like 1"
FT                   /note="gene_id=mCG5186.1 transcript_id=mCT3907.0
FT                   protein_id=mCP4462.1"
FT                   /db_xref="GOA:Q9Z120"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR025763"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1339986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z120"
FT                   /protein_id="EDL24462.1"
FT                   /translation="MMAGAEAPQPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYP
FT                   EFFAPLIQNKSHDDPKDEKEKHSGAQVEFADIGCGYGGLLVALSPLFPDTLILGLEIRV
FT                   KVSDYVQDRIRALRAAPGGGFQNIACLRSNAMKHLPNFFRKGQLAKMFFLFPDPHFKRT
FT                   KHKWRIISPTLLAEYAYVLRVGGLVYTVTDVPELHEWMCTHFEEHPLFERVPLEELSED
FT                   PIVEHLGSSTEEGKKVLRNGGKNFPAVFRRIQDPLLQAVTPNPTLP"
FT   gene            8733060..8737776
FT                   /gene="Cyp27b1"
FT                   /locus_tag="mCG_5188"
FT                   /note="gene_id=mCG5188.1"
FT   mRNA            join(8733060..8733283,8733873..8734063,8734488..8734690,
FT                   8734777..8734977,8735050..8735222,8735486..8735655,
FT                   8735858..8735936,8736321..8736518,8736839..8737776)
FT                   /gene="Cyp27b1"
FT                   /locus_tag="mCG_5188"
FT                   /product="cytochrome P450, family 27, subfamily b,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG5188.1 transcript_id=mCT3900.1 created on
FT                   19-AUG-2002"
FT   CDS             join(8733089..8733283,8733873..8734063,8734488..8734690,
FT                   8734777..8734977,8735050..8735222,8735486..8735655,
FT                   8735858..8735936,8736321..8736518,8736839..8736952)
FT                   /codon_start=1
FT                   /gene="Cyp27b1"
FT                   /locus_tag="mCG_5188"
FT                   /product="cytochrome P450, family 27, subfamily b,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG5188.1 transcript_id=mCT3900.1
FT                   protein_id=mCP4483.2"
FT                   /protein_id="EDL24463.1"
FT                   /translation="MTQAVKLASRVFHRIHLPLQLDASLGSRGSESVLRSLSDIPGPST
FT                   LSFLAELFCKGGLSRLHELQVHGAARYGPIWSGSFGTLRTVYVADPTLVEQLLRQESHC
FT                   PERCSFSSWAEHRRRHQRACGLLTADGEEWQRLRSLLAPLLLRPQAAAGYAGTLDNVVR
FT                   DLVRRLRRQRGRGSGLPGLVLDVAGEFYKFGLESIGAVLLGSRLGCLEAEVPPDTETFI
FT                   HAVGSVFVSTLLTMAMPNWLHHLIPGPWARLCRDWDQMFAFAQRHVELREGEAAMRNQG
FT                   KPEEDMPSGHHLTHFLFREKVSVQSIVGNVTELLLAGVDTVSNTLSWTLYELSRHPDVQ
FT                   TALHSEITAGTRGSCAHPHGTALSQLPLLKAVIKEVLRLYPVVPGNSRVPDRDIRVGNY
FT                   VIPQDTLVSLCHYATSRDPTQFPDPNSFNPARWLGEGPTPHPFASLPFGFGKRSCIGRR
FT                   LAELELQMALSQILTHFEVLPEPGALPIKPMTRTVLVPERSINLQFVDR"
FT   gene            complement(8740405..>8744255)
FT                   /locus_tag="mCG_5187"
FT                   /note="gene_id=mCG5187.2"
FT   mRNA            complement(join(8740405..8741720,8742241..8742433,
FT                   8743029..8743184,8744207..>8744255))
FT                   /locus_tag="mCG_5187"
FT                   /product="mCG5187"
FT                   /note="gene_id=mCG5187.2 transcript_id=mCT3899.2 created on
FT                   19-AUG-2002"
FT   CDS             complement(join(8741380..8741720,8742241..8742433,
FT                   8743029..8743184,8744207..>8744254))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5187"
FT                   /product="mCG5187"
FT                   /note="gene_id=mCG5187.2 transcript_id=mCT3899.2
FT                   protein_id=mCP4408.2"
FT                   /protein_id="EDL24464.1"
FT                   /translation="GLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERG
FT                   SWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSL
FT                   SPSAKWQRQDLLFQICYGMYGFMDVVCIGLIVHEGSSVYRIFKRWQAVNQQWKVLNYDK
FT                   TKDVGGDTGGGAAGKPGPRTSRTSPPAGAPTRPPAAQRMRMRTLLPQRCGYTILHLLGQ
FT                   LRPPDARSSSHSGREVVMRVTTV"
FT   assembly_gap    8744410..8744429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8749007..8753338
FT                   /locus_tag="mCG_126446"
FT                   /note="gene_id=mCG126446.1"
FT   mRNA            join(8749007..8749178,8749639..8749872,8750004..8750139,
FT                   8750254..8750421,8750574..8750683,8751372..8751422,
FT                   8751520..8751655,8752348..8753338)
FT                   /locus_tag="mCG_126446"
FT                   /product="mCG126446"
FT                   /note="gene_id=mCG126446.1 transcript_id=mCT127715.1
FT                   created on 07-AUG-2002"
FT   CDS             join(8749655..8749872,8750004..8750139,8750254..8750421,
FT                   8750574..8750683,8751372..8751422,8751520..8751655,
FT                   8752348..8752440)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126446"
FT                   /product="mCG126446"
FT                   /note="gene_id=mCG126446.1 transcript_id=mCT127715.1
FT                   protein_id=mCP44415.0"
FT                   /db_xref="GOA:Q545C3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:88357"
FT                   /db_xref="UniProtKB/TrEMBL:Q545C3"
FT                   /protein_id="EDL24465.1"
FT                   /translation="MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAA
FT                   GGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYL
FT                   DKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLAR
FT                   IYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQ
FT                   LGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPH
FT                   KRISAFRALQHSYLHKEESDAE"
FT   gene            complement(8752710..8755750)
FT                   /gene="Tspan31"
FT                   /locus_tag="mCG_5174"
FT                   /note="gene_id=mCG5174.1"
FT   mRNA            complement(join(8752710..8753609,8753688..8753801,
FT                   8753899..8754030,8754327..8754407,8754765..8754932,
FT                   8755534..8755750))
FT                   /gene="Tspan31"
FT                   /locus_tag="mCG_5174"
FT                   /product="tetraspanin 31, transcript variant mCT3917"
FT                   /note="gene_id=mCG5174.1 transcript_id=mCT3917.1 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(8753535..8753609,8753688..8753801,
FT                   8753899..8754030,8754327..8754407,8754765..8754932,
FT                   8755534..8755596))
FT                   /codon_start=1
FT                   /gene="Tspan31"
FT                   /locus_tag="mCG_5174"
FT                   /product="tetraspanin 31, isoform CRA_b"
FT                   /note="gene_id=mCG5174.1 transcript_id=mCT3917.1
FT                   protein_id=mCP4372.1 isoform=CRA_b"
FT                   /protein_id="EDL24467.1"
FT                   /translation="MVCGGFACSRNALCALNVVYMLVGFLLIGVAAWGKGLGVVSSIHI
FT                   IGGVIAVGVFLLLIAVAGLVGAANHHQVLLFFYMIILGLVFIFQFGISCSCLAINRNTQ
FT                   ADVINASWSVLSNSTRHELERSFDCCGLFNLTTLRLQDDTSCSAVCKTKSSTCQMCGER
FT                   FLKHSDKALKILGGVGLFFSFTEILGVWLAMRFRNQKDPRANPSAFL"
FT   mRNA            complement(join(8753594..8754030,8754327..8754407,
FT                   8754765..8754932,8755534..8755750))
FT                   /gene="Tspan31"
FT                   /locus_tag="mCG_5174"
FT                   /product="tetraspanin 31, transcript variant mCT171789"
FT                   /note="gene_id=mCG5174.1 transcript_id=mCT171789.0 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(8753890..8754030,8754327..8754407,
FT                   8754765..8754932,8755534..8755596))
FT                   /codon_start=1
FT                   /gene="Tspan31"
FT                   /locus_tag="mCG_5174"
FT                   /product="tetraspanin 31, isoform CRA_a"
FT                   /note="gene_id=mCG5174.1 transcript_id=mCT171789.0
FT                   protein_id=mCP94708.0 isoform=CRA_a"
FT                   /protein_id="EDL24466.1"
FT                   /translation="MVCGGFACSRNALCALNVVYMLVGFLLIGVAAWGKGLGVVSSIHI
FT                   IGGVIAVGVFLLLIAVAGLVGAANHHQVLLFFYMIILGLVFIFQFGISCSCLAINRNTQ
FT                   ADVINASWSVLSNSTRHELERSFDCCGLFNLTTLRLQDDTSCSAVR"
FT   assembly_gap    8764621..8764640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8778700..8778719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8779919..8780264
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   gene            complement(8781417..8806904)
FT                   /gene="4632413K17Rik"
FT                   /locus_tag="mCG_5182"
FT                   /note="gene_id=mCG5182.1"
FT   mRNA            complement(join(8781417..8781611,8782006..8782140,
FT                   8782398..8782510,8782683..8782847,8783700..8783889,
FT                   8784109..8784405,8784599..8784684,8785171..8785225,
FT                   8785381..8785475,8785658..8785759,8785853..8786063,
FT                   8804855..8804953,8805159..8805235,8805360..8805423,
FT                   8806125..8806301,8806713..8806904))
FT                   /gene="4632413K17Rik"
FT                   /locus_tag="mCG_5182"
FT                   /product="RIKEN cDNA 4632413K17, transcript variant
FT                   mCT3905"
FT                   /note="gene_id=mCG5182.1 transcript_id=mCT3905.2 created on
FT                   19-AUG-2002"
FT   mRNA            complement(join(8781420..8782140,8782398..8782510,
FT                   8782683..8782847,8783700..8783889,8784109..8784405,
FT                   8784599..8784684,8785171..8785225,8785381..8785475,
FT                   8785658..8785759,8785853..8786063,8804855..8804953,
FT                   8805159..8805235,8805360..8805423,8806125..8806301,
FT                   8806713..>8806892))
FT                   /gene="4632413K17Rik"
FT                   /locus_tag="mCG_5182"
FT                   /product="RIKEN cDNA 4632413K17, transcript variant
FT                   mCT191966"
FT                   /note="gene_id=mCG5182.1 transcript_id=mCT191966.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8781420..8782140,8782398..8782510,
FT                   8783700..8783889,8784109..8784405,8784599..8784684,
FT                   8785171..8785225,8785381..8785475,8785658..8785759,
FT                   8785853..8786063,8804855..8804953,8805159..8805235,
FT                   8805360..8805423,8806125..8806301,8806713..>8806736))
FT                   /gene="4632413K17Rik"
FT                   /locus_tag="mCG_5182"
FT                   /product="RIKEN cDNA 4632413K17, transcript variant
FT                   mCT191965"
FT                   /note="gene_id=mCG5182.1 transcript_id=mCT191965.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(8782015..8782140,8782398..8782510,
FT                   8782683..8782847,8783700..8783889,8784109..8784405,
FT                   8784599..8784684,8785171..8785225,8785381..8785475,
FT                   8785658..8785759,8785853..8786063,8804855..8804953,
FT                   8805159..8805235,8805360..8805423,8806125..8806301,
FT                   8806713..>8806892))
FT                   /codon_start=1
FT                   /gene="4632413K17Rik"
FT                   /locus_tag="mCG_5182"
FT                   /product="RIKEN cDNA 4632413K17, isoform CRA_b"
FT                   /note="gene_id=mCG5182.1 transcript_id=mCT191966.0
FT                   protein_id=mCP112957.0 isoform=CRA_b"
FT                   /protein_id="EDL24469.1"
FT                   /translation="AETERKMAAEVLLSSLLGLLFLGLLLPARLTGGVGSLNLEELSEM
FT                   RYGIQILPLPVMGGQSQASDVVVVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGI
FT                   PELLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGDVLYLGHYQSSFNWDDE
FT                   TAKASKQHRLKRYHSQTYGNGSKCDLNGKPREAEVRFLCDEGAGISGDYIDRVDEPVSC
FT                   SYVLTIRTSRLCPHPLLRPPASAAPQAILCHPALQPDEYMAYLQRQAESKQHEEKTTEE
FT                   VQDTDRQVWSGSKAAGAPPKKEDVSPAKEEKESELWKLQGPEEQAAAREEAQAGEQDLN
FT                   HEAAADPAPSPPNDFQNNVQVKLIRSPADLIRLIEELKAAEKGKPSVRREQPGDDTTEA
FT                   PQREAEGTKAKGKDGEPPGLMEEEDGDDEEEEEEEEEDEEEQQLLGEFEKELEGMLLPS
FT                   NRERLRSEVKAGMERELENIIQETEKELDPEGLRKESEREQAILALTSTLDKLIKRLQE
FT                   NQSPELVQKYKKRRVVPQKPPPSPHPTEEEPEHRVRVRVTKLRPGGPNRDLTVLEMNRE
FT                   NPQLKQIEGLVTEVLEREGLTAEGKIEIKIVRPGAEGKEEDTRWLTDEDTRNLKEIFFN
FT                   ILVQGAEEANKERQRQSELESNYRRVWGSPGGEDTGDLDEFDF"
FT   CDS             complement(join(8782015..8782140,8782398..8782510,
FT                   8782683..8782847,8783700..8783889,8784109..8784405,
FT                   8784599..8784684,8785171..8785225,8785381..8785475,
FT                   8785658..8785759,8785853..8786063,8804855..8804953,
FT                   8805159..8805235,8805360..8805423,8806125..8806301,
FT                   8806713..8806874))
FT                   /codon_start=1
FT                   /gene="4632413K17Rik"
FT                   /locus_tag="mCG_5182"
FT                   /product="RIKEN cDNA 4632413K17, isoform CRA_c"
FT                   /note="gene_id=mCG5182.1 transcript_id=mCT3905.2
FT                   protein_id=mCP4415.2 isoform=CRA_c"
FT                   /protein_id="EDL24470.1"
FT                   /translation="MAAEVLLSSLLGLLFLGLLLPARLTGGVGSLNLEELSEMRYGIQI
FT                   LPLPVMGGQSQASDVVVVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLSP
FT                   MRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGDVLYLGHYQSSFNWDDETAKASK
FT                   QHRLKRYHSQTYGNGSKCDLNGKPREAEVRFLCDEGAGISGDYIDRVDEPVSCSYVLTI
FT                   RTSRLCPHPLLRPPASAAPQAILCHPALQPDEYMAYLQRQAESKQHEEKTTEEVQDTDR
FT                   QVWSGSKAAGAPPKKEDVSPAKEEKESELWKLQGPEEQAAAREEAQAGEQDLNHEAAAD
FT                   PAPSPPNDFQNNVQVKLIRSPADLIRLIEELKAAEKGKPSVRREQPGDDTTEAPQREAE
FT                   GTKAKGKDGEPPGLMEEEDGDDEEEEEEEEEDEEEQQLLGEFEKELEGMLLPSNRERLR
FT                   SEVKAGMERELENIIQETEKELDPEGLRKESEREQAILALTSTLDKLIKRLQENQSPEL
FT                   VQKYKKRRVVPQKPPPSPHPTEEEPEHRVRVRVTKLRPGGPNRDLTVLEMNRENPQLKQ
FT                   IEGLVTEVLEREGLTAEGKIEIKIVRPGAEGKEEDTRWLTDEDTRNLKEIFFNILVQGA
FT                   EEANKERQRQSELESNYRRVWGSPGGEDTGDLDEFDF"
FT   CDS             complement(join(8782015..8782140,8782398..8782510,
FT                   8783700..8783889,8784109..8784405,8784599..8784684,
FT                   8785171..8785225,8785381..8785475,8785658..8785759,
FT                   8785853..8786063,8804855..8804953,8805159..8805235,
FT                   8805360..8805423,8806125..8806301,8806713..>8806736))
FT                   /codon_start=1
FT                   /gene="4632413K17Rik"
FT                   /locus_tag="mCG_5182"
FT                   /product="RIKEN cDNA 4632413K17, isoform CRA_a"
FT                   /note="gene_id=mCG5182.1 transcript_id=mCT191965.0
FT                   protein_id=mCP112956.0 isoform=CRA_a"
FT                   /protein_id="EDL24468.1"
FT                   /translation="PLPVMGGQSQASDVVVVSSKYKQRYECRLPAGAIHFQREREEETP
FT                   AYQGPGIPELLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGDVLYLGHYQS
FT                   SFNWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGKPREAEVRFLCDEGAGISGDYIDR
FT                   VDEPVSCSYVLTIRTSRLCPHPLLRPPASAAPQAILCHPALQPDEYMAYLQRQAESKQH
FT                   EEKTTEEVQDTDRQVWSGSKAAGAPPKKEDVSPAKEEKESELWKLQGPEEQAAAREEAQ
FT                   AGEQDLNHEAAADPAPSPPNDFQNNVQVKLIRSPADLIRLIEELKAAEKGKPSVRREQP
FT                   GDDTTEAPQREAEGTKAKGKDGEPPGLMEEEDGDDEEEEEEEEEDEEEQQLLGEFEKEL
FT                   EGMLLPSNRERLRSEVKAGMERELENIIQETEKELDPEGLRKESEREQAILALTSTLDK
FT                   LIKRLQENQSPELVQKYKKRRVVPQKPPPSPHPTGKIEIKIVRPGAEGKEEDTRWLTDE
FT                   DTRNLKEIFFNILVQGAEEANKERQRQSELESNYRRVWGSPGGEDTGDLDEFDF"
FT   gene            8783473..8786936
FT                   /locus_tag="mCG_147838"
FT                   /note="gene_id=mCG147838.0"
FT   mRNA            8783473..8786936
FT                   /locus_tag="mCG_147838"
FT                   /product="mCG147838"
FT                   /note="gene_id=mCG147838.0 transcript_id=mCT188101.0
FT                   created on 13-JAN-2004"
FT   CDS             8784116..8784439
FT                   /codon_start=1
FT                   /locus_tag="mCG_147838"
FT                   /product="mCG147838"
FT                   /note="gene_id=mCG147838.0 transcript_id=mCT188101.0
FT                   protein_id=mCP108212.0"
FT                   /db_xref="MGI:MGI:3704371"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D673"
FT                   /protein_id="EDL24471.1"
FT                   /translation="MMFSSSRSMPALTSERRRSRFEGSNIPSSSFSNSPRSCCSSSSSS
FT                   SSSSSSSSSPSSSSIRPGGSPSFPFAFVPSASLWGASVVSSPGCSRLTLGFPWVGSWVE
FT                   DAV"
FT   assembly_gap    8795829..8796078
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    8830888..8831016
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    8832877..8832896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8834572..8834894
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   gene            complement(8849660..8851393)
FT                   /locus_tag="mCG_147835"
FT                   /note="gene_id=mCG147835.0"
FT   mRNA            complement(8849660..8851393)
FT                   /locus_tag="mCG_147835"
FT                   /product="mCG147835"
FT                   /note="gene_id=mCG147835.0 transcript_id=mCT188098.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8851004..8851288)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147835"
FT                   /product="mCG147835"
FT                   /note="gene_id=mCG147835.0 transcript_id=mCT188098.0
FT                   protein_id=mCP108209.0"
FT                   /protein_id="EDL24472.1"
FT                   /translation="MRELGGREPDSVGDPTPPACGLRGFVDRSAGVVLNVSCRGELDRK
FT                   SAAPQPQRQSGEALAPRRAPRQPRAQASARLSHRSAAPLPGWLRHRLGL"
FT   gene            8851090..8858271
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /note="gene_id=mCG5175.3"
FT   mRNA            join(8851090..8851385,8851870..8852088,8852584..8852748,
FT                   8852865..8852971,8853368..8853408,8855620..8855718,
FT                   8855920..8856110,8856533..8856673,8856861..8857101,
FT                   8857558..8858271)
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   transcript variant mCT185452"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT185452.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(8851090..8851385,8851870..8852088,8852584..8852748,
FT                   8852865..8852971,8853368..8853408,8853567..8854388)
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   transcript variant mCT171791"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT171791.1 created
FT                   on 12-JUN-2003"
FT   mRNA            join(<8851091..8851385,8851870..8852088,8852584..8852748,
FT                   8852865..8852971,8853368..8853408,8853567..8853747,
FT                   8855620..8855718,8855920..8856110,8856533..8856673,
FT                   8856861..8857101,8857558..8858271)
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   transcript variant mCT191968"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT191968.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<8851093..8851385,8851870..8852088,8852584..8852748,
FT                   8852865..8852971,8853368..8853408,8853567..8853747,
FT                   8855620..8855718,8855920..8856110,8856533..8856673,
FT                   8856861..8857101,8857558..8857775)
FT                   /codon_start=1
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT191968.0
FT                   protein_id=mCP112952.0 isoform=CRA_c"
FT                   /protein_id="EDL24475.1"
FT                   /translation="WERDAVPGLPRFVAGAGARRIYDPVHPGRKRSEPPPRCGLQSPGV
FT                   RRREESDPRHCRAPSRPAPASGRRRPHEDPPAGAENRALPGPRSCRGLRTLDRMRLDRR
FT                   ALYALVLLLACASLGLLYSSTRNAPSLPNPLALWSPPQGPPRLDLLDLAPEPRYAHIPV
FT                   RIKEQVVGLLAQNNCSCESKGGSLPLPFLRQVRAVDLTKAFDAEELRAVSVAREQEYQA
FT                   FLARSRSLADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQEASVQEIYQVNLSAS
FT                   LGTWDVAGEVTGVTLTGEGQPDLTLASPVLDKLNRQLQLVTYSSRSYQANTADTVRFST
FT                   KGHEVAFTILVRHPPNPRLYPPSSLPQGAEYNISALVTIATKTFLRYDRLRTLIASIRR
FT                   FYPTVTIVIADDSDKPERISDPHVEHYFMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFV
FT                   FTARTRLEKLVDVLEKTPLDLVGGAVREISGYATTYRQLLSVEPGAPGLGNCFRQKQGF
FT                   HHELVGFPSCVVTDGVVNFFLARTDKVRQVGFDPRLNRVAHLEFFLDGLGFLRVGSCSD
FT                   VVVDHASKVKLPWTAKDPGAETYARYRYPGSLDQSQVAKHRLLFFKHRLQCMTAE"
FT   mRNA            join(8851695..8852088,8852584..8852748,8852865..8852971,
FT                   8853368..8853408,8853567..8853747,8855620..8855718,
FT                   8855920..8856110,8856533..8856673,8856861..8857101,
FT                   8857558..8858271)
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   transcript variant mCT3913"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT3913.2 created on
FT                   12-JUN-2003"
FT   mRNA            join(8851695..8852088,8852584..8852748,8852865..8852971,
FT                   8853368..8853408,8853567..8853747,8855620..8855718,
FT                   8855920..8856354)
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   transcript variant mCT185451"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT185451.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(8851695..8852088,8852584..8852748,8852865..8852971,
FT                   8853368..8853408,8853567..8854386)
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   transcript variant mCT171790"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT171790.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(8851763..8852088,8852584..8852748,8852865..8852971,
FT                   8853368..8853408,8853567..8853747,8855620..8855718,
FT                   8855920..8856110,8856533..8856673,8856861..8857101,
FT                   8857558..8857775)
FT                   /codon_start=1
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT3913.2
FT                   protein_id=mCP4388.2 isoform=CRA_d"
FT                   /db_xref="GOA:A0A1Z4EAV4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011143"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1342057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Z4EAV4"
FT                   /protein_id="EDL24476.1"
FT                   /translation="MAGLGYLREPRRRRGPESRPSRSLRAWSPLTLPHIRMRLDRRALY
FT                   ALVLLLACASLGLLYSSTRNAPSLPNPLALWSPPQGPPRLDLLDLAPEPRYAHIPVRIK
FT                   EQVVGLLAQNNCSCESKGGSLPLPFLRQVRAVDLTKAFDAEELRAVSVAREQEYQAFLA
FT                   RSRSLADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQEASVQEIYQVNLSASLGT
FT                   WDVAGEVTGVTLTGEGQPDLTLASPVLDKLNRQLQLVTYSSRSYQANTADTVRFSTKGH
FT                   EVAFTILVRHPPNPRLYPPSSLPQGAEYNISALVTIATKTFLRYDRLRTLIASIRRFYP
FT                   TVTIVIADDSDKPERISDPHVEHYFMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTA
FT                   RTRLEKLVDVLEKTPLDLVGGAVREISGYATTYRQLLSVEPGAPGLGNCFRQKQGFHHE
FT                   LVGFPSCVVTDGVVNFFLARTDKVRQVGFDPRLNRVAHLEFFLDGLGFLRVGSCSDVVV
FT                   DHASKVKLPWTAKDPGAETYARYRYPGSLDQSQVAKHRLLFFKHRLQCMTAE"
FT   CDS             join(8851763..8852088,8852584..8852748,8852865..8852971,
FT                   8853368..8853408,8853567..8853747,8855620..8855718,
FT                   8855920..8856194)
FT                   /codon_start=1
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   isoform CRA_f"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT185451.0
FT                   protein_id=mCP106709.0 isoform=CRA_f"
FT                   /protein_id="EDL24478.1"
FT                   /translation="MAGLGYLREPRRRRGPESRPSRSLRAWSPLTLPHIRMRLDRRALY
FT                   ALVLLLACASLGLLYSSTRNAPSLPNPLALWSPPQGPPRLDLLDLAPEPRYAHIPVRIK
FT                   EQVVGLLAQNNCSCESKGGSLPLPFLRQVRAVDLTKAFDAEELRAVSVAREQEYQAFLA
FT                   RSRSLADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQEASVQEIYQVNLSASLGT
FT                   WDVAGEVTGVTLTGEGQPDLTLASPVLDKLNRQLQLVTYSSRSYQANTADTVRFSTKGH
FT                   EVAFTILVRHPPNPRLYPPSSLPQGAEYNISALVTIATKTFLRYDRLRTLIASIRRFYP
FT                   TVTIVIADDSDKPERISDPHVEHYFMPFGKVRCPQSRAGAPEDSGKGACLSQQLPGC"
FT   CDS             join(8851763..8852088,8852584..8852748,8852865..8852971,
FT                   8853368..8853408,8853567..8853770)
FT                   /codon_start=1
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT171790.1
FT                   protein_id=mCP94710.1 isoform=CRA_e"
FT                   /protein_id="EDL24477.1"
FT                   /translation="MAGLGYLREPRRRRGPESRPSRSLRAWSPLTLPHIRMRLDRRALY
FT                   ALVLLLACASLGLLYSSTRNAPSLPNPLALWSPPQGPPRLDLLDLAPEPRYAHIPVRIK
FT                   EQVVGLLAQNNCSCESKGGSLPLPFLRQVRAVDLTKAFDAEELRAVSVAREQEYQAFLA
FT                   RSRSLADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQEASVQEIYQVNLSASLGT
FT                   WDVAGEVTGVTLTGEGQPDLTLASPVLDKLNRQLQLVTYSSRSYQANTADTGGRPEEG"
FT   CDS             join(8851871..8852088,8852584..8852748,8852865..8852971,
FT                   8853368..8853408,8853567..8853770)
FT                   /codon_start=1
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT171791.1
FT                   protein_id=mCP94709.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VDF0"
FT                   /db_xref="MGI:MGI:1342057"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VDF0"
FT                   /protein_id="EDL24473.1"
FT                   /translation="MRLDRRALYALVLLLACASLGLLYSSTRNAPSLPNPLALWSPPQG
FT                   PPRLDLLDLAPEPRYAHIPVRIKEQVVGLLAQNNCSCESKGGSLPLPFLRQVRAVDLTK
FT                   AFDAEELRAVSVAREQEYQAFLARSRSLADQLLIAPANSPLQYPLQGVEVQPLRSILVP
FT                   GLSLQEASVQEIYQVNLSASLGTWDVAGEVTGVTLTGEGQPDLTLASPVLDKLNRQLQL
FT                   VTYSSRSYQANTADTGGRPEEG"
FT   assembly_gap    8855813..8855876
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   CDS             join(8856096..8856110,8856533..8856673,8856861..8857101,
FT                   8857558..8857775)
FT                   /codon_start=1
FT                   /gene="B4galnt1"
FT                   /locus_tag="mCG_5175"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5175.3 transcript_id=mCT185452.0
FT                   protein_id=mCP106710.0 isoform=CRA_b"
FT                   /protein_id="EDL24474.1"
FT                   /translation="MPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLEKLVDVL
FT                   EKTPLDLVGGAVREISGYATTYRQLLSVEPGAPGLGNCFRQKQGFHHELVGFPSCVVTD
FT                   GVVNFFLARTDKVRQVGFDPRLNRVAHLEFFLDGLGFLRVGSCSDVVVDHASKVKLPWT
FT                   AKDPGAETYARYRYPGSLDQSQVAKHRLLFFKHRLQCMTAE"
FT   gene            complement(8857335..8866585)
FT                   /gene="C78409"
FT                   /locus_tag="mCG_126456"
FT                   /note="gene_id=mCG126456.1"
FT   mRNA            complement(join(8857335..8858518,8859217..8859323,
FT                   8859424..8859478,8859566..8859648,8859851..8859967,
FT                   8860041..8860110,8860226..8860843,8860927..8861004,
FT                   8862514..8862627,8862749..8862896,8863029..8863111,
FT                   8863880..8864032,8864285..8864449,8864671..8864828,
FT                   8865565..8865675,8866171..>8866523))
FT                   /gene="C78409"
FT                   /locus_tag="mCG_126456"
FT                   /product="expressed sequence C78409, transcript variant
FT                   mCT191959"
FT                   /note="gene_id=mCG126456.1 transcript_id=mCT191959.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(8858253..8858518,8859217..8859323,
FT                   8859424..8859478,8859566..8859648,8859729..8859750,
FT                   8859851..8859967,8860041..8860110,8860226..8860332,
FT                   8860748..8860843,8860927..8861004,8862514..8862627,
FT                   8862749..8862896,8863029..8863111,8863880..8864032,
FT                   8864285..8864449,8864671..8864870,8865565..8865675,
FT                   8866171..8866585))
FT                   /gene="C78409"
FT                   /locus_tag="mCG_126456"
FT                   /product="expressed sequence C78409, transcript variant
FT                   mCT127725"
FT                   /note="gene_id=mCG126456.1 transcript_id=mCT127725.0
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(8858480..8858518,8859217..8859323,
FT                   8859424..8859478,8859566..8859648,8859729..8859750,
FT                   8859851..8859967,8860041..8860110,8860226..8860332,
FT                   8860748..8860843,8860927..8861004,8862514..8862627,
FT                   8862749..8862896,8863029..8863111,8863880..8864032,
FT                   8864285..8864449,8864671..8864870,8865565..8865675,
FT                   8866171..8866537))
FT                   /codon_start=1
FT                   /gene="C78409"
FT                   /locus_tag="mCG_126456"
FT                   /product="expressed sequence C78409, isoform CRA_b"
FT                   /note="gene_id=mCG126456.1 transcript_id=mCT127725.0
FT                   protein_id=mCP44494.1 isoform=CRA_b"
FT                   /protein_id="EDL24480.1"
FT                   /translation="MLQGAKDKMSGPLASGTCSDPEEVSDLKSPLSSRFREPLTHARFQ
FT                   ELFGGAEPEPELPAEPCLPCLCRLRRRRASACSGPGAWRVLLARLPPLRWLPQYRWRAW
FT                   LLGDAVAGVTVGVVHVPQGMAFALLTSVPPVFGLYTSFFPVLIYSLLGTGRHLSTGCTN
FT                   ANLCIWPMTAGTFAVLSLMTGSVVERVVPEPLAGNLSGIEREQLEARRVGAAAAVAFGS
FT                   GALMLGMFVLQLGVLSTFLSEPVIKALTSGAALHVLVSQLPSLLGLSLPRQIGCFSLFK
FT                   TLAAVLSALSQSSPAEVTISALSLVLLVPVKELNVRFRDRLLTPIPGEVVMVLLATVLC
FT                   FTSSLDTRYNVQVVGPLPGGFPQPLLPTLDELPRILADSLPISLVTFAVSTSLASIYAD
FT                   KYSYTIEPNQELLAHGVSNLISSLFSCFPNSATLATTSLLVDAGGNTQLAGLFSCAVVL
FT                   AALLWLGPFFYYLPKAVLACINISSMRQMFFQMQELPQLWHISRVDFAVWIVTWVAVVT
FT                   LNVDLGLAVGVVVSMMTVVCRTQRVQCLELGLAEGTELYRPIRESRKLLQVPGLCILSY
FT                   PAPLYFATRGQFHRILEWHLGLGERIKPGSVPDKGAEPVRVAILDFSGITFVDAAGARE
FT                   VVQLTRRCQDDGIYLLLAQCNALVLETLTRARLLDSVSPEQLFVSVQDAAAHALERLKP
FT                   TGPKICTVWV"
FT   CDS             complement(join(8860718..8860843,8860927..8861004,
FT                   8862514..8862627,8862749..8862896,8863029..8863111,
FT                   8863880..8864032,8864285..8864449,8864671..8864828,
FT                   8865565..8865675,8866171..>8866522))
FT                   /codon_start=1
FT                   /gene="C78409"
FT                   /locus_tag="mCG_126456"
FT                   /product="expressed sequence C78409, isoform CRA_a"
FT                   /note="gene_id=mCG126456.1 transcript_id=mCT191959.0
FT                   protein_id=mCP112922.0 isoform=CRA_a"
FT                   /protein_id="EDL24479.1"
FT                   /translation="KDKMSGPLASGTCSDPEEVSDLKSPLSSRFREPLTHARFQELFGG
FT                   AEPEPELPAEPCLPCLCRLRRRRASACSGPGAWRVLLARLPPLRWLPQYRWRAWLLGDA
FT                   VAGVTVGVVHVPQGMAFALLTSVPPVFGLYTSFFPVLIYSLLGTGRHLSTGTFAVLSLM
FT                   TGSVVERVVPEPLAGNLSGIEREQLEARRVGAAAAVAFGSGALMLGMFVLQLGVLSTFL
FT                   SEPVIKALTSGAALHVLVSQLPSLLGLSLPRQIGCFSLFKTLAAVLSALSQSSPAEVTI
FT                   SALSLVLLVPVKELNVRFRDRLLTPIPGEVVMVLLATVLCFTSSLDTRYNVQVVGPLPG
FT                   GFPQPLLPTLDELPRILADSLPISLVTFAVSTSLASIYADKYSYTIEPNQELLAHGVSN
FT                   LISSLFSCFPNSATLATTSLLVDAGGNTQLAGLFSCAVVLAALLWLGPFFYYLPKAVLA
FT                   CINISSMRQMFFQMQELPQLWHISRVDFVRNGNMPGC"
FT   gene            complement(8868464..>8875975)
FT                   /gene="D10Ertd610e"
FT                   /locus_tag="mCG_5181"
FT                   /note="gene_id=mCG5181.2"
FT   mRNA            complement(join(8868464..8868882,8869137..8869348,
FT                   8869588..8869768,8869951..8870151,8870331..8870408,
FT                   8870602..8870652,8870826..8870918,8871022..8871111,
FT                   8871226..8871295,8871514..8871617,8871799..8871865,
FT                   8872022..8872098,8872818..8872913,8873047..8873261,
FT                   8875434..8875548,8875806..8875974))
FT                   /gene="D10Ertd610e"
FT                   /locus_tag="mCG_5181"
FT                   /product="DNA segment, Chr 10, ERATO Doi 610, expressed,
FT                   transcript variant mCT3908"
FT                   /note="gene_id=mCG5181.2 transcript_id=mCT3908.2 created on
FT                   19-AUG-2002"
FT   mRNA            complement(join(8868465..8868882,8869137..8869348,
FT                   8869588..8869768,8869951..8870151,8870331..8870408,
FT                   8870602..8870652,8870826..8870918,8871022..8871617,
FT                   8871799..8871865,8872022..8872098,8872818..8872913,
FT                   8873047..8873261,8875434..8875548,8875806..>8875975))
FT                   /gene="D10Ertd610e"
FT                   /locus_tag="mCG_5181"
FT                   /product="DNA segment, Chr 10, ERATO Doi 610, expressed,
FT                   transcript variant mCT191962"
FT                   /note="gene_id=mCG5181.2 transcript_id=mCT191962.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(8868775..8868882,8869137..8869348,
FT                   8869588..8869768,8869951..8870151,8870331..8870408,
FT                   8870602..8870652,8870826..8870918,8871022..8871111,
FT                   8871226..8871295,8871514..8871617,8871799..8871865,
FT                   8872022..8872098,8872818..8872913,8873047..8873261,
FT                   8875434..8875548,8875806..8875904))
FT                   /codon_start=1
FT                   /gene="D10Ertd610e"
FT                   /locus_tag="mCG_5181"
FT                   /product="DNA segment, Chr 10, ERATO Doi 610, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5181.2 transcript_id=mCT3908.2
FT                   protein_id=mCP4482.2 isoform=CRA_b"
FT                   /db_xref="GOA:G5E825"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR030738"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="MGI:MGI:1277173"
FT                   /db_xref="UniProtKB/TrEMBL:G5E825"
FT                   /protein_id="EDL24482.1"
FT                   /translation="MKPPDRPTPGRTDRILGVMGGMLRACAVPGQEGPPERDPLGPGST
FT                   KTESDCIEEDQTGQREPEVLAWAPQPESYSIAVSEGSMSASAVSGLAALSGPSSGLSSD
FT                   PCSPIPPGPVTGLRRWLDHSKHCLSVETEAESGQTGQCENWTLEPTLTTGQELPELTLL
FT                   TTLLEGPGDKAQPAEEETLSQAPKNEEEQKKMALERSMFVLGELVETERTYVDDLGQIV
FT                   EGYMATMATQGVPESLRGRDRIVFGNIQQIYEWHRDYFLQELQQCLKDPDWLAQLFIKH
FT                   ERRLHMYVVYCQNKPKSEHVLSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLL
FT                   LKDFLKYYRRAGKDTEELEQAVEVMCFVPKRCNDMMSLGRLRGFEGKLTAQGKLLGQDT
FT                   FLVTEPEAGGLLSSRGRERRVFLFEQIIIFSEALGGGGRGGAQPGYVYKNSIKVSCLGL
FT                   EGNLQGNPCRFALTSRGPEGGIQRYVLQASDPAVSQAWIKQVAQILESQRDFLNALQSP
FT                   IEYQRRESQTNSLGRPGGPWVGSPGRMRPGDLAQASMHTPINGSLPSLLLLPRGEVSRV
FT                   LLPLDTQALSDTPQTPHDSPALPTVNTPPCQARLAKLDEDEL"
FT   CDS             complement(join(8868775..8868882,8869137..8869348,
FT                   8869588..8869768,8869951..8870151,8870331..8870408,
FT                   8870602..8870652,8870826..8870918,8871022..>8871111))
FT                   /codon_start=1
FT                   /gene="D10Ertd610e"
FT                   /locus_tag="mCG_5181"
FT                   /product="DNA segment, Chr 10, ERATO Doi 610, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5181.2 transcript_id=mCT191962.0
FT                   protein_id=mCP112955.0 isoform=CRA_a"
FT                   /protein_id="EDL24481.1"
FT                   /translation="ERRLHMYVVYCQNKPKSEHVLSEFGDSYFEELRQQLGHRLQLNDL
FT                   LIKPVQRIMKYQLLLKDFLKYYRRAGKDTEELEQAVEVMCFVPKRCNDMMSLGRLRGFE
FT                   GKLTAQGKLLGQDTFLVTEPEAGGLLSSRGRERRVFLFEQIIIFSEALGGGGRGGAQPG
FT                   YVYKNSIKVSCLGLEGNLQGNPCRFALTSRGPEGGIQRYVLQASDPAVSQAWIKQVAQI
FT                   LESQRDFLNALQSPIEYQRRESQTNSLGRPGGPWVGSPGRMRPGDLAQASMHTPINGSL
FT                   PSLLLLPRGEVSRVLLPLDTQALSDTPQTPHDSPALPTVNTPPCQARLAKLDEDEL"
FT   gene            complement(8876318..8880605)
FT                   /gene="Dtx3"
FT                   /locus_tag="mCG_5177"
FT                   /note="gene_id=mCG5177.1"
FT   mRNA            complement(join(8876318..8876978,8877275..8877492,
FT                   8878899..8879341,8879714..8879787,8880383..8880605))
FT                   /gene="Dtx3"
FT                   /locus_tag="mCG_5177"
FT                   /product="deltex 3 homolog (Drosophila)"
FT                   /note="gene_id=mCG5177.1 transcript_id=mCT3909.2 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(8876903..8876978,8877275..8877492,
FT                   8878899..8879341,8879714))
FT                   /codon_start=1
FT                   /gene="Dtx3"
FT                   /locus_tag="mCG_5177"
FT                   /product="deltex 3 homolog (Drosophila)"
FT                   /note="gene_id=mCG5177.1 transcript_id=mCT3909.2
FT                   protein_id=mCP4392.2"
FT                   /protein_id="EDL24483.1"
FT                   /translation="MSFVLSRMAACGGSCKNKVTVSKPVWDFLSKETPARLARLREEHR
FT                   VSILIDGETSDIYVLQLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMG
FT                   CLALGGGGEHPELHRPGPPPLRAAPLLPPGARGLPPPPPPLPPPAEHPNPGVRYPGTTR
FT                   VAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTTGRPNVITWNDIHHKTSCTGGPQLF
FT                   GYPDPTYLTRVQEELRAKGITDD"
FT   assembly_gap    8878458..8878894
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   gene            <8881227..8886722
FT                   /locus_tag="mCG_126467"
FT                   /note="gene_id=mCG126467.1"
FT   mRNA            join(<8881227..8881497,8882742..8882840,8883110..8883167,
FT                   8886498..8886722)
FT                   /locus_tag="mCG_126467"
FT                   /product="mCG126467"
FT                   /note="gene_id=mCG126467.1 transcript_id=mCT127736.1
FT                   created on 19-AUG-2002"
FT   CDS             join(<8881228..8881497,8882742..8882840,8883110..8883133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_126467"
FT                   /product="mCG126467"
FT                   /note="gene_id=mCG126467.1 transcript_id=mCT127736.1
FT                   protein_id=mCP44578.1"
FT                   /protein_id="EDL24484.1"
FT                   /translation="LGQTRPDTRPASSSRQRPLAGTARKGKGPLGRCPLRHPPPFSPRL
FT                   PPDPSNPKPTPASLLEEAPESRRLVRVCVHPTAALRTPKWRPGLKSWYPKRPTKVNRWR
FT                   SKSIMKTDTPSHSHSGRHKMENGSSK"
FT   gene            complement(8883062..8897462)
FT                   /gene="Pip5k2c"
FT                   /locus_tag="mCG_5198"
FT                   /note="gene_id=mCG5198.1"
FT   mRNA            complement(join(8883062..8885117,8885286..8885389,
FT                   8885562..8885829,8886157..8886270,8886813..8886851,
FT                   8887012..8887158,8891648..8891791,8892587..8892683,
FT                   8894772..8894869,8897240..8897462))
FT                   /gene="Pip5k2c"
FT                   /locus_tag="mCG_5198"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase, type
FT                   II, gamma"
FT                   /note="gene_id=mCG5198.1 transcript_id=mCT3891.1 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(8885037..8885117,8885286..8885389,
FT                   8885562..8885829,8886157..8886270,8886813..8886851,
FT                   8887012..8887158,8891648..8891791,8892587..8892683,
FT                   8894772..8894869,8897240..8897413))
FT                   /codon_start=1
FT                   /gene="Pip5k2c"
FT                   /locus_tag="mCG_5198"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase, type
FT                   II, gamma"
FT                   /note="gene_id=mCG5198.1 transcript_id=mCT3891.1
FT                   protein_id=mCP4463.2"
FT                   /protein_id="EDL24485.1"
FT                   /translation="MASSSVPPATAPAAAGGPGPGFGFASKTKKKHFVQQKVKVFRAAD
FT                   PLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHFFHRENLPSHFKFKEYC
FT                   PQVFRNLRDRFAIDDHDYLVSLTRSPPSETEGSDGRFLISYDRTLVIKEVSSEDIADMH
FT                   SNLSNYHQYIVKCHGNTLLPQFLGMYRVSVENEDSYMLVMRNMFSHRLPVHRKYDLKGS
FT                   LVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKVFLEKLKRDVEFLVQLKIMDY
FT                   SLLLGIHDIIRGSEPEEEGPVREEESEWDGDCNLAGPPALVGSYGTSPEGIGGYIHSHR
FT                   PLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAE
FT                   ISTVHPEQYAKRFLDFIANIFA"
FT   gene            complement(8914244..>8948494)
FT                   /gene="Kif5a"
FT                   /locus_tag="mCG_5176"
FT                   /note="gene_id=mCG5176.2"
FT   mRNA            complement(join(8914244..8914280,8915603..8915714,
FT                   8916007..8916034,8916427..8916494,8916782..8916935,
FT                   8917150..8917366,8919456..8919560,8919686..8919757,
FT                   8922152..8922259,8922361..8922425,8922726..8922843,
FT                   8923146..8923334,8924174..8924320,8924603..8924809,
FT                   8925262..8925330,8927364..8927539,8928091..8928239,
FT                   8928793..8928941,8929081..8929185,8930786..8930910,
FT                   8931141..8931228,8931383..8931438,8932468..8932516,
FT                   8932959..8933063,8933466..8933539,8933628..8933715,
FT                   8948182..8948464))
FT                   /gene="Kif5a"
FT                   /locus_tag="mCG_5176"
FT                   /product="kinesin family member 5A, transcript variant
FT                   mCT3918"
FT                   /note="gene_id=mCG5176.2 transcript_id=mCT3918.2 created on
FT                   07-AUG-2002"
FT   mRNA            complement(join(8914244..8914280,8915603..8915714,
FT                   8916007..8916034,8916427..8916494,8916782..8916935,
FT                   8917150..8917366,8919456..8919560,8919686..8919757,
FT                   8922150..8922259,8922361..8922425,8922726..8922843,
FT                   8923146..8923334,8924174..8924320,8924603..8924809,
FT                   8925262..8925330,8927364..8927539,8928091..8928239,
FT                   8928793..8928941,8929081..8929185,8930786..8930910,
FT                   8931141..8931228,8931383..8931438,8932468..8932516,
FT                   8932959..8933063,8933466..8933539,8933628..8933715,
FT                   8948182..>8948464))
FT                   /gene="Kif5a"
FT                   /locus_tag="mCG_5176"
FT                   /product="kinesin family member 5A, transcript variant
FT                   mCT191972"
FT                   /note="gene_id=mCG5176.2 transcript_id=mCT191972.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8914911..8915714,8916007..8916034,
FT                   8916427..8916494,8916782..8916935,8917150..8917366,
FT                   8919456..8919560,8919686..8919757,8922150..8922259,
FT                   8922361..8922425,8922726..8922843,8923146..8923334,
FT                   8924174..8924320,8924603..8924809,8925262..8925330,
FT                   8927364..8927539,8928091..8928239,8928793..8928941,
FT                   8929081..8929185,8930786..8930910,8931141..8931228,
FT                   8931383..8931438,8932468..8932516,8932959..8933063,
FT                   8933466..8933539,8933628..8933715,8948182..>8948494))
FT                   /gene="Kif5a"
FT                   /locus_tag="mCG_5176"
FT                   /product="kinesin family member 5A, transcript variant
FT                   mCT191973"
FT                   /note="gene_id=mCG5176.2 transcript_id=mCT191973.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(8915636..8915714,8916007..8916034,
FT                   8916427..8916494,8916782..8916935,8917150..8917366,
FT                   8919456..8919560,8919686..8919757,8922152..8922259,
FT                   8922361..8922425,8922726..8922843,8923146..8923334,
FT                   8924174..8924320,8924603..8924809,8925262..8925330,
FT                   8927364..8927539,8928091..8928239,8928793..8928941,
FT                   8929081..8929185,8930786..8930910,8931141..8931228,
FT                   8931383..8931438,8932468..8932516,8932959..8933063,
FT                   8933466..8933539,8933628..8933715,8948182..8948310))
FT                   /codon_start=1
FT                   /gene="Kif5a"
FT                   /locus_tag="mCG_5176"
FT                   /product="kinesin family member 5A, isoform CRA_c"
FT                   /note="gene_id=mCG5176.2 transcript_id=mCT3918.2
FT                   protein_id=mCP4450.2 isoform=CRA_c"
FT                   /protein_id="EDL24488.1"
FT                   /translation="MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGK
FT                   PYVFDRVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQ
FT                   LMGIIPRIARDIFNHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRV
FT                   PFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQ
FT                   KLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRD
FT                   SKMTRILQDSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAE
FT                   QWKKKYEKEKEKTKAQKETIAKLEAELSRWRNGENVPETERLAGEDSALGAELCEETPV
FT                   NDNSSIVVRIAPEERQKYEEEIRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVS
FT                   TRGDNEKVQRELSHLQSENDAAKDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVD
FT                   ELSQKVATMLSLESELQRLQEVSGHQRKRIAEVLNGLMRDLSEFSVIVGNGEIKLPVEI
FT                   SGAIEEEFTVARLYISKIKSEVKSVVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQ
FT                   HEAKIRSLTEYMQTVELKKRHLEESYDSLSDELARLQAHETVHEVALKDKEPDTQDAEE
FT                   VKKALELQMENHREAHHRQLARLRDEINEKQKTIDELKARELQTLHNLRKLFVQDVTTR
FT                   VKKSAEMEPEDSGGIHSQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRA
FT                   TAERVKALEGALKEAKEGAMKDKRRYQQEVDRIKEAVRYKSSGKRGHSAQIAKPVRPGH
FT                   YPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQAAPSSTSDMYFASSGATSVAPLASY
FT                   QKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS"
FT   CDS             complement(join(8917267..8917366,8919456..8919560,
FT                   8919686..8919757,8922150..8922259,8922361..8922425,
FT                   8922726..8922843,8923146..8923334,8924174..8924320,
FT                   8924603..8924809,8925262..8925330,8927364..8927539,
FT                   8928091..8928239,8928793..8928941,8929081..8929185,
FT                   8930786..8930910,8931141..8931228,8931383..8931438,
FT                   8932468..8932516,8932959..8933063,8933466..8933539,
FT                   8933628..8933715,8948182..>8948493))
FT                   /codon_start=1
FT                   /gene="Kif5a"
FT                   /locus_tag="mCG_5176"
FT                   /product="kinesin family member 5A, isoform CRA_b"
FT                   /note="gene_id=mCG5176.2 transcript_id=mCT191973.0
FT                   protein_id=mCP112954.0 isoform=CRA_b"
FT                   /protein_id="EDL24487.1"
FT                   /translation="PHPVPQDTESSSSPRRSSCSLGLSDRSPVHCLDLSPASPSSGVHA
FT                   TLAVGDAPSPSSSSTTMAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIG
FT                   GKPYVFDRVFPPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHD
FT                   PQLMGIIPRIARDIFNHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKN
FT                   RVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVET
FT                   EQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPY
FT                   RDSKMTRILQDSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELT
FT                   AEQWKKKYEKEKEKTKAQKETIAKLEAELSRWRNGENVPETERLAGEDSALGAELCEET
FT                   PVNDNSSIVVRIAPEERQKYEEEIRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELL
FT                   VSTRGDNEKVQRELSHLQSENDAAKDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLL
FT                   VDELSQKVATMLSLESELQRLQEVSGHQRKRIAEVLNGLMRDLSEFSVIVGNGEIKLPV
FT                   EISGAIEEEFTVARLYISKIKSEVKSVVKRCRQLENLQVECHRKMEVTGRELSSCQLLI
FT                   SQHEAKIRSLTEYMQTVELKKRHLEESYDSLSDELARLQAHETVHEVALKDKEPDTQDA
FT                   EEVKKALELQMENHREAHHRQLARLRDEINEKQKTIDELKEPVNSRPSTTFASCSFKTS
FT                   RLESRKVQKWSPRTVGGFIPKSRRSPFLRTTWNSLQRFTNSWYVTMQICVVSFLNWKND
FT                   FGLRLRELRPWRVH"
FT   CDS             complement(join(8917267..8917366,8919456..8919560,
FT                   8919686..8919757,8922150..8922259,8922361..8922425,
FT                   8922726..8922843,8923146..8923334,8924174..8924320,
FT                   8924603..8924809,8925262..8925330,8927364..8927539,
FT                   8928091..8928239,8928793..8928941,8929081..8929185,
FT                   8930786..8930910,8931141..8931228,8931383..8931438,
FT                   8932468..8932516,8932959..8933063,8933466..8933539,
FT                   8933628..8933715,8948182..>8948463))
FT                   /codon_start=1
FT                   /gene="Kif5a"
FT                   /locus_tag="mCG_5176"
FT                   /product="kinesin family member 5A, isoform CRA_a"
FT                   /note="gene_id=mCG5176.2 transcript_id=mCT191972.0
FT                   protein_id=mCP112953.0 isoform=CRA_a"
FT                   /protein_id="EDL24486.1"
FT                   /translation="SSSPRRSSCSLGLSDRSPVHCLDLSPASPSSGVHATLAVGDAPSP
FT                   SSSSTTMAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVF
FT                   PPNTTQEQVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRI
FT                   ARDIFNHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTE
FT                   RFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLSGKLYL
FT                   VDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQ
FT                   DSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEK
FT                   EKEKTKAQKETIAKLEAELSRWRNGENVPETERLAGEDSALGAELCEETPVNDNSSIVV
FT                   RIAPEERQKYEEEIRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKV
FT                   QRELSHLQSENDAAKDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVAT
FT                   MLSLESELQRLQEVSGHQRKRIAEVLNGLMRDLSEFSVIVGNGEIKLPVEISGAIEEEF
FT                   TVARLYISKIKSEVKSVVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSL
FT                   TEYMQTVELKKRHLEESYDSLSDELARLQAHETVHEVALKDKEPDTQDAEEVKKALELQ
FT                   MENHREAHHRQLARLRDEINEKQKTIDELKEPVNSRPSTTFASCSFKTSRLESRKVQKW
FT                   SPRTVGGFIPKSRRSPFLRTTWNSLQRFTNSWYVTMQICVVSFLNWKNDFGLRLRELRP
FT                   WRVH"
FT   assembly_gap    8918512..8918531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8919840..8920696
FT                   /estimated_length=857
FT                   /gap_type="unknown"
FT   assembly_gap    8921306..8921939
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   gene            8951782..8967156
FT                   /gene="Dctn2"
FT                   /locus_tag="mCG_5199"
FT                   /note="gene_id=mCG5199.2"
FT   mRNA            join(8951782..8951956,8952836..8952904,8960136..8960232,
FT                   8960416..8960477,8961246..8961344,8961806..8961966,
FT                   8962124..8962271,8962677..8962742,8962909..8962947,
FT                   8963117..8963194,8963289..8963360,8963542..8963644,
FT                   8963739..8963830,8966751..8967156)
FT                   /gene="Dctn2"
FT                   /locus_tag="mCG_5199"
FT                   /product="dynactin 2"
FT                   /note="gene_id=mCG5199.2 transcript_id=mCT3887.2 created on
FT                   19-AUG-2002"
FT   CDS             join(8951921..8951956,8952836..8952904,8960136..8960232,
FT                   8960416..8960477,8961246..8961344,8961806..8961966,
FT                   8962124..8962271,8962677..8962742,8962909..8962947,
FT                   8963117..8963194,8963289..8963360,8963542..8963644,
FT                   8963739..8963830,8966751..8966837)
FT                   /codon_start=1
FT                   /gene="Dctn2"
FT                   /locus_tag="mCG_5199"
FT                   /product="dynactin 2"
FT                   /note="gene_id=mCG5199.2 transcript_id=mCT3887.2
FT                   protein_id=mCP4396.2"
FT                   /db_xref="GOA:Q3TPZ5"
FT                   /db_xref="InterPro:IPR028133"
FT                   /db_xref="MGI:MGI:107733"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TPZ5"
FT                   /protein_id="EDL24489.1"
FT                   /translation="MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELSSTSVEH
FT                   IIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGDYEMLGEGLGVKETPQQKYQ
FT                   RLLHEVQELTTEVEKIKTTVKESATEEKLTPVVLAKQLAALKQQLVASHLEKLLGPDAA
FT                   INLADPDGALAKRLLLQLEATKSSKGSSGGKATAGAPPDSSLVTYELHSRPEQDKFSQA
FT                   AKVAELEKRLTELEATVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVE
FT                   ARLQSVLGKVNEIAKHKASVEDADTQNKVHQLYETIQRWSPVASTLPELVQRLVTIKQL
FT                   HEQAMQFGQLLTHLDTTQQMMASSLKDNTALLTQVQTTMRENLATVEGNFASIDARMKR
FT                   LGK"
FT   assembly_gap    8964670..8964689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8966060..8966104
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            complement(8967306..8969428)
FT                   /gene="Mbd6"
FT                   /locus_tag="mCG_5184"
FT                   /note="gene_id=mCG5184.3"
FT   mRNA            complement(join(8967306..8967527,8967765..8967828,
FT                   8968087..8968257,8968375..8968438,8968742..8968794,
FT                   8968876..>8969020))
FT                   /gene="Mbd6"
FT                   /locus_tag="mCG_5184"
FT                   /product="methyl-CpG binding domain protein 6, transcript
FT                   variant mCT191969"
FT                   /note="gene_id=mCG5184.3 transcript_id=mCT191969.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8967308..8968257,8968375..8968438,
FT                   8968742..8968794,8968876..8969292,8969393..8969428))
FT                   /gene="Mbd6"
FT                   /locus_tag="mCG_5184"
FT                   /product="methyl-CpG binding domain protein 6, transcript
FT                   variant mCT3904"
FT                   /note="gene_id=mCG5184.3 transcript_id=mCT3904.2 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(8967331..8967527,8967765..8967828,
FT                   8968087..>8968182))
FT                   /codon_start=1
FT                   /gene="Mbd6"
FT                   /locus_tag="mCG_5184"
FT                   /product="methyl-CpG binding domain protein 6, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5184.3 transcript_id=mCT191969.0
FT                   protein_id=mCP112958.0 isoform=CRA_a"
FT                   /protein_id="EDL24490.1"
FT                   /translation="QPYLELESDPDWGELSAEPWEPLPATCTCGQWLAGSVYKPVSYCW
FT                   LLPSFPVKALRDGVTMPLGVMQRGPAGAASMTSCPGAASCLFFCKDKTLGSFHSVLYLP
FT                   CGASTAFLWETLLI"
FT   CDS             complement(join(8968183..8968257,8968375..8968438,
FT                   8968742..8968794,8968876..8968989))
FT                   /codon_start=1
FT                   /gene="Mbd6"
FT                   /locus_tag="mCG_5184"
FT                   /product="methyl-CpG binding domain protein 6, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5184.3 transcript_id=mCT3904.2
FT                   protein_id=mCP4394.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR037385"
FT                   /db_xref="MGI:MGI:106378"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XJH3"
FT                   /protein_id="EDL24491.1"
FT                   /translation="MERSPRRTHHWQHNGELAEGGAEPKDPPLPGTHSEDLKVPPGIVR
FT                   KSRRGRRRKYNPARNSSSSRQDVTLEPSPTTRAAVPLPPRARPGRPAKNKRRKLAP"
FT   gene            <8973863..8974901
FT                   /locus_tag="mCG_1048844"
FT                   /note="gene_id=mCG1048844.0"
FT   mRNA            join(<8973863..8973928,8974680..8974901)
FT                   /locus_tag="mCG_1048844"
FT                   /product="mCG1048844"
FT                   /note="gene_id=mCG1048844.0 transcript_id=mCT166548.0
FT                   created on 19-AUG-2002"
FT   CDS             join(<8973864..8973928,8974680..8974827)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048844"
FT                   /product="mCG1048844"
FT                   /note="gene_id=mCG1048844.0 transcript_id=mCT166548.0
FT                   protein_id=mCP44542.0"
FT                   /protein_id="EDL24492.1"
FT                   /translation="TEGSEVRKAEVRHFGRRNGGGRPGETIWSNPPPTSTNRRGNEGLE
FT                   RRSSLAKDLSPSHHPIATGLGSVST"
FT   assembly_gap    8974031..8974372
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   gene            complement(8974916..>8975986)
FT                   /locus_tag="mCG_1048845"
FT                   /note="gene_id=mCG1048845.0"
FT   mRNA            complement(join(8974916..8975171,8975783..>8975986))
FT                   /locus_tag="mCG_1048845"
FT                   /product="mCG1048845"
FT                   /note="gene_id=mCG1048845.0 transcript_id=mCT166549.0
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(8975069..8975171,8975783..>8975985))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048845"
FT                   /product="mCG1048845"
FT                   /note="gene_id=mCG1048845.0 transcript_id=mCT166549.0
FT                   protein_id=mCP44560.0"
FT                   /protein_id="EDL24493.1"
FT                   /translation="CCPAPPGGGAGSRSLPIRKRHAGTGSASSLTSATQESHGPTPIAP
FT                   SGLRVYVVSDPEVALGHAASRRSESCDSLLRSWPPASSCLSSRPTVEPGTCMHLNA"
FT   gene            8976017..8981511
FT                   /gene="Ddit3"
FT                   /locus_tag="mCG_5189"
FT                   /note="gene_id=mCG5189.1"
FT   mRNA            join(8976017..8976115,8978932..8978979,8980541..8980698,
FT                   8980943..8981506)
FT                   /gene="Ddit3"
FT                   /locus_tag="mCG_5189"
FT                   /product="DNA-damage inducible transcript 3, transcript
FT                   variant mCT3901"
FT                   /note="gene_id=mCG5189.1 transcript_id=mCT3901.1 created on
FT                   07-AUG-2002"
FT   mRNA            join(8976026..8976115,8980541..8980698,8980943..8981511)
FT                   /gene="Ddit3"
FT                   /locus_tag="mCG_5189"
FT                   /product="DNA-damage inducible transcript 3, transcript
FT                   variant mCT171792"
FT                   /note="gene_id=mCG5189.1 transcript_id=mCT171792.0 created
FT                   on 07-AUG-2002"
FT   mRNA            join(<8976030..8976111,8978932..8978979,8980541..8980698,
FT                   8980943..8981504)
FT                   /gene="Ddit3"
FT                   /locus_tag="mCG_5189"
FT                   /product="DNA-damage inducible transcript 3, transcript
FT                   variant mCT191979"
FT                   /note="gene_id=mCG5189.1 transcript_id=mCT191979.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(8976049..8976115,8980541..8980698,8980943..8981311)
FT                   /codon_start=1
FT                   /gene="Ddit3"
FT                   /locus_tag="mCG_5189"
FT                   /product="DNA-damage inducible transcript 3, isoform CRA_a"
FT                   /note="gene_id=mCG5189.1 transcript_id=mCT171792.0
FT                   protein_id=mCP94711.0 isoform=CRA_a"
FT                   /protein_id="EDL24494.1"
FT                   /translation="MLKMSGWQRQSQNNSRNLRREAKPGPRAVMAAESLPFTLETVSSW
FT                   ELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTRT
FT                   SQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLA
FT                   EENERLKQEIERLTREVETTRRALIDRMVSLHQA"
FT   CDS             join(<8976090..8976111,8978932..8978979,8980541..8980698,
FT                   8980943..8981311)
FT                   /codon_start=1
FT                   /gene="Ddit3"
FT                   /locus_tag="mCG_5189"
FT                   /product="DNA-damage inducible transcript 3, isoform CRA_b"
FT                   /note="gene_id=mCG5189.1 transcript_id=mCT191979.0
FT                   protein_id=mCP112959.0 isoform=CRA_b"
FT                   /protein_id="EDL24495.1"
FT                   /translation="QPEPEERVFQKEVHLHTPPHLKAEPGPRAVMAAESLPFTLETVSS
FT                   WELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLTEEPGPTEVTR
FT                   TSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQL
FT                   AEENERLKQEIERLTREVETTRRALIDRMVSLHQA"
FT   CDS             join(8980561..8980698,8980943..8981311)
FT                   /codon_start=1
FT                   /gene="Ddit3"
FT                   /locus_tag="mCG_5189"
FT                   /product="DNA-damage inducible transcript 3, isoform CRA_c"
FT                   /note="gene_id=mCG5189.1 transcript_id=mCT3901.1
FT                   protein_id=mCP4475.1 isoform=CRA_c"
FT                   /protein_id="EDL24496.1"
FT                   /translation="MAAESLPFTLETVSSWELEAWYEDLQEVLSSDEIGGTYISSPGNE
FT                   EEESKTFTTLDPASLAWLTEEPGPTEVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKR
FT                   KQSGQCPARPGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVETTRRALIDRMV
FT                   SLHQA"
FT   gene            complement(8981448..8997288)
FT                   /gene="Mars"
FT                   /locus_tag="mCG_5191"
FT                   /note="gene_id=mCG5191.3"
FT   mRNA            complement(join(8981448..8981660,8981761..8982164,
FT                   8982983..8983169,8983252..8983356,8983439..8983570,
FT                   8984765..8984978,8985466..8985583,8985695..8985790,
FT                   8985927..8986097,8988329..8988403,8989702..8989903,
FT                   8990939..8991142,8991258..8991374,8993775..8993881,
FT                   8994018..8994196,8994425..8994500,8995521..8995655,
FT                   8995737..8995815,8995961..8996051,8997038..>8997155))
FT                   /gene="Mars"
FT                   /locus_tag="mCG_5191"
FT                   /product="methionine-tRNA synthetase, transcript variant
FT                   mCT191967"
FT                   /note="gene_id=mCG5191.3 transcript_id=mCT191967.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8981459..8981660,8981761..8981853,
FT                   8981937..8981960,8982093..8982164,8982983..8983169,
FT                   8983252..8983356,8983439..8983570,8984765..8984978,
FT                   8985466..8985583,8985695..8985790,8985927..8986097,
FT                   8988329..8988403,8989702..8989903,8990939..8991142,
FT                   8991258..8991374,8993775..8993881,8994018..8994196,
FT                   8994425..8994500,8995521..8995655,8995737..8995815,
FT                   8995961..8996051,8997020..8997288))
FT                   /gene="Mars"
FT                   /locus_tag="mCG_5191"
FT                   /product="methionine-tRNA synthetase, transcript variant
FT                   mCT3895"
FT                   /note="gene_id=mCG5191.3 transcript_id=mCT3895.2 created on
FT                   19-AUG-2002"
FT   CDS             complement(join(8981514..8981660,8981761..8981853,
FT                   8981937..8981960,8982093..8982164,8982983..8983169,
FT                   8983252..8983356,8983439..8983570,8984765..8984978,
FT                   8985466..8985583,8985695..8985790,8985927..8986097,
FT                   8988329..8988403,8989702..8989903,8990939..8991142,
FT                   8991258..8991374,8993775..8993881,8994018..8994196,
FT                   8994425..8994500,8995521..8995655,8995737..8995815,
FT                   8995961..8996051,8997020..8997146))
FT                   /codon_start=1
FT                   /gene="Mars"
FT                   /locus_tag="mCG_5191"
FT                   /product="methionine-tRNA synthetase, isoform CRA_b"
FT                   /note="gene_id=mCG5191.3 transcript_id=mCT3895.2
FT                   protein_id=mCP4390.2 isoform=CRA_b"
FT                   /protein_id="EDL24498.1"
FT                   /translation="MRLFVSEGSPGSLPVLAAAARARGRAELLISTVGPEGTGVAAECV
FT                   VPFLTRPKVPVLQLDSGNYLFSASAICRYFFLLCGWEQDDLTNQWLEWEATELQPVLSA
FT                   ALHCLVVQGKKGEDILGPLRRVLTHIDHSLSRQNCPFLAGDTESLADIVLWGALYPLLQ
FT                   DPAYLPEELGALQSWFQTLSTQEPCQRAAETVLKQQGVLALRLYLQKQPQPQPPPPEGR
FT                   TVSNELEEEELATLSEEDIVTAVAAWEKGLESLPPLKLQQHPVLPVPGERNVLITSALP
FT                   YVNNVPHLGNIIGCVLSADVFARYCRLRQWNTLYLCGTDEYGTATETKAMEEGLTPREI
FT                   CDKYHAIHADIYRWFGISFDTFGRTTTPQQTKITQDIFQRLLTRGFVLRDTVEQLRCER
FT                   CARFLADRFVEGVCPFCGYEEARGDQCDRCGKLINAIELKKPQCKICRSCPVVRSSQHL
FT                   FLDLPKLEKRLEDWLGKTVPGSDWTPNARFIIRSWLRDGLKPRCITRDLKWGTPVPLEG
FT                   FEDKVFYVWFDATIGYVSITANYTDQWEKWWKNPEQVDLYQFMAKDNVPFHGLVFPCSV
FT                   LGAEDNYTLVKHIIATEYLNYEDGKFSKSRGIGVFGDMAKDTGIPADIWRFYLLYIRPE
FT                   GQDSAFSWTDLLIKNNSELLNNLGNFINRAGMFVSKFFGGCVPEMALTPDDRRLVAHVS
FT                   WELQHYHQLLEKVRIRDALRSILTISRHGNQYIQVNEPWKRIKGGEMDRQRAGTVTGMA
FT                   VNMAALLSVMLQPYMPTVSSTIQTQLQLPPAACRILATSFICTLPAGHRIGTVSPLFQK
FT                   LENDQIENLRQRFGGGQLEESLELKAKGSPKPAAVEAVTAAGSQHIQTLTDEVTKQGNV
FT                   VRELKAQKADKNQVAAEVAKLLDLKKQLALAEGKPIETPKGKKKK"
FT   CDS             complement(join(8982000..8982164,8982983..8983169,
FT                   8983252..8983356,8983439..8983570,8984765..8984978,
FT                   8985466..8985583,8985695..8985790,8985927..8986097,
FT                   8988329..8988403,8989702..8989903,8990939..8991142,
FT                   8991258..8991374,8993775..8993881,8994018..8994196,
FT                   8994425..8994500,8995521..8995655,8995737..8995815,
FT                   8995961..8996051,8997038..>8997155))
FT                   /codon_start=1
FT                   /gene="Mars"
FT                   /locus_tag="mCG_5191"
FT                   /product="methionine-tRNA synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG5191.3 transcript_id=mCT191967.0
FT                   protein_id=mCP112960.0 isoform=CRA_a"
FT                   /protein_id="EDL24497.1"
FT                   /translation="RGTMRLFVSEGSPGSLPVLAAAARARGRAELLISTVGPEECVVPF
FT                   LTRPKVPVLQLDSGNYLFSASAICRYFFLLCGWEQDDLTNQWLEWEATELQPVLSAALH
FT                   CLVVQGKKGEDILGPLRRVLTHIDHSLSRQNCPFLAGDTESLADIVLWGALYPLLQDPA
FT                   YLPEELGALQSWFQTLSTQEPCQRAAETVLKQQGVLALRLYLQKQPQPQPPPPEGRTVS
FT                   NELEEEELATLSEEDIVTAVAAWEKGLESLPPLKLQQHPVLPVPGERNVLITSALPYVN
FT                   NVPHLGNIIGCVLSADVFARYCRLRQWNTLYLCGTDEYGTATETKAMEEGLTPREICDK
FT                   YHAIHADIYRWFGISFDTFGRTTTPQQTKITQDIFQRLLTRGFVLRDTVEQLRCERCAR
FT                   FLADRFVEGVCPFCGYEEARGDQCDRCGKLINAIELKKPQCKICRSCPVVRSSQHLFLD
FT                   LPKLEKRLEDWLGKTVPGSDWTPNARFIIRSWLRDGLKPRCITRDLKWGTPVPLEGFED
FT                   KVFYVWFDATIGYVSITANYTDQWEKWWKNPEQVDLYQFMAKDNVPFHGLVFPCSVLGA
FT                   EDNYTLVKHIIATEYLNYEDGKFSKSRGIGVFGDMAKDTGIPADIWRFYLLYIRPEGQD
FT                   SAFSWTDLLIKNNSELLNNLGNFINRAGMFVSKFFGGCVPEMALTPDDRRLVAHVSWEL
FT                   QHYHQLLEKVRIRDALRSILTISRHGNQYIQVNEPWKRIKGGEMDRQRAGTVTGMAVNM
FT                   AALLSVMLQPYMPTVSSTIQTQLQLPPAACRILATSFICTLPAGHRIGTVSPLFQKLEN
FT                   DQIENLRQRFGGGQVSKLDCALPQQKPWQCPPISPSILTLSFHL"
FT   assembly_gap    8982186..8982205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8998666..8999665
FT                   /pseudo
FT                   /locus_tag="mCG_17028"
FT                   /note="gene_id=mCG17028.1"
FT   mRNA            8998666..8999665
FT                   /pseudo
FT                   /locus_tag="mCG_17028"
FT                   /note="gene_id=mCG17028.1 transcript_id=mCT15975.2 created
FT                   on 19-AUG-2002"
FT   assembly_gap    9006197..9006251
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   gene            <9007508..9015454
FT                   /gene="Arhgap9"
FT                   /locus_tag="mCG_134497"
FT                   /note="gene_id=mCG134497.0"
FT   mRNA            join(<9007508..9007819,9007857..9007990,9008253..9008449,
FT                   9009453..9009637,9010630..9010710,9011034..9011141,
FT                   9011355..9011413,9011559..9011652,9011843..9011938,
FT                   9012064..9012162,9012384..9012525,9012606..9012716,
FT                   9013149..9013247,9013410..9013487,9013605..9013658,
FT                   9013902..9014036,9014390..9014495,9015011..9015454)
FT                   /gene="Arhgap9"
FT                   /locus_tag="mCG_134497"
FT                   /product="Rho GTPase activating protein 9, transcript
FT                   variant mCT135884"
FT                   /note="gene_id=mCG134497.0 transcript_id=mCT135884.1
FT                   created on 19-AUG-2002"
FT   assembly_gap    9007834..9007853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<9008402..9008449,9010630..9010710,9011034..9011141,
FT                   9011355..9011413,9011559..9011652,9011843..9011938,
FT                   9012064..9012162,9012384..9012525,9012606..9012716,
FT                   9013149..9013247,9013410..9013487,9013605..9013658,
FT                   9013902..9014036,9014390..9014495,9015011..9015300)
FT                   /gene="Arhgap9"
FT                   /locus_tag="mCG_134497"
FT                   /product="Rho GTPase activating protein 9, transcript
FT                   variant mCT191970"
FT                   /note="gene_id=mCG134497.0 transcript_id=mCT191970.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9008402..9008449,9010630..9010710,9011034..9011141,
FT                   9011355..9011413,9011559..9011652,9011843..9011938,
FT                   9012064..9012162,9012384..9012525,9012606..9012716,
FT                   9013149..9013247,9013410..9013487,9013605..9013658,
FT                   9013902..9014036,9014390..9014495,9015011..9015182)
FT                   /codon_start=1
FT                   /gene="Arhgap9"
FT                   /locus_tag="mCG_134497"
FT                   /product="Rho GTPase activating protein 9, isoform CRA_b"
FT                   /note="gene_id=mCG134497.0 transcript_id=mCT191970.0
FT                   protein_id=mCP112925.0 isoform=CRA_b"
FT                   /protein_id="EDL24500.1"
FT                   /translation="EGPGERSHWWMTEVAVKPGSMEQTETLTRDSSALQPQEWLDPQGL
FT                   PSLSQSVPWLALSEQPGALRPCSALPQLLDDPHVEERSGLLNMTKIAQGGRKLRKNWGP
FT                   AWVVLTGSSLVFYRERPPQSASLQGWARAGSRPESSVDLRGAALASGCQLSSRRNVLHI
FT                   RTVPGHEFLLQSDEETELRDWHRALRTVIERLDRENPLELRLSGSGPAELAELSAGEDD
FT                   ELESEPVSKSLMRLGSRRTSSRCAEGTDQKNRVRNKLKRLIAKRPTLQSLQERGLFRDQ
FT                   VFGCQLESLCQREGDTVPSFVRLCVEAVDKKGLDVDGIYRVSGNLAVVQKLRFLVDRER
FT                   AVTSDGRYMFPEQAGQEGKLDLDSAEWDDIHVVTGALKLFFRELPQPLVPALLLPDFRD
FT                   ALELSEPEQCLSKIQKLIDSLPRPNHDTLKYILEHLCRVIAHSDKNRMTAHNLGIVFGP
FT                   TLFRPEQEASDMAAHVFYPGQLVQLMLNNFASLFT"
FT   CDS             join(<9008422..9008449,9009453..9009637,9010630..9010710,
FT                   9011034..9011141,9011355..9011413,9011559..9011652,
FT                   9011843..9011938,9012064..9012162,9012384..9012525,
FT                   9012606..9012716,9013149..9013247,9013410..9013487,
FT                   9013605..9013658,9013902..9014036,9014390..9014495,
FT                   9015011..9015182)
FT                   /codon_start=1
FT                   /gene="Arhgap9"
FT                   /locus_tag="mCG_134497"
FT                   /product="Rho GTPase activating protein 9, isoform CRA_a"
FT                   /note="gene_id=mCG134497.0 transcript_id=mCT135884.1
FT                   protein_id=mCP44588.1 isoform=CRA_a"
FT                   /protein_id="EDL24499.1"
FT                   /translation="SLVDDRSCCASRSWGRQDHILSQLPVYCNLAGLLRRPGSLVRSPC
FT                   IPSHALQEAEWLRAAPNRILKRKALSKPGSMEQTETLTRDSSALQPQEWLDPQGLPSLS
FT                   QSVPWLALSEQPGALRPCSALPQLLDDPHVEERSGLLNMTKIAQGGRKLRKNWGPAWVV
FT                   LTGSSLVFYRERPPQSASLQGWARAGSRPESSVDLRGAALASGCQLSSRRNVLHIRTVP
FT                   GHEFLLQSDEETELRDWHRALRTVIERLDRENPLELRLSGSGPAELAELSAGEDDELES
FT                   EPVSKSLMRLGSRRTSSRCAEGTDQKNRVRNKLKRLIAKRPTLQSLQERGLFRDQVFGC
FT                   QLESLCQREGDTVPSFVRLCVEAVDKKGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTS
FT                   DGRYMFPEQAGQEGKLDLDSAEWDDIHVVTGALKLFFRELPQPLVPALLLPDFRDALEL
FT                   SEPEQCLSKIQKLIDSLPRPNHDTLKYILEHLCRVIAHSDKNRMTAHNLGIVFGPTLFR
FT                   PEQEASDMAAHVFYPGQLVQLMLNNFASLFT"
FT   assembly_gap    9010138..9010158
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            complement(9015397..9027096)
FT                   /gene="Gli1"
FT                   /locus_tag="mCG_17037"
FT                   /note="gene_id=mCG17037.1"
FT   mRNA            complement(join(9015397..9017312,9017913..9018177,
FT                   9019080..9019310,9019712..9019876,9021476..9021625,
FT                   9021925..9022062,9022152..9022241,9022526..9022670,
FT                   9022903..9023107,9023585..9023677,9023935..9024060,
FT                   9026722..9026835,9027076..9027096))
FT                   /gene="Gli1"
FT                   /locus_tag="mCG_17037"
FT                   /product="GLI-Kruppel family member GLI1"
FT                   /note="gene_id=mCG17037.1 transcript_id=mCT15986.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(9015559..9017312,9017913..9018177,
FT                   9019080..9019310,9019712..9019876,9021476..9021625,
FT                   9021925..9022062,9022152..9022241,9022526..9022670,
FT                   9022903..9023107,9023585..9023677,9023935..9024034))
FT                   /codon_start=1
FT                   /gene="Gli1"
FT                   /locus_tag="mCG_17037"
FT                   /product="GLI-Kruppel family member GLI1"
FT                   /note="gene_id=mCG17037.1 transcript_id=mCT15986.1
FT                   protein_id=mCP4436.2"
FT                   /db_xref="GOA:P47806"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR032850"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="MGI:MGI:95727"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47806"
FT                   /protein_id="EDL24501.1"
FT                   /translation="MFNPMTPPQVNSYSEPCCLRPLHSQGVPSMGTEGLSGLPFCHQAN
FT                   FMSGSQGYGAARETSSCTEGSLFPPPPPPRSSVKLTKKRALSISPLSDASLDLQTVIRT
FT                   SPSSLVAFINSRCTSPGGSYGHLSIGTMSPSLGFPPQMSHQKGTSPPYGVQPCVPHDST
FT                   RGSMMLHPQSRGPRATCQLKSELDMMVGKCPEDPLEGDMSSPNSTGTQDHLLGMLDGRE
FT                   DLEREEKPEPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRE
FT                   LRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEG
FT                   CSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKR
FT                   HRGDGPLPRAQPLSTVEPKREREGGSGREESRLTVPESAMPQQSPGAQSSCSSDHSPAG
FT                   SAANTDSGVEMAGNAGGSTEDLSSLDEGPCVSATGLSTLRRLENLRLDQLHQLRPIGSR
FT                   GLKLPSLTHAGAPVSRRLGPPVSLDRRSSSSSSMSSAYTVSRRSSLASPFPPGTPPENG
FT                   ASSLPGLTPAQHYMLRARYASARGSGTPPTAAHSLDRMGGLSVPPWRSRTEYPGYNPNA
FT                   GVTRRASDPARAADHPAPARVQRFKSLGCVHTPPSVATGRNFDPHHPTSVYSPQPPSIT
FT                   ENVAMDTRGLQEEPEVGTSVMGNGLNPYMDFSSTDTLGYGGPEGTAAEPYEARGPGSLP
FT                   LGPGPPTNYGPGHCAQQVSYPDPTPENWGEFPSHAGVYPSNKAPGAAYSQCPRLEHYGQ
FT                   VQVKPEQGCPVGSDSTGLAPCLNAHPSEGSPGPQPLFSHHPQLPQPQYPQSGPYPQPPH
FT                   GYLSTEPRLGLNFNPSSSHSTGQLKAQLVCNYVQSQQELLWEGRNRGGLPNQELPYQSP
FT                   KFLGGSQVSQSPAKTPAAAAAAYGSGFAPASANHKSGSYPAPSPCHETFTVGVNRPSHR
FT                   PAAPPRLLPPLSPCYGPLKVGDTNPSCGHPEVGRLGAGPALYPPPEGQVCNALDSLDLD
FT                   NTQLDFVAILDEAQGLSPPLSHEQGDSSKNTPSPSGPPNMAVGNMSVLLGSLPGETQFL
FT                   NSSA"
FT   assembly_gap    9027141..9027366
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            complement(9034809..9037173)
FT                   /gene="Inhbe"
FT                   /locus_tag="mCG_17039"
FT                   /note="gene_id=mCG17039.0"
FT   mRNA            complement(join(9034809..9036418,9036655..9037173))
FT                   /gene="Inhbe"
FT                   /locus_tag="mCG_17039"
FT                   /product="inhibin beta E"
FT                   /note="gene_id=mCG17039.0 transcript_id=mCT15988.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(9035664..9036418,9036655..9036952))
FT                   /codon_start=1
FT                   /gene="Inhbe"
FT                   /locus_tag="mCG_17039"
FT                   /product="inhibin beta E"
FT                   /note="gene_id=mCG17039.0 transcript_id=mCT15988.1
FT                   protein_id=mCP4467.1"
FT                   /db_xref="GOA:O08717"
FT                   /db_xref="InterPro:IPR001318"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:109269"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08717"
FT                   /protein_id="EDL24502.1"
FT                   /translation="MKLPKAQLWLILLWALVWVQSTRSACPSCGGPTLAPQGERALVLE
FT                   LAKQQILEGLHLTSRPRITRPLPQAALTRALRRLQPKSMVPGNREKVISFATIIDKSTS
FT                   TYRSMLTFQLSPLWSHHLYHARLWLHVPPSFPGTLYLRIFRCGTTRCRGFRTFLAEHQT
FT                   TSSGWHALTLPSSGLRSEDSGVVKLQLEFRPLDLNSTAAGLPRLLLDTAGQQRPFLELK
FT                   IRANEPGAGRARRRTPTCEPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCP
FT                   PHLAGSPGIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVP
FT                   DMVVEACGCS"
FT   gene            complement(9041739..9055791)
FT                   /gene="Inhbc"
FT                   /locus_tag="mCG_17041"
FT                   /note="gene_id=mCG17041.2"
FT   mRNA            complement(join(9041739..9043234,9055328..9055791))
FT                   /gene="Inhbc"
FT                   /locus_tag="mCG_17041"
FT                   /product="inhibin beta-C"
FT                   /note="gene_id=mCG17041.2 transcript_id=mCT15990.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(9042492..9043234,9055328..9055643))
FT                   /codon_start=1
FT                   /gene="Inhbc"
FT                   /locus_tag="mCG_17041"
FT                   /product="inhibin beta-C"
FT                   /note="gene_id=mCG17041.2 transcript_id=mCT15990.1
FT                   protein_id=mCP4469.0"
FT                   /protein_id="EDL24503.1"
FT                   /translation="MASSLLLALLFLTPTTVVNPKTEGPCPACWGAIFDLESQRELLLD
FT                   LAKKSILDKLHLSQRPILSRPVSRGALKTALQRLRGPRRETLLEHDQRQEEYEIISFAD
FT                   TDLSSINQTRLEFHFSGRMASGMEVRQTRFMFFVQFPHNATQTMNIRVLVLRPYDTNLT
FT                   LTSQYVVQVNASGWYQLLLGPEAQAACSQGHLTLELVPESQVAHSSLILGWFSHRPFVA
FT                   AQVRVEGKHRVRRRGIDCQGASRMCCRQEFFVDFREIGWNDWIIQPEGYAMNFCTGQCP
FT                   LHVAGMPGISASFHTAVLNLLKANAAAGTTGRGSCCVPTSRRPLSLLYYDRDSNIVKTD
FT                   IPDMVVEACGCS"
FT   assembly_gap    9052821..9052931
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    9057922..9058694
FT                   /estimated_length=773
FT                   /gap_type="unknown"
FT   assembly_gap    9060470..9061926
FT                   /estimated_length=1457
FT                   /gap_type="unknown"
FT   assembly_gap    9066023..9066603
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    9070044..9070063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9072310..9072329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9085225..9183797
FT                   /gene="R3hdm2"
FT                   /locus_tag="mCG_134500"
FT                   /note="gene_id=mCG134500.1"
FT   mRNA            join(9085225..9085318,9085584..9085651,9129364..9129563,
FT                   9136671..9136712,9137373..9137459,9139312..9139438,
FT                   9142346..9142424,9142835..9142894,9143506..9143646,
FT                   9144163..9144271,9146884..9146979,9149678..9149709,
FT                   9156191..9156423,9160943..9161121,9168399..9168641,
FT                   9168929..9169055,9169285..9169445,9169839..9169993,
FT                   9172202..9172302,9176997..9177166,9179449..9179596,
FT                   9181588..9181685,9181967..9182051,9182795..9183797)
FT                   /gene="R3hdm2"
FT                   /locus_tag="mCG_134500"
FT                   /product="R3H domain containing 2, transcript variant
FT                   mCT135887"
FT                   /note="gene_id=mCG134500.1 transcript_id=mCT135887.1
FT                   created on 19-AUG-2002"
FT   mRNA            join(<9085609..9085651,9129364..9129563,9136671..9136712,
FT                   9137373..9137459,9139312..9139438,9142346..9142424,
FT                   9142835..9142894,9143506..9143646,9144163..9144271,
FT                   9146884..9146979,9149678..9149709,9149827..9149880,
FT                   9156191..9156423,9160943..9161121,9166116..9166217,
FT                   9168399..9168641,9168929..9169055,9169285..9169445,
FT                   9169839..9169993,9172202..9172302,9176997..9177166,
FT                   9179449..9179596,9181588..9181685,9181967..9182051,
FT                   9182795..9183786)
FT                   /gene="R3hdm2"
FT                   /locus_tag="mCG_134500"
FT                   /product="R3H domain containing 2, transcript variant
FT                   mCT191991"
FT                   /note="gene_id=mCG134500.1 transcript_id=mCT191991.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9085609..9085651,9129364..9129563,9136671..9136712,
FT                   9137373..9137459,9139312..9139438,9142346..9142424,
FT                   9142835..9142894,9143506..9143646,9144163..9144271,
FT                   9146884..9146979,9149678..9149709,9149827..9149880,
FT                   9156191..9156423,9160943..9161121,9166116..9166217,
FT                   9168399..9168641,9168929..9169055,9169285..9169445,
FT                   9169839..9169993,9172202..9172302,9176997..9177166,
FT                   9179449..9179596,9181588..9181685,9181967..9182051,
FT                   9182795..9183135)
FT                   /codon_start=1
FT                   /gene="R3hdm2"
FT                   /locus_tag="mCG_134500"
FT                   /product="R3H domain containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG134500.1 transcript_id=mCT191991.0
FT                   protein_id=mCP112926.0 isoform=CRA_b"
FT                   /protein_id="EDL24505.1"
FT                   /translation="AIPALDSWRLSIYSEIHKSCCTLLQNMSNSNTTQETLEIMKESEK
FT                   KLVEESVNKNKFISKTPSKEDVEKEGEENGLRQETQRRTSSHGHARKRAKSNSKLKLVR
FT                   SLAVCEESSTPFVDGPLDTQDIIQLHISCPSDKEEEKSTKDVSEKEDKDKSKEKVPRKM
FT                   LSRDSSQEYTDSTGIDLHEFLVNTLKKNPRDRMMLLKLEQEILDFINDNNNQFKKFPQM
FT                   TSYHRMLLHRVAAYFGMDHNVDQTGKAVIINKTSSTRIPEQRFSEHIKDEKNTEFQQRF
FT                   ILKRDDASMDRDDNQMRVPLQDGRRSKSIEEREEEYQRVRERIFARETGQNGYLNDIRL
FT                   SKEAFSSSSHKRRQIFRGNREGLSRTSSSRQSSTDSELKSLEPRPWSSTDSDGSVRSMR
FT                   PPVTKASSFSGISILTRGDSIGSSKGGSAGRLSRPGMALGAPEVCNQVTSPQSVRGLLP
FT                   CTAQQQQQQQQQQQQLPALPPTPQHQPPLNNHMISQPVPALQPSPQPVQFSPSSCPQVL
FT                   LPVSPPQQYNMAEDLSNPFGQMSLSRQGSTEAADPSSALFQPPLISQHPQQASFIMASA
FT                   GQPLPTSNYSTSSHAPPTQQVLPPQGYMQPPQQIQVSYYPPGQYPNSNQQYRPLSHPVA
FT                   YSPQRGQQLPQASQQPGLQPMMSNQQQTAYQGMLGVQQPQNQGLLSNQRSSMGGQMQGL
FT                   VVQYTPLPSYQVPVGSDSQNVVQPSFQQPMLVPASQSVQGGLPTGGVPVYYSMIPPAQQ
FT                   NGTSPSVGFLQPPGSEQYQMPQSPSPCSPPQMSQQYSGVSPSGPGVVVMQLNVPNGPQA
FT                   PQNPSMVQWSHCKYYSVEQRGQKPGDLYSPDGSPQANAQMGSSPVTSPTQSPAPSPVTS
FT                   LSNVCTGLSPLPVLTPFPRPGGPAQGDGRYSLLGQPLQYNLSICPPLLHGQSTYTVHQG
FT                   QSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEGITRTEADKLFTQLAMSGA
FT                   KIQWLKDAQGLPGAGGGDNSGTAENGRHPDLAALYTIVAVFPSPLAAQNASLRLNNSVS
FT                   RFKLRVAKKNYDLRILERASSQ"
FT   assembly_gap    9105297..9105355
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    9111348..9111535
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   CDS             join(9129399..9129563,9136671..9136712,9137373..9137459,
FT                   9139312..9139438,9142346..9142424,9142835..9142894,
FT                   9143506..9143646,9144163..9144271,9146884..9146979,
FT                   9149678..9149709,9156191..9156423,9160943..9161121,
FT                   9168399..9168641,9168929..9169055,9169285..9169445,
FT                   9169839..9169993,9172202..9172302,9176997..9177166,
FT                   9179449..9179596,9181588..9181685,9181967..9182051,
FT                   9182795..9183135)
FT                   /codon_start=1
FT                   /gene="R3hdm2"
FT                   /locus_tag="mCG_134500"
FT                   /product="R3H domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG134500.1 transcript_id=mCT135887.1
FT                   protein_id=mCP44590.1 isoform=CRA_a"
FT                   /protein_id="EDL24504.1"
FT                   /translation="MSNSNTTQETLEIMKESEKKLVEESVNKNKFISKTPSKEDVEKEG
FT                   EENGLRQETQRRTSSHGHARKRAKSNSKLKLVRSLAVCEESSTPFVDGPLDTQDIIQLH
FT                   ISCPSDKEEEKSTKDVSEKEDKDKSKEKVPRKMLSRDSSQEYTDSTGIDLHEFLVNTLK
FT                   KNPRDRMMLLKLEQEILDFINDNNNQFKKFPQMTSYHRMLLHRVAAYFGMDHNVDQTGK
FT                   AVIINKTSSTRIPEQRFSEHIKDEKNTEFQQRFILKRDDASMDRDDNQMRVPLQDGRRS
FT                   KSIEEREEEYQRVRERIFARETGQNGYLNDIRGNREGLSRTSSSRQSSTDSELKSLEPR
FT                   PWSSTDSDGSVRSMRPPVTKASSFSGISILTRGDSIGSSKGGSAGRLSRPGMALGAPEV
FT                   CNQVTSPQSVRGLLPCTAQQQQQQQQQQQQLPALPPTPQHQPPLNNHMISQAEDLSNPF
FT                   GQMSLSRQGSTEAADPSSALFQPPLISQHPQQASFIMASAGQPLPTSNYSTSSHAPPTQ
FT                   QVLPPQGYMQPPQQIQVSYYPPGQYPNSNQQYRPLSHPVAYSPQRGQQLPQASQQPGLQ
FT                   PMMSNQQQTAYQGMLGVQQPQNQGLLSNQRSSMGGQMQGLVVQYTPLPSYQVPVGSDSQ
FT                   NVVQPSFQQPMLVPASQSVQGGLPTGGVPVYYSMIPPAQQNGTSPSVGFLQPPGSEQYQ
FT                   MPQSPSPCSPPQMSQQYSGVSPSGPGVVVMQLNVPNGPQAPQNPSMVQWSHCKYYSVEQ
FT                   RGQKPGDLYSPDGSPQANAQMGSSPVTSPTQSPAPSPVTSLSNVCTGLSPLPVLTPFPR
FT                   PGGPAQGDGRYSLLGQPLQYNLSICPPLLHGQSTYTVHQGQSGLKHGNRGKRQALKSAS
FT                   TDLGTADVVLGRVLEVTDLPEGITRTEADKLFTQLAMSGAKIQWLKDAQGLPGAGGGDN
FT                   SGTAENGRHPDLAALYTIVAVFPSPLAAQNASLRLNNSVSRFKLRVAKKNYDLRILERA
FT                   SSQ"
FT   assembly_gap    9135407..9135426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9186119..9193492
FT                   /gene="Stac3"
FT                   /locus_tag="mCG_134501"
FT                   /note="gene_id=mCG134501.2"
FT   mRNA            join(9186119..9186157,9187103..9187270,9187511..9187775,
FT                   9187989..9188086,9188277..9188337,9189275..9189372,
FT                   9191903..9191969,9192138..9192190,9192376..9192461,
FT                   9192623..9192674,9192758..9192895,9193057..9193486)
FT                   /gene="Stac3"
FT                   /locus_tag="mCG_134501"
FT                   /product="SH3 and cysteine rich domain 3, transcript
FT                   variant mCT135888"
FT                   /note="gene_id=mCG134501.2 transcript_id=mCT135888.1
FT                   created on 19-AUG-2002"
FT   mRNA            join(<9186137..9186405,9187103..9187270,9187511..9187775,
FT                   9187989..9188086,9188277..9188337,9189275..9189372,
FT                   9191903..9191969,9192138..9192190,9192376..9192461,
FT                   9192623..9192674,9192758..9192895,9193057..9193492)
FT                   /gene="Stac3"
FT                   /locus_tag="mCG_134501"
FT                   /product="SH3 and cysteine rich domain 3, transcript
FT                   variant mCT191993"
FT                   /note="gene_id=mCG134501.2 transcript_id=mCT191993.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9187184..9187270,9187511..9187775,9187989..9188086,
FT                   9188277..9188337,9189275..9189372,9191903..9191969,
FT                   9192138..9192190,9192376..9192461,9192623..9192674,
FT                   9192758..9192895,9193057..9193155)
FT                   /codon_start=1
FT                   /gene="Stac3"
FT                   /locus_tag="mCG_134501"
FT                   /product="SH3 and cysteine rich domain 3, isoform CRA_b"
FT                   /note="gene_id=mCG134501.2 transcript_id=mCT191993.0
FT                   protein_id=mCP112927.0 isoform=CRA_b"
FT                   /protein_id="EDL24507.1"
FT                   /translation="RGPISCKMTEKEVVESPQPPFPGETPQSGLQRLKQLFKKGSPETA
FT                   EMEPPPEPQANGEAVGAGGGPIYYIYEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFK
FT                   KPKFCDVCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRCFGKIPPGFRRAYSSPLY
FT                   SDQQYAVSAANRNDPVFETLRVGVIMANKERKKGQADKKNPLAAMMEEEPESARPEEGK
FT                   SQDGNNAEKDKKAEKKTPDDKNKQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVID
FT                   DSNEEWWRGKIGEKVGFFPPNFIIRVRAGERVHRVTRSFVGNREIGQITLKKDQIVVQK
FT                   GDEAGGYVKVYTGRKVGLFPTDFLEEI"
FT   CDS             join(9187205..9187270,9187511..9187775,9187989..9188086,
FT                   9188277..9188337,9189275..9189372,9191903..9191969,
FT                   9192138..9192190,9192376..9192461,9192623..9192674,
FT                   9192758..9192895,9193057..9193155)
FT                   /codon_start=1
FT                   /gene="Stac3"
FT                   /locus_tag="mCG_134501"
FT                   /product="SH3 and cysteine rich domain 3, isoform CRA_a"
FT                   /note="gene_id=mCG134501.2 transcript_id=mCT135888.1
FT                   protein_id=mCP44324.1 isoform=CRA_a"
FT                   /protein_id="EDL24506.1"
FT                   /translation="MTEKEVVESPQPPFPGETPQSGLQRLKQLFKKGSPETAEMEPPPE
FT                   PQANGEAVGAGGGPIYYIYEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDV
FT                   CARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRCFGKIPPGFRRAYSSPLYSDQQYAV
FT                   SAANRNDPVFETLRVGVIMANKERKKGQADKKNPLAAMMEEEPESARPEEGKSQDGNNA
FT                   EKDKKAEKKTPDDKNKQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWW
FT                   RGKIGEKVGFFPPNFIIRVRAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGY
FT                   VKVYTGRKVGLFPTDFLEEI"
FT   gene            9199625..9201806
FT                   /locus_tag="mCG_17019"
FT                   /note="gene_id=mCG17019.2"
FT   mRNA            join(9199625..9199699,9200061..9200149,9200928..9200988,
FT                   9201106..9201806)
FT                   /locus_tag="mCG_17019"
FT                   /product="mCG17019, transcript variant mCT15966"
FT                   /note="gene_id=mCG17019.2 transcript_id=mCT15966.2 created
FT                   on 10-JUN-2003"
FT   mRNA            join(9199627..9199699,9200928..9200988,9201106..9201348)
FT                   /locus_tag="mCG_17019"
FT                   /product="mCG17019, transcript variant mCT185228"
FT                   /note="gene_id=mCG17019.2 transcript_id=mCT185228.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(9199643..9199699,9200061..9200149,9200928..9200988,
FT                   9201106..9201162)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17019"
FT                   /product="mCG17019, isoform CRA_a"
FT                   /note="gene_id=mCG17019.2 transcript_id=mCT15966.2
FT                   protein_id=mCP4464.2 isoform=CRA_a"
FT                   /protein_id="EDL24508.1"
FT                   /translation="MAGTSLGTRFYRQIKRHPGLIPMIGFICLGMGSAGLYLLRLALRS
FT                   PDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF"
FT   CDS             join(9199643..9199699,9200928..9200978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17019"
FT                   /product="mCG17019, isoform CRA_b"
FT                   /note="gene_id=mCG17019.2 transcript_id=mCT185228.0
FT                   protein_id=mCP106486.0 isoform=CRA_b"
FT                   /protein_id="EDL24509.1"
FT                   /translation="MAGTSLGTRFYRQIKRHPGLGQKEQPRALEPPESQ"
FT   gene            complement(9201980..9207090)
FT                   /gene="Shmt2"
FT                   /locus_tag="mCG_17012"
FT                   /note="gene_id=mCG17012.2"
FT   mRNA            complement(join(9201980..9202630,9202688..9202795,
FT                   9202888..9203043,9203134..9203233,9203456..9203621,
FT                   9203785..9203924,9204052..9204174,9204293..9204374,
FT                   9204634..9204834,9205001..9205080,9205581..9205778,
FT                   9206951..9207090))
FT                   /gene="Shmt2"
FT                   /locus_tag="mCG_17012"
FT                   /product="serine hydroxymethyl transferase 2
FT                   (mitochondrial), transcript variant mCT15960"
FT                   /note="gene_id=mCG17012.2 transcript_id=mCT15960.2 created
FT                   on 19-AUG-2002"
FT   mRNA            complement(join(9201980..9202579,9202688..9202795,
FT                   9202888..9203043,9203134..9203233,9203456..9203621,
FT                   9203785..9203924,9204052..9204174,9204293..9204374,
FT                   9204634..9204834,9205001..9205080,9205581..9205778,
FT                   9206951..>9207051))
FT                   /gene="Shmt2"
FT                   /locus_tag="mCG_17012"
FT                   /product="serine hydroxymethyl transferase 2
FT                   (mitochondrial), transcript variant mCT191974"
FT                   /note="gene_id=mCG17012.2 transcript_id=mCT191974.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(9202452..9202579,9202688..9202795,
FT                   9202888..9203043,9203134..9203233,9203456..9203621,
FT                   9203785..9203924,9204052..9204174,9204293..9204374,
FT                   9204634..9204834,9205001..9205080,9205581..9205778,
FT                   9206951..>9207049))
FT                   /codon_start=1
FT                   /gene="Shmt2"
FT                   /locus_tag="mCG_17012"
FT                   /product="serine hydroxymethyl transferase 2
FT                   (mitochondrial), isoform CRA_b"
FT                   /note="gene_id=mCG17012.2 transcript_id=mCT191974.0
FT                   protein_id=mCP112931.0 isoform=CRA_b"
FT                   /protein_id="EDL24511.1"
FT                   /translation="GFRPRYYTDTELVASPPVPPVAMVSFSLLRTTRPLQRCGQLVCMA
FT                   ARAQHSKVAQTQAGEATGGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSR
FT                   AALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPY
FT                   SGSPANLAAYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPQ
FT                   TGLIDYDQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVRAHLLADMAHISGLV
FT                   AAKVIPSPFKYADVVTTTTHKTLRGARSGLIFYRKGVRTVDPKTGKEIPYTFEDRINFA
FT                   VFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLRNAQAMADALLKRGYSLVSGGT
FT                   DTHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQF
FT                   REDDFRRVVDFIDEGVNIGLEVKRKTAKLQDFKSFLLKDPETSQRLANLRQQVEQFARG
FT                   FPMPGFDER"
FT   CDS             complement(join(9202452..9202630,9202688..9202795,
FT                   9202888..9203043,9203134..9203233,9203456..9203621,
FT                   9203785..9203924,9204052..9204174,9204293..9204374,
FT                   9204634..9204834,9205001..9205080,9205581..9205778,
FT                   9206951..9206983))
FT                   /codon_start=1
FT                   /gene="Shmt2"
FT                   /locus_tag="mCG_17012"
FT                   /product="serine hydroxymethyl transferase 2
FT                   (mitochondrial), isoform CRA_a"
FT                   /note="gene_id=mCG17012.2 transcript_id=mCT15960.2
FT                   protein_id=mCP4451.2 isoform=CRA_a"
FT                   /protein_id="EDL24510.1"
FT                   /translation="MVSFSLLRTTRPLQRCGQLVCMAARAQHSKVAQTQAGEATGGWTG
FT                   QESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKR
FT                   YYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANLAAYTALLQPHDRIMG
FT                   LDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPQTGLIDYDQLALTARLFRPRLII
FT                   AGTSAYARLIDYARMREVCDEVRAHLLADMAHISGLVAAKVIPSPFKYADVVTTTTHKT
FT                   LRGARSGLIFYRKGVRTVDPKTGKEIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALK
FT                   QACTPMFREYSLQVLRNAQAMADALLKRGYSLVSGGTDTHLVLVDLRPKGLDGARAERV
FT                   LELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEV
FT                   KRKTAPGPAQQPSDQLLPPISAKLQDFKSFLLKDPETSQRLANLRQQVEQFARGFPMPG
FT                   FDER"
FT   assembly_gap    9208079..9208511
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   gene            complement(9210220..9219305)
FT                   /gene="Nxph4"
FT                   /locus_tag="mCG_17040"
FT                   /note="gene_id=mCG17040.1"
FT   mRNA            complement(join(9210220..9211714,9219122..9219305))
FT                   /gene="Nxph4"
FT                   /locus_tag="mCG_17040"
FT                   /product="neurexophilin 4"
FT                   /note="gene_id=mCG17040.1 transcript_id=mCT15989.1 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(9210857..9211714,9219122..9219178))
FT                   /codon_start=1
FT                   /gene="Nxph4"
FT                   /locus_tag="mCG_17040"
FT                   /product="neurexophilin 4"
FT                   /note="gene_id=mCG17040.1 transcript_id=mCT15989.1
FT                   protein_id=mCP4399.1"
FT                   /db_xref="GOA:G3X9N5"
FT                   /db_xref="InterPro:IPR010450"
FT                   /db_xref="InterPro:IPR026845"
FT                   /db_xref="MGI:MGI:1336197"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9N5"
FT                   /protein_id="EDL24512.1"
FT                   /translation="MRLLPEWLLLLFGPWLLRKAVCGQIVESGRPQYLDLRPAMAGGGA
FT                   RGQQLPAPASSEGLGMARSWSWAWPANHTGALAKPGTAGGPSVPRTKRKPSIKAARAKK
FT                   IFGWGDFYFRVHTLKFSLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEF
FT                   GGVWLPGPASHPLQSTLALEGVLPGLGPPLGMAGQGLGSNLGGALAGPLGSALGVPGAK
FT                   ESRAFNCHVEYEKTNRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIFVSFLS
FT                   FDYKLVQKVCPDYNFQSEHPYFG"
FT   assembly_gap    9212833..9212987
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    9214043..9214860
FT                   /estimated_length=818
FT                   /gap_type="unknown"
FT   assembly_gap    9219368..9219427
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            complement(9222953..9305432)
FT                   /gene="Lrp1"
FT                   /locus_tag="mCG_17035"
FT                   /note="gene_id=mCG17035.1"
FT   mRNA            complement(join(9222953..9223849,9223992..9224136,
FT                   9224231..9224321,9224426..9224490,9224617..9224718,
FT                   9224912..9225086,9225378..9225539,9225709..9225882,
FT                   9225993..9226133,9226399..9226575,9226945..9227061,
FT                   9227327..9227433,9227847..9228025,9229175..9229443,
FT                   9230291..9230410,9230487..9230621,9230756..9230896,
FT                   9231150..9231272,9231597..9231716,9233080..9233212,
FT                   9233303..9233409,9234082..9234198,9234673..9234798,
FT                   9234950..9235072,9235372..9235491,9235704..9235820,
FT                   9236419..9236512,9236911..9237059,9237461..9237649,
FT                   9238117..9238322,9238442..9238629,9239014..9239133,
FT                   9239331..9239416,9239698..9239881,9240404..9240594,
FT                   9240741..9240881,9240960..9241082,9241358..9241486,
FT                   9241634..9241750,9241944..9242066,9242162..9242311,
FT                   9242824..9242937,9243258..9243377,9243553..9243681,
FT                   9243819..9243944,9244690..9244882,9245172..9245376,
FT                   9248321..9248510,9251012..9251389,9251703..9251827,
FT                   9251917..9252068,9252902..9253028,9253138..9253267,
FT                   9253448..9253582,9253833..9253964,9255732..9255866,
FT                   9256213..9256353,9256741..9256890,9257073..9257167,
FT                   9257252..9257426,9257604..9257831,9258296..9258427,
FT                   9258591..9258835,9259278..9259442,9259608..9259812,
FT                   9260764..9260961,9261134..9261379,9262312..9262512,
FT                   9262856..9263038,9266045..9266212,9267704..9267784,
FT                   9268144..9268260,9268637..9268762,9268937..9269077,
FT                   9272384..9272509,9272724..9272925,9273874..9274096,
FT                   9274876..9275056,9276204..9276440,9277651..9277794,
FT                   9278078..9278267,9279247..9279469,9279583..9279745,
FT                   9289696..9289959,9290073..9290201,9292236..9292355,
FT                   9294637..9294774,9296951..9297073,9304919..9305432))
FT                   /gene="Lrp1"
FT                   /locus_tag="mCG_17035"
FT                   /product="low density lipoprotein receptor-related protein
FT                   1"
FT                   /note="gene_id=mCG17035.1 transcript_id=mCT15982.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(9223709..9223849,9223992..9224136,
FT                   9224231..9224321,9224426..9224490,9224617..9224718,
FT                   9224912..9225086,9225378..9225539,9225709..9225882,
FT                   9225993..9226133,9226399..9226575,9226945..9227061,
FT                   9227327..9227433,9227847..9228025,9229175..9229443,
FT                   9230291..9230410,9230487..9230621,9230756..9230896,
FT                   9231150..9231272,9231597..9231716,9233080..9233212,
FT                   9233303..9233409,9234082..9234198,9234673..9234798,
FT                   9234950..9235072,9235372..9235491,9235704..9235820,
FT                   9236419..9236512,9236911..9237059,9237461..9237649,
FT                   9238117..9238322,9238442..9238629,9239014..9239133,
FT                   9239331..9239416,9239698..9239881,9240404..9240594,
FT                   9240741..9240881,9240960..9241082,9241358..9241486,
FT                   9241634..9241750,9241944..9242066,9242162..9242311,
FT                   9242824..9242937,9243258..9243377,9243553..9243681,
FT                   9243819..9243944,9244690..9244882,9245172..9245376,
FT                   9248321..9248510,9251012..9251389,9251703..9251827,
FT                   9251917..9252068,9252902..9253028,9253138..9253267,
FT                   9253448..9253582,9253833..9253964,9255732..9255866,
FT                   9256213..9256353,9256741..9256890,9257073..9257167,
FT                   9257252..9257426,9257604..9257831,9258296..9258427,
FT                   9258591..9258835,9259278..9259442,9259608..9259812,
FT                   9260764..9260961,9261134..9261379,9262312..9262512,
FT                   9262856..9263038,9266045..9266212,9267704..9267784,
FT                   9268144..9268260,9268637..9268762,9268937..9269077,
FT                   9272384..9272509,9272724..9272925,9273874..9274096,
FT                   9274876..9275056,9276204..9276440,9277651..9277794,
FT                   9278078..9278267,9279247..9279469,9279583..9279745,
FT                   9289696..9289959,9290073..9290201,9292236..9292355,
FT                   9294637..9294774,9296951..9297073,9304919..9304988))
FT                   /codon_start=1
FT                   /gene="Lrp1"
FT                   /locus_tag="mCG_17035"
FT                   /product="low density lipoprotein receptor-related protein
FT                   1"
FT                   /note="gene_id=mCG17035.1 transcript_id=mCT15982.1
FT                   protein_id=mCP4441.2"
FT                   /db_xref="GOA:A0A0R4J0I9"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="InterPro:IPR036055"
FT                   /db_xref="MGI:MGI:96828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0I9"
FT                   /protein_id="EDL24513.1"
FT                   /translation="MLTPPLLLLLPLLSALVSGATMDAPKTCSPKQFACRDQITCISKG
FT                   WRCDGERDCPDGSDEAPEICPQSKAQRCPPNEHSCLGTELCVPMSRLCNGIQDCMDGSD
FT                   EGAHCRELRANCSRMGCQHHCVPTPSGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQ
FT                   LCTNTDGSFTCGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVST
FT                   ITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLH
FT                   HVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFF
FT                   TDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEG
FT                   KGRQTIIQGILIEHLYGLTVFENYLYATNSDNANTQQKTSVIRVNRFNSTEYQVVTRVD
FT                   KGGALHIYHQRRQPRVRSHACENDQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDG
FT                   KSCKKPEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYF
FT                   ADTTSYLIGRQKIDGTERETILKDGIHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEK
FT                   AAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFV
FT                   TSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELNHAFGLCHHG
FT                   NYLFWTEYRSGSVYRLERGVAGAPPTVTLLRSERPPIFEIRMYDAQQQQVGTNKCRVNN
FT                   GGCSSLCLATPGSRQCACAEDQVLDTDGVTCLANPSYVPPPQCQPGEFACANNRCIQER
FT                   WKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNSEDESNA
FT                   TCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCNNGR
FT                   CININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDET
FT                   HANCTNQATRPPGGCHSDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHVCDP
FT                   NVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCEALACRPPSHPCANNTSVCLPPDKL
FT                   CDGKDDCGDGSDEGELCDQCSLNNGGCSHNCSVAPGEGIVCSCPLGMELGSDNHTCQIQ
FT                   SYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCRSLDPFKPFIIFSNRHEIRRID
FT                   LHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEVVIQYG
FT                   LATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGIL
FT                   FWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYS
FT                   ARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTN
FT                   TQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRTVSCACPHLMKLHKDNTTC
FT                   YEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQ
FT                   AIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNA
FT                   VVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNHTLLFSGQKGPVGLAIDFPESK
FT                   LYWISSGNHTINRCNLDGSELEVIDTMRSQLGKATALAIMGDKLWWADQVSEKMGTCNK
FT                   ADGSGSVVLRNSTTLVMHMKVYDESIQLEHEGTNPCSVNNGDCSQLCLPTSETTRSCMC
FT                   TAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAE
FT                   NDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEV
FT                   ARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGHYPRIERSRLDGTERVVLVNVS
FT                   ISWPNGISVDYQGGKLYWCDARMDKIERIDLETGENREVVLSSNNMDMFSVSVFEDFIY
FT                   WSDRTHANGSIKRGCKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGGCQQ
FT                   LCLYRGGGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNLNAPVQPF
FT                   EDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIVENVGSVE
FT                   GLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQNL
FT                   MFWTNWNELHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERC
FT                   EYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIPQQ
FT                   PMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQEDFTCRAVNS
FT                   SCRAQDEFECANGECISFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCNNGRCVSN
FT                   MLWCNGVDDCGDGSDEIPCNKTACGVGEFRCRDGSCIGNSSRCNQFVDCEDASDEMNCS
FT                   TTDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLN
FT                   YFACPSGRCIPMSWTCDKEDDCENGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDD
FT                   CGDGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCTDGADESVTAGCLYNST
FT                   CDDREFMCQNRLCIPKHFVCDHDRDCADGSDESPECEYPTCGPNEFRCANGRCLSSRQW
FT                   ECDGENDCHDHSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSD
FT                   ERGCHVNECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADLDECSTTFPCSQ
FT                   LCINTHGSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLK
FT                   QGLNNAVALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWV
FT                   GGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIG
FT                   RIGMDGSGRSIIVDTKITWPNGLTVDYVTERIYWADAREDYIEFASLDGSNRHVVLSQD
FT                   IPHIFALTLFEDYVYWTDWETKSINRAHKTTGANKTLLISTLHRPMDLHVFHALRQPDV
FT                   PNHPCKVNNGGCSNLCLLSPGGGHKCACPTNFYLGGDGRTCVSNCTASQFVCKNDKCIP
FT                   FWWKCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEAN
FT                   CDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRC
FT                   IPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSD
FT                   EPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCAN
FT                   GRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSD
FT                   EEACGTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFICPPNRPFR
FT                   CKNDRVCLWIGRQCDGVDNCGDGTDEEDCEPPTAQNPHCKDKKEFLCRNQRCLSSSLRC
FT                   NMFDDCGDGSDEEDCSIDPKLTSCATNASMCGDEARCVRTEKAAYCACRSGFHTVPGQP
FT                   GCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIR
FT                   SLFPGHPHSAYEQTFQGDESVRIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTS
FT                   NRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLIS
FT                   GMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHN
FT                   ERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKI
FT                   HKFGHSPLINLTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNG
FT                   KRLDNGTCVPVPSPTPPPDAPRPGTCTLQCFNGGSCFLNARRQPKCRCQPRYTGDKCEL
FT                   DQCWEYCHNGGTCAASPSGMPTCRCPTGFTGPKCTAQVCAGYCSNNSTCTVNQGNQPQC
FT                   RCLPGFLGDRCQYRQCSGFCENFGTCQMAADGSRQCRCTVYFEGPRCEVNKCSRCLQGA
FT                   CVVNKQTGDVTCNCTDGRVAPSCLTCIDHCSNGGSCTMNSKMMPECQCPPHMTGPRCEE
FT                   QVVSQQQPGHMASILIPLLLLLLLLLVAGVVFWYKRRVRGAKGFQHQRMTNGAMNVEIG
FT                   NPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATLYMGGHGSRHSLASTDEKR
FT                   ELLGRGPEDEIGDPLA"
FT   assembly_gap    9245126..9245145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9305475..9305717
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    9307959..9308142
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    9320299..9320318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9323127..9323146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9328373..9345673
FT                   /gene="Stat6"
FT                   /locus_tag="mCG_17043"
FT                   /note="gene_id=mCG17043.1"
FT   mRNA            join(9328373..9328456,9332106..9332242,9332900..9333038,
FT                   9333321..9333404,9335958..9336096,9336215..9336267,
FT                   9336419..9336567,9337227..9337358,9337468..9337656,
FT                   9338262..9338349,9338484..9338606,9340203..9340295,
FT                   9340574..9340780,9342195..9342289,9342379..9342515,
FT                   9342827..9342973,9343468..9343531,9343628..9343732,
FT                   9343900..9343971,9344703..9344768,9344859..9344987,
FT                   9345065..9345673)
FT                   /gene="Stat6"
FT                   /locus_tag="mCG_17043"
FT                   /product="signal transducer and activator of transcription
FT                   6"
FT                   /note="gene_id=mCG17043.1 transcript_id=mCT15993.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(9332127..9332242,9332900..9333038,9333321..9333404,
FT                   9335958..9336096,9336215..9336267,9336419..9336567,
FT                   9337227..9337358,9337468..9337656,9338262..9338349,
FT                   9338484..9338606,9340203..9340295,9340574..9340780,
FT                   9342195..9342289,9342379..9342515,9342827..9342973,
FT                   9343468..9343531,9343628..9343732,9343900..9343971,
FT                   9344703..9344768,9344859..9344987,9345065..9345251)
FT                   /codon_start=1
FT                   /gene="Stat6"
FT                   /locus_tag="mCG_17043"
FT                   /product="signal transducer and activator of transcription
FT                   6"
FT                   /note="gene_id=mCG17043.1 transcript_id=mCT15993.1
FT                   protein_id=mCP4472.1"
FT                   /db_xref="GOA:P52633"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001217"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR012345"
FT                   /db_xref="InterPro:IPR013799"
FT                   /db_xref="InterPro:IPR013800"
FT                   /db_xref="InterPro:IPR013801"
FT                   /db_xref="InterPro:IPR015988"
FT                   /db_xref="InterPro:IPR028187"
FT                   /db_xref="InterPro:IPR035857"
FT                   /db_xref="InterPro:IPR036535"
FT                   /db_xref="InterPro:IPR036860"
FT                   /db_xref="MGI:MGI:103034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P52633"
FT                   /protein_id="EDL24514.1"
FT                   /translation="MSLWGLISKMSPEKLQRLYVDFPQRLRHLLADWLESQPWEFLVGS
FT                   DAFCYNMASALLSATVQRLQATAGEQGKGNSILPHISTLESIYQRDPLKLVATIRQILQ
FT                   GEKKAVIEEFRHLPGPFHRKQEELKFTTALGRLQHRVRETRLLRESLQQGAKTGQVSLQ
FT                   NLIDPPVNGPGPSEDLATMLQGTVGDLEATQALVLKRIQIWKRQQQLAGNGTPFEESLA
FT                   GLQERCESLVEIYSQLQQEIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQ
FT                   VLKTQTKFQAGVRFLLGLQFLGTSAKPPMVRADMVTEKQARELSLAQGPGTGVESTGEI
FT                   MNNTVPLENSIPSNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKL
FT                   LIQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLK
FT                   FMAEVGTSRGLLPEHFLFLAQKIFNDNSLSVEAFQHRCVSWSQFNKEILLGRGFTFWQW
FT                   FDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHV
FT                   IRGQDGSSQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMG
FT                   KDGRGYVSTTIKMTVERDQPLPTPEPQMPAMVPPYDLGMAPDASMQLSSDMGYPPQSIH
FT                   SFQSLEESMSVLPSFQEPHLQMPPNMSQITMPFDQPHPQGLLQCQSQEHAVSSPEPMLC
FT                   SDVTMVEDSCLTQPVGGFPQGTWVSEDMYPPLMPPTEQDLTKLLLENQGEAGGSLGSQP
FT                   LLQPSPYGQSGISLSHLDLRTNPSW"
FT   gene            complement(9346189..9351954)
FT                   /gene="Nab2"
FT                   /locus_tag="mCG_17010"
FT                   /note="gene_id=mCG17010.1"
FT   mRNA            complement(join(9346189..9347055,9348007..9348198,
FT                   9348408..9348540,9348626..9348677,9349016..9349149,
FT                   9349541..9350414,9351652..9351954))
FT                   /gene="Nab2"
FT                   /locus_tag="mCG_17010"
FT                   /product="Ngfi-A binding protein 2"
FT                   /note="gene_id=mCG17010.1 transcript_id=mCT15958.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(9346946..9347055,9348007..9348198,
FT                   9348408..9348540,9348626..9348677,9349016..9349149,
FT                   9349541..9350414,9351652..9351734))
FT                   /codon_start=1
FT                   /gene="Nab2"
FT                   /locus_tag="mCG_17010"
FT                   /product="Ngfi-A binding protein 2"
FT                   /note="gene_id=mCG17010.1 transcript_id=mCT15958.1
FT                   protein_id=mCP4429.1"
FT                   /db_xref="GOA:Q61127"
FT                   /db_xref="InterPro:IPR006988"
FT                   /db_xref="InterPro:IPR006989"
FT                   /db_xref="MGI:MGI:107563"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61127"
FT                   /protein_id="EDL24515.1"
FT                   /translation="MHRAPSPTAEQPPGRGDNTRRTPQPRFKASAPAMALPRTLGELQL
FT                   YRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALR
FT                   EWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSP
FT                   LELGEKLSPLPGGPGAGDPRIWPGQSTPESDVGAGGEEEAGSPPFSPPAGGGVSEGPGV
FT                   GGVAAGGAGGGPDRLEPEMVRMVVESVERIFRSFPRGDTGEIASLLKLNKKLARSVGHI
FT                   FEMDDHDAQKEEEIRKYSVIYGRLDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRR
FT                   VELFSLSRQVARESTYLSSLKGSRLHSEELGGPPLKKLKQEVGEQSHNEIQQPPPGPES
FT                   YAPPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQT
FT                   LMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVK
FT                   VEAEASRQ"
FT   gene            <9362354..9382188
FT                   /gene="BC030440"
FT                   /locus_tag="mCG_17021"
FT                   /note="gene_id=mCG17021.2"
FT   mRNA            join(<9362354..9362495,9373498..9373613,9374490..9374709,
FT                   9376126..9376198,9378233..9378326,9378749..9378863,
FT                   9379678..9380413)
FT                   /gene="BC030440"
FT                   /locus_tag="mCG_17021"
FT                   /product="cDNA sequence BC030440, transcript variant
FT                   mCT191978"
FT                   /note="gene_id=mCG17021.2 transcript_id=mCT191978.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9362354..9362495,9373498..9373613,9374490..9374709,
FT                   9376126..9376198,9378233..9378326,9378749..9378863,
FT                   9379678..9379907)
FT                   /codon_start=1
FT                   /gene="BC030440"
FT                   /locus_tag="mCG_17021"
FT                   /product="cDNA sequence BC030440, isoform CRA_b"
FT                   /note="gene_id=mCG17021.2 transcript_id=mCT191978.0
FT                   protein_id=mCP112933.0 isoform=CRA_b"
FT                   /protein_id="EDL24517.1"
FT                   /translation="CEASMAGGIKVSVWSAVGPGPRCWGAGGGGGATWLLLVVAGCVVC
FT                   GSADVNVVMLQESQVDMNSSQQFCYKNVLIPKWHDIWTRIQVRVNSSKLVRVTQVDNEE
FT                   KLKELEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCLKVEMIEKDTTYSVTVTRRFDP
FT                   KLFLVFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVI
FT                   LVGGWSFSLYLIQLVFKNLQEIWRSYWHYLLSYILTVGFMSFAVCYKYGPLENERSINL
FT                   LTWTLQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYR"
FT   mRNA            join(9362358..9362495,9373498..9373613,9374490..9374709,
FT                   9376126..9376198,9378233..9378326,9378749..9378863,
FT                   9379678..9379903,9380618..9380791,9381477..9382188)
FT                   /gene="BC030440"
FT                   /locus_tag="mCG_17021"
FT                   /product="cDNA sequence BC030440, transcript variant
FT                   mCT15968"
FT                   /note="gene_id=mCG17021.2 transcript_id=mCT15968.2 created
FT                   on 20-AUG-2002"
FT   CDS             join(9362366..9362495,9373498..9373613,9374490..9374709,
FT                   9376126..9376198,9378233..9378326,9378749..9378863,
FT                   9379678..9379903,9380618..9380791,9381477..9381642)
FT                   /codon_start=1
FT                   /gene="BC030440"
FT                   /locus_tag="mCG_17021"
FT                   /product="cDNA sequence BC030440, isoform CRA_a"
FT                   /note="gene_id=mCG17021.2 transcript_id=mCT15968.2
FT                   protein_id=mCP4466.2 isoform=CRA_a"
FT                   /protein_id="EDL24516.1"
FT                   /translation="MAGGIKVSVWSAVGPGPRCWGAGGGGGATWLLLVVAGCVVCGSAD
FT                   VNVVMLQESQVDMNSSQQFCYKNVLIPKWHDIWTRIQVRVNSSKLVRVTQVDNEEKLKE
FT                   LEQFSIWNFFSSFLKEKLNDTYVNVGLYSTKTCLKVEMIEKDTTYSVTVTRRFDPKLFL
FT                   VFLLGLTLFFCGDLLSRSQIFYYSTGMSVGIVASLLIVIFMISKFMPKRSPIYVILVGG
FT                   WSFSLYLIQLVFKNLQEIWRSYWHYLLSYILTVGFMSFAVCYKYGPLENERSINLLTWT
FT                   LQLLGLGLMYSSIQIPHVAFALIVIALCTKNLEYPIHWLCSTYRRMCKASGKPVPPRLL
FT                   TEEEYRIQGEVETQKALQELREFCNSPECSAWKTISRIQSPKRFADFVEGSFHLTPNEV
FT                   SVHEQEYGLGSIFTQDEELSSEEEGSEYPTFTQNNFLT"
FT   assembly_gap    9379038..9379131
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    9388400..9388419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9388495..9408418
FT                   /locus_tag="mCG_17044"
FT                   /note="gene_id=mCG17044.1"
FT   mRNA            join(<9388495..9388598,9393567..9393671,9393874..9393920,
FT                   9394113..9394176,9394873..9394971,9397401..9397504,
FT                   9397625..9397772,9398129..9398247,9398335..9398421,
FT                   9399835..9399900,9400014..9400118,9400974..9401036,
FT                   9401238..9401438,9401579..9401805,9402134..9402334,
FT                   9402503..9402596,9402885..9403034,9403130..9403198,
FT                   9403541..9403615,9405991..9406125,9406727..9406833,
FT                   9407109..9407241,9407344..9407496,9407629..9407756,
FT                   9408069..9408418)
FT                   /locus_tag="mCG_17044"
FT                   /product="mCG17044"
FT                   /note="gene_id=mCG17044.1 transcript_id=mCT15994.2 created
FT                   on 20-AUG-2002"
FT   CDS             join(<9388496..9388598,9393567..9393671,9393874..9393920,
FT                   9394113..9394176,9394873..9394971,9397401..9397504,
FT                   9397625..9397772,9398129..9398247,9398335..9398421,
FT                   9399835..9399900,9400014..9400118,9400974..9401036,
FT                   9401238..9401438,9401579..9401805,9402134..9402334,
FT                   9402503..9402596,9402885..9403034,9403130..9403198,
FT                   9403541..9403615,9405991..9406125,9406727..9406833,
FT                   9407109..9407241,9407344..9407496,9407629..9407756,
FT                   9408069..9408195)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17044"
FT                   /product="mCG17044"
FT                   /note="gene_id=mCG17044.1 transcript_id=mCT15994.2
FT                   protein_id=mCP4434.2"
FT                   /protein_id="EDL24518.1"
FT                   /translation="PTSYALANVAYQSLKDRDRDQCILITGESGAGKTEASKLVMSYVA
FT                   AVCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVI
FT                   TNYLLEKSRVVKQLKGERNFHIFYQLLAGADAQLLKALKLEEDTSVYGYLNGEVSKVNG
FT                   MDDASNFRAVQHAMSVIGFSEEEIRQVLEVTALVLKLGNVKLTDEFQANGIPASGICDG
FT                   KGIQEIGEMMGLNSTELERALCSRTMETGKEKVVTVLNVTQAQYARDALAKNIYSRLFD
FT                   WIVKRINESIKVGTGEKKKVMGVLDIYGFEILEDNSFEQFVINYCNERLQQVFIELTLK
FT                   EEQEEYKREGIPWTKVEYFDNGIICNLIEHSQRGILAMLDEECLRPGVVSDSTFLAKLN
FT                   QLFSKHSHYESKVSQNAQRQYDRTMGLSCFRISHYAGKVTYNVTGFIDKNNDLLFRDLS
FT                   QTMWKAQHPLLKSLFPEGNPKEASLKRPPTAGTQFKNSVAVLMKNLYSKNPNYIRCIKP
FT                   NDQQQKGRFTSEMVMVQARYLGLLENVRVRRAGYAFRQGYKPFLERYRLLSRSTWPRWN
FT                   GDDREGVEKVLGSLTLSSEELAYGKTKIFIRSPKTLFYLEEQRRLRLQQLATLIQKVYR
FT                   GWRCRTHYQQMRKSQILISAWFRGNKQKKHYGKIRSSVLLIQAFVRGWRARKNYRKYFR
FT                   SGAALTLANFIYQSMAQKFLLNLKKNLPSTKVLDNTWPAAPYRCFNTANQELQRLFYQW
FT                   KCKKFRDQLSPKQVQTLREKLCASELFKGKKASYPQSVPIPFRGDYIGLQGNPKLQRLK
FT                   GREEGPVLVADTVKKVNRGNGKTSARILLLTKGHVILTDAKKSQAQIVIGLEDVAGVSV
FT                   SSLQDGLFSLHLSEMSSAVSKGDILLVSDHVVELLTKMYQAVLDATQRQLSVTVTEKFS
FT                   VRFKEGSVAVKVIQGPEGGGNRKLICKKKGSNAMEVTVR"
FT   assembly_gap    9389453..9389472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9390553..9393088
FT                   /estimated_length=2536
FT                   /gap_type="unknown"
FT   assembly_gap    9394369..9394530
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    9403671..9404250
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   gene            9411955..9419243
FT                   /gene="Tac2"
FT                   /locus_tag="mCG_17015"
FT                   /note="gene_id=mCG17015.1"
FT   mRNA            join(9411955..9412157,9412913..9412955,9413501..9413623,
FT                   9415647..9415752,9415923..9415952,9416590..9416643,
FT                   9416952..9417025,9419025..9419243)
FT                   /gene="Tac2"
FT                   /locus_tag="mCG_17015"
FT                   /product="tachykinin 2, transcript variant mCT15962"
FT                   /note="gene_id=mCG17015.1 transcript_id=mCT15962.1 created
FT                   on 07-AUG-2002"
FT   mRNA            join(<9412880..9412955,9413501..9413623,9415647..9415752,
FT                   9415923..9415952,9416590..9416643,9416952..9417025,
FT                   9419025..9419243)
FT                   /gene="Tac2"
FT                   /locus_tag="mCG_17015"
FT                   /product="tachykinin 2, transcript variant mCT191980"
FT                   /note="gene_id=mCG17015.1 transcript_id=mCT191980.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9412881..9412955,9413501..9413623,9415647..9415752,
FT                   9415923..9415952,9416590..9416643,9416952..9417007)
FT                   /codon_start=1
FT                   /gene="Tac2"
FT                   /locus_tag="mCG_17015"
FT                   /product="tachykinin 2, isoform CRA_a"
FT                   /note="gene_id=mCG17015.1 transcript_id=mCT191980.0
FT                   protein_id=mCP112932.0 isoform=CRA_a"
FT                   /protein_id="EDL24519.1"
FT                   /translation="PLHSCLCLCSSISQLPDPVSYPAPQLCPSGTMRSAMLFAAVLALS
FT                   LAWTFGAVCEEPQGQGGRLSKDSDLYQLPPSLLRRLYDSRPVSLEGLLKVLSKASVGPK
FT                   ETSLPQKRDMHDFFVGLMGKRNSQPDTPTDVVEENTPSFGILK"
FT   CDS             join(9413519..9413623,9415647..9415752,9415923..9415952,
FT                   9416590..9416643,9416952..9417007)
FT                   /codon_start=1
FT                   /gene="Tac2"
FT                   /locus_tag="mCG_17015"
FT                   /product="tachykinin 2, isoform CRA_b"
FT                   /note="gene_id=mCG17015.1 transcript_id=mCT15962.1
FT                   protein_id=mCP4456.1 isoform=CRA_b"
FT                   /protein_id="EDL24520.1"
FT                   /translation="MRSAMLFAAVLALSLAWTFGAVCEEPQGQGGRLSKDSDLYQLPPS
FT                   LLRRLYDSRPVSLEGLLKVLSKASVGPKETSLPQKRDMHDFFVGLMGKRNSQPDTPTDV
FT                   VEENTPSFGILK"
FT   assembly_gap    9426941..9427056
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            9427135..>9431207
FT                   /gene="Zbtb39"
FT                   /locus_tag="mCG_52114"
FT                   /note="gene_id=mCG52114.1"
FT   mRNA            join(9427135..9427172,9429025..>9431207)
FT                   /gene="Zbtb39"
FT                   /locus_tag="mCG_52114"
FT                   /product="zinc finger and BTB domain containing 39"
FT                   /note="gene_id=mCG52114.1 transcript_id=mCT52297.1 created
FT                   on 20-AUG-2002"
FT   CDS             9429069..9431207
FT                   /codon_start=1
FT                   /gene="Zbtb39"
FT                   /locus_tag="mCG_52114"
FT                   /product="zinc finger and BTB domain containing 39"
FT                   /note="gene_id=mCG52114.1 transcript_id=mCT52297.1
FT                   protein_id=mCP27455.2"
FT                   /protein_id="EDL24521.1"
FT                   /translation="MGMRIKLQSSNHPNNLLKELNKCRLSETMCDVTIVVGSRSFPAHK
FT                   AVLACAAGYFQNLFLNTGLDAARTYVVDFITPANFEKILSFVYTSELFTDLINVGVIYE
FT                   VAERLGMEDLLRACHSTFPDLESTAIAKSLTSTSDSQCVTLSCPSVDPTHPLGESRGSG
FT                   EHFGPDRNYVLPTDAGGSYKEEERSVSGDTNHGLPLPQLPLPPKSEDHDTPVPFTSVPS
FT                   VATPPPVLGTVSTGIQTSTSSCQPYKVQSNGDFSKSTFFASDNAVDITTQTNSCLSNSD
FT                   HSRDPSFGQMDELQLDDLGDEDLQFEDPAEDIGTAEEVIELSDDSEDDLAFGDSDNREN
FT                   KAMPCQVCKKVLEPNIQLIRQHARDHVDLLTGNCKVCETHFQDRNSRVTHVLSHIGIFL
FT                   FSCDMCETKFFTQWQLTLHRRDGIFDNNVIVHPSEPLSGKLGLFPGAASPELKCAVCGK
FT                   ALAKDFHVVRCHILEHVNLKGQACSICDQRHLNLCSLMWHMLSHLGISVFSCSVCASSF
FT                   VDWHLLEKHMVVHQGLEDVLFRCHLCSQSFRSEAAYRYHVSQHKCSSGLDARPALGLPH
FT                   LALQKRKLPAEEFLSEELALQGQPGNSKYSCKVCGKRFAHTSEFNYHRRIHTGEKPYQC
FT                   KVCHKFFRGRSTIKCHLKTHSGALMYRCTVCGHYSSTLNLMSKHVGVHKGSLPPDFTIE
FT                   QTFMYIIHSKEAEKNPDS"
FT   gene            complement(9437129..9439200)
FT                   /gene="Admr"
FT                   /locus_tag="mCG_17017"
FT                   /note="gene_id=mCG17017.0"
FT   mRNA            complement(join(9437129..9438603,9439107..9439200))
FT                   /gene="Admr"
FT                   /locus_tag="mCG_17017"
FT                   /product="adrenomedullin receptor"
FT                   /note="gene_id=mCG17017.0 transcript_id=mCT15964.0 created
FT                   on 07-AUG-2002"
FT   CDS             complement(9437391..9438587)
FT                   /codon_start=1
FT                   /gene="Admr"
FT                   /locus_tag="mCG_17017"
FT                   /product="adrenomedullin receptor"
FT                   /note="gene_id=mCG17017.0 transcript_id=mCT15964.0
FT                   protein_id=mCP4367.1"
FT                   /db_xref="GOA:G3X9R9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001350"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109545"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9R9"
FT                   /protein_id="EDL24522.1"
FT                   /translation="MSVIPSPRPVSTLEPDNDFRDIHNWTELLHLFNQTFTDCHIEFNE
FT                   NTKHVVLFVFYLAIFVVGLVENVLVICVNCRRSGRVGMLNLYILNMAIADLGIILSLPV
FT                   WMLEVMLEYTWLWGSFSCRFIHYFYLVNMYSSIFFLTCLSIDRYVTLTNTSPSWQRHQH
FT                   RIRRAVCAGVWVLSAIIPLPEVVHIQLLDGSEPMCLFLAPFETYSAWALAVALSATILG
FT                   FLLPFLLIAVFNILTACRLRRQRQTESRRHCLLMWAYIVVFAICWLPYQVTMLLLTLHG
FT                   THIFLHCHLVNLLYFFYEIIDCFSMLHCVANPILYNFLSPSFRGRLLSLVVRYLPKEQA
FT                   RAAGGRASSSSSTQHSIIITKEGSLPAAADLHTHPIRNVQASSPPPNTSPTLCNSVAS"
FT   gene            9447330..9455808
FT                   /locus_tag="mCG_140848"
FT                   /note="gene_id=mCG140848.0"
FT   mRNA            join(9447330..9447770,9450469..9450727,9452186..9452349,
FT                   9452830..9455808)
FT                   /locus_tag="mCG_140848"
FT                   /product="mCG140848"
FT                   /note="gene_id=mCG140848.0 transcript_id=mCT171794.0
FT                   created on 07-AUG-2002"
FT   CDS             join(9447458..9447770,9450469..9450727,9452186..9452349,
FT                   9452830..9453047)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140848"
FT                   /product="mCG140848"
FT                   /note="gene_id=mCG140848.0 transcript_id=mCT171794.0
FT                   protein_id=mCP94713.0"
FT                   /db_xref="GOA:Q8CGV4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:1195275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CGV4"
FT                   /protein_id="EDL24523.1"
FT                   /translation="MWLYLVALVGLWTLLRFFRERQVVSHLQDKYVFITGCDSGFGNLL
FT                   ARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGNR
FT                   GLWGLVNNAGISTPSGPNEWMKKQDFARVLDVNLLGMIEVTLSMLPLVRKARGRVVNVS
FT                   SVMGRMSFFGGGYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGGFKTCVTSSDRLSSN
FT                   TKMIWDKASSEVKEIYGEKFLLFYLKNLNELDKRCNKDLSVVTDCMEHALTACHPRTRY
FT                   SAGWDAKFLFLPLSYLPTFLVDALLYWTSMKPEKAL"
FT   gene            <9463998..>9478551
FT                   /locus_tag="mCG_140849"
FT                   /note="gene_id=mCG140849.0"
FT   mRNA            join(<9463998..9464310,9476126..9476384,9477707..9477870,
FT                   9478334..>9478551)
FT                   /locus_tag="mCG_140849"
FT                   /product="mCG140849"
FT                   /note="gene_id=mCG140849.0 transcript_id=mCT171793.0
FT                   created on 07-AUG-2002"
FT   CDS             join(9463998..9464310,9476126..9476384,9477707..9477870,
FT                   9478334..9478551)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140849"
FT                   /product="mCG140849"
FT                   /note="gene_id=mCG140849.0 transcript_id=mCT171793.0
FT                   protein_id=mCP94712.0"
FT                   /db_xref="GOA:Q8K5C8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:2143528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K5C8"
FT                   /protein_id="EDL24524.1"
FT                   /translation="MWLFLVALVGLWTLLCFFRERQVVSYLQDKYVFITGCDSGFGNLL
FT                   ARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVTATQWVKERVGNR
FT                   GLWGLVNNAGISIPSGPNEWMKKQDFAHVLDVNLLGLIEVTLSMLPLVRKARGRVINVA
FT                   SVLGRVSLCGGAYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGVTSSARLCSN
FT                   TQMLWDQTSSEIREIYGEKYLASYLKRLNELDKRCNKDLSLVTDCMEHALTACHPRTRY
FT                   SAGWDAKLFYLPLSYLPTFLVDALLYWTSLKPEKAL"
FT   gene            9488683..9503371
FT                   /locus_tag="mCG_17020"
FT                   /note="gene_id=mCG17020.1"
FT   mRNA            join(9488683..9489039,9498593..9498851,9500317..9500480,
FT                   9500944..9503371)
FT                   /locus_tag="mCG_17020"
FT                   /product="mCG17020"
FT                   /note="gene_id=mCG17020.1 transcript_id=mCT15967.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(9488727..9489039,9498593..9498851,9500317..9500480,
FT                   9500944..9501161)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17020"
FT                   /product="mCG17020"
FT                   /note="gene_id=mCG17020.1 transcript_id=mCT15967.1
FT                   protein_id=mCP4403.1"
FT                   /db_xref="GOA:O54909"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:1201375"
FT                   /db_xref="UniProtKB/TrEMBL:O54909"
FT                   /protein_id="EDL24525.1"
FT                   /translation="MWLYLVALVGLWTLLRFFRVRQVVSHLQDKYVFITGCDSGFGTLL
FT                   ARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVTATQWVKEHVGNR
FT                   GLWGLVNNAGISTPSGPNEWMKKQDFAHVLDVNLLGMIEVTLSMLPLVRKARGRVVNVS
FT                   SVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGVTSSARLCSN
FT                   TQMLWDQTSSEIREIYGEKYLASYLKRLNKLDKRCNKDLSGVTDCMEHALTACHPRTRY
FT                   SAGWDAKLFYLPLSYLPTFLVDALLYWTSLKPEKAL"
FT   gene            9511730..9531506
FT                   /locus_tag="mCG_17030"
FT                   /note="gene_id=mCG17030.2"
FT   mRNA            join(9511730..9512129,9529239..9529497,9530641..9530803,
FT                   9531250..9531506)
FT                   /locus_tag="mCG_17030"
FT                   /product="mCG17030"
FT                   /note="gene_id=mCG17030.2 transcript_id=mCT15977.2 created
FT                   on 20-AUG-2002"
FT   CDS             join(9511817..9512129,9529239..9529429)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17030"
FT                   /product="mCG17030"
FT                   /note="gene_id=mCG17030.2 transcript_id=mCT15977.2
FT                   protein_id=mCP4384.2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:2687008"
FT                   /db_xref="UniProtKB/TrEMBL:V9H0I4"
FT                   /protein_id="EDL24526.1"
FT                   /translation="MWLYLVALVGLWTLLCFFRERQVVSHLQDKYVFITGCDSGFGNLL
FT                   ARQLDRRGMRVLAACLTEKGAEQLRNKTSDRLETVILDVTKTESIVAATQWVKERVGNR
FT                   GLWGLVNNTGISVPSGPSQWMDKQNFASILDVNLLGMIEVTLSMLPLVRKARGRVVNVS
FT                   SIVG"
FT   gene            9537537..>9547878
FT                   /locus_tag="mCG_134493"
FT                   /note="gene_id=mCG134493.0"
FT   mRNA            join(9537537..9537875,9544317..9544578,9547035..9547198,
FT                   9547661..>9547878)
FT                   /locus_tag="mCG_134493"
FT                   /product="mCG134493"
FT                   /note="gene_id=mCG134493.0 transcript_id=mCT135879.0
FT                   created on 20-AUG-2002"
FT   CDS             join(9537563..9537875,9544317..9544578,9547035..9547198,
FT                   9547661..9547878)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134493"
FT                   /product="mCG134493"
FT                   /note="gene_id=mCG134493.0 transcript_id=mCT135879.0
FT                   protein_id=mCP44433.1"
FT                   /db_xref="GOA:G5E8H9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:2678390"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8H9"
FT                   /protein_id="EDL24527.1"
FT                   /translation="MWLYLVSLVGLWTLLRFFRERQVVSHLQDKYVFITGCDSGFGNLL
FT                   ARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGNR
FT                   GLWGLVNNAGISVPLGLSQWMNKQNFASVLDVNLLGMIEVTLTMLPLVRKARGRVVNVS
FT                   SIMGRVSLHGNGGYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGMASSARLSS
FT                   NTQMLWDQTSSEIREIYGEKYLAFYLKSLNELDKRCNKDLSLVTDCMEHALTACHPRTR
FT                   YSAGWDAKLFFIPLSYLPTFLVDAVFYWTSMKPEKAL"
FT   gene            <9554063..9564882
FT                   /locus_tag="mCG_134494"
FT                   /note="gene_id=mCG134494.2"
FT   mRNA            join(<9554063..9554426,9562390..9562651,9563812..9563975,
FT                   9564435..9564878)
FT                   /locus_tag="mCG_134494"
FT                   /product="mCG134494, transcript variant mCT191961"
FT                   /note="gene_id=mCG134494.2 transcript_id=mCT191961.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9554063..9554426,9562390..9562651,9563812..9563975,
FT                   9564435..9564652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134494"
FT                   /product="mCG134494, isoform CRA_b"
FT                   /note="gene_id=mCG134494.2 transcript_id=mCT191961.0
FT                   protein_id=mCP112924.0 isoform=CRA_b"
FT                   /protein_id="EDL24529.1"
FT                   /translation="LSLSLSLSLSLSPLLQTMWLYMVALLGLWMLLRFFRERQVVDHLQ
FT                   DKYVFITGCGSGFGNLLARQLDRRGMRVLAACRKEEGAEELRRKTSERLETVILDVTKT
FT                   ENIVAATQWVKERVGNRGLWGLVNNAGISVPSGPNEWMKKQDFASVLDVNLLGLIEVTL
FT                   SMLPLVRKARGRVVNVSSILGRVSLGGSGGYCISKYGIEAFSDSLRRELRYFGVKVAII
FT                   EPGFFLTGMASSARLCSNIQMLWDQTSSEIREIYGEKYLASYLKNLNELDQRCNKDLSV
FT                   VTDCMEHALTACHPRTRYSAGWDAKLFFTPLSYLPTFLVDALLYWTSPKPDKAL"
FT   mRNA            join(9554071..9554426,9562390..9562651,9563812..9563975,
FT                   9564435..9564502,9564707..9564882)
FT                   /locus_tag="mCG_134494"
FT                   /product="mCG134494, transcript variant mCT135880"
FT                   /note="gene_id=mCG134494.2 transcript_id=mCT135880.1
FT                   created on 20-AUG-2002"
FT   CDS             join(9554114..9554426,9562390..9562651,9563812..9563975,
FT                   9564435..9564502,9564707..9564829)
FT                   /codon_start=1
FT                   /locus_tag="mCG_134494"
FT                   /product="mCG134494, isoform CRA_a"
FT                   /note="gene_id=mCG134494.2 transcript_id=mCT135880.1
FT                   protein_id=mCP44436.1 isoform=CRA_a"
FT                   /protein_id="EDL24528.1"
FT                   /translation="MWLYMVALLGLWMLLRFFRERQVVDHLQDKYVFITGCGSGFGNLL
FT                   ARQLDRRGMRVLAACRKEEGAEELRRKTSERLETVILDVTKTENIVAATQWVKERVGNR
FT                   GLWGLVNNAGISVPSGPNEWMKKQDFASVLDVNLLGLIEVTLSMLPLVRKARGRVVNVS
FT                   SILGRVSLGGSGGYCISKYGIEAFSDSLRRELRYFGVKVAIIEPGFFLTGMASSARLCS
FT                   NIQMLWDQTSSEIREIYGEKYLASYLKNLNELDQRCNKDLSVVTDCMSLRRRKIPVLSP
FT                   HVLCIGAWLFLPLYNMGDMGPQESAMLK"
FT   gene            complement(9571598..9576246)
FT                   /locus_tag="mCG_17033"
FT                   /note="gene_id=mCG17033.1"
FT   mRNA            complement(join(9571598..9572330,9573219..9573382,
FT                   9574963..9575218,9575848..9576246))
FT                   /locus_tag="mCG_17033"
FT                   /product="mCG17033"
FT                   /note="gene_id=mCG17033.1 transcript_id=mCT15980.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(9572113..9572330,9573219..9573382,
FT                   9574963..9575218,9575848..9576160))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17033"
FT                   /product="mCG17033"
FT                   /note="gene_id=mCG17033.1 transcript_id=mCT15980.1
FT                   protein_id=mCP4375.2"
FT                   /protein_id="EDL24530.1"
FT                   /translation="MWLYLVALVGLWTLLRFFRERQVVSHLQDKYVFITGCDSGFGNLL
FT                   ARQLDRRGMRVLAACLTEKGAEQLRNKTSDRLETVILDVTKTESIVAATQWVKERVGNR
FT                   GLWGLVNNAGICVFAINEWLKKEDFANILDVNLLGMIEVTLSMLPLVRKARGRVVNISS
FT                   SMGRVSLCGGGYCISKYGVEAFSDSLRREISYFGVKVAIIEPGGFRTNVSNYERLSHSI
FT                   EKLWDQTSSEVKEVYDKNFLDSYIKAIQSLTDTCSDDLSVVTDCMEHALTACHPRTRYS
FT                   AGWDAKLFYLPLSYMPTFLVDAMLYWSSVKPAQAL"
FT   assembly_gap    9572700..9572840
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            9585822..9599110
FT                   /gene="Sdro"
FT                   /locus_tag="mCG_17011"
FT                   /note="gene_id=mCG17011.1"
FT   mRNA            join(9585822..9586493,9589709..9589967,9591346..9591509,
FT                   9597801..9599110)
FT                   /gene="Sdro"
FT                   /locus_tag="mCG_17011"
FT                   /product="orphan short chain dehydrogenase/reductase"
FT                   /note="gene_id=mCG17011.1 transcript_id=mCT15959.1 created
FT                   on 20-AUG-2002"
FT   CDS             join(9586193..9586493,9589709..9589967,9591346..9591509,
FT                   9597801..9597985)
FT                   /codon_start=1
FT                   /gene="Sdro"
FT                   /locus_tag="mCG_17011"
FT                   /product="orphan short chain dehydrogenase/reductase"
FT                   /note="gene_id=mCG17011.1 transcript_id=mCT15959.1
FT                   protein_id=mCP4447.2"
FT                   /protein_id="EDL24531.1"
FT                   /translation="MAALTDFAFMYRWFKNCNLVKNLSEKYVFITGCDSGFGNLLAKQL
FT                   VDRGMKVLAACLTEEGAQKLLQDTSHQLQTFLLDVTKSENVKEAAQWVRDQVGEQGLWA
FT                   LVNNAGVGLPSGPNEWLTIKDFVKVININLVGLIDVTLNMLPMIKKARGRVVNMSSSGG
FT                   RVAIFGGGYCVSKFGVEAFSDSIRRELHFFGVKVSIIEPGNYKTSILGQEALESRMKKL
FT                   WDRLPQETRDSYGEEYFQTSEPRISDVTNSMEHAIVSRSPRIRYNPGLDVKFLYLTLAK
FT                   LPTPVTDFILSRYLPRPADSV"
FT   assembly_gap    9590379..9591173
FT                   /estimated_length=795
FT                   /gap_type="unknown"
FT   assembly_gap    9594777..9595803
FT                   /estimated_length=1027
FT                   /gap_type="unknown"
FT   assembly_gap    9597066..9597763
FT                   /estimated_length=698
FT                   /gap_type="unknown"
FT   assembly_gap    9615936..9616111
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    9620311..9620540
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    9630969..9631060
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    9634697..9634759
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    9641462..9641524
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    9650376..9650395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9659534..9659842
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    9670049..9670134
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            complement(9679565..9695707)
FT                   /gene="Hsd17b9"
FT                   /locus_tag="mCG_17029"
FT                   /note="gene_id=mCG17029.2"
FT   mRNA            complement(join(9679565..9680092,9682223..9682386,
FT                   9682956..9683214,9686325..9686651,9695564..>9695627))
FT                   /gene="Hsd17b9"
FT                   /locus_tag="mCG_17029"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 9,
FT                   transcript variant mCT191992"
FT                   /note="gene_id=mCG17029.2 transcript_id=mCT191992.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(9679578..9680092,9682223..9682386,
FT                   9682956..9683214,9686325..9686651,9695602..9695707))
FT                   /gene="Hsd17b9"
FT                   /locus_tag="mCG_17029"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 9,
FT                   transcript variant mCT15976"
FT                   /note="gene_id=mCG17029.2 transcript_id=mCT15976.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(9679875..9680092,9682223..9682386,
FT                   9682956..9683214,9686325..>9686649))
FT                   /codon_start=1
FT                   /gene="Hsd17b9"
FT                   /locus_tag="mCG_17029"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17029.2 transcript_id=mCT191992.0
FT                   protein_id=mCP112935.0 isoform=CRA_b"
FT                   /protein_id="EDL24533.1"
FT                   /translation="HFFIMWFYLVTLVGLYHLLRWYRERQVVSHLQDKYVFITGCDSGF
FT                   GNLLARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKER
FT                   VGDRGLWGLVNNAGVLQPFAYIEWYRPEDYMPIFQVNLIGLTQVTISMLFLVKKARGRI
FT                   VNVSSALGRVALFGGFYSCSKYGVEAFSDVLRHEVQDFGVKVSIIEPGSFKTEMTDAEL
FT                   TIERTKKVWEAAPEHIKESYGQQFFDDFCSTTKRELMKCSRNLSLVTDCMEHALTSTHP
FT                   RTRYSAGWDAKFFFIPLSYLPASLVDYLLAISRGKPAQAA"
FT   CDS             complement(join(9679875..9680092,9682223..9682386,
FT                   9682956..9683214,9686325..9686637))
FT                   /codon_start=1
FT                   /gene="Hsd17b9"
FT                   /locus_tag="mCG_17029"
FT                   /product="hydroxysteroid (17-beta) dehydrogenase 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17029.2 transcript_id=mCT15976.1
FT                   protein_id=mCP4478.2 isoform=CRA_a"
FT                   /protein_id="EDL24532.1"
FT                   /translation="MWFYLVTLVGLYHLLRWYRERQVVSHLQDKYVFITGCDSGFGNLL
FT                   ARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGDR
FT                   GLWGLVNNAGVLQPFAYIEWYRPEDYMPIFQVNLIGLTQVTISMLFLVKKARGRIVNVS
FT                   SALGRVALFGGFYSCSKYGVEAFSDVLRHEVQDFGVKVSIIEPGSFKTEMTDAELTIER
FT                   TKKVWEAAPEHIKESYGQQFFDDFCSTTKRELMKCSRNLSLVTDCMEHALTSTHPRTRY
FT                   SAGWDAKFFFIPLSYLPASLVDYLLAISRGKPAQAA"
FT   assembly_gap    9689238..9689463
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    9692596..9692615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9699857..9700322
FT                   /locus_tag="mCG_49049"
FT                   /note="gene_id=mCG49049.1"
FT   mRNA            9699857..9700322
FT                   /locus_tag="mCG_49049"
FT                   /product="mCG49049"
FT                   /note="gene_id=mCG49049.1 transcript_id=mCT49232.1 created
FT                   on 20-AUG-2002"
FT   CDS             9699891..9700247
FT                   /codon_start=1
FT                   /locus_tag="mCG_49049"
FT                   /product="mCG49049"
FT                   /note="gene_id=mCG49049.1 transcript_id=mCT49232.1
FT                   protein_id=mCP27417.0"
FT                   /protein_id="EDL24534.1"
FT                   /translation="MSLLNKSKSEMTPEELQKRAEEEFNTGPLSVLTQSVKNNTQVLIN
FT                   CRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGD
FT                   LVIVVLRNPLIAGK"
FT   gene            9703331..9718053
FT                   /gene="Prim1"
FT                   /locus_tag="mCG_17018"
FT                   /note="gene_id=mCG17018.1"
FT   mRNA            join(9703331..9703467,9704080..9704237,9705997..9706103,
FT                   9706169..9706242,9708151..9708287,9709694..9709752,
FT                   9710884..9710987,9711598..9711695,9711802..9711940,
FT                   9714541..9714610,9715076..9715161,9717209..9717307,
FT                   9717789..9718053)
FT                   /gene="Prim1"
FT                   /locus_tag="mCG_17018"
FT                   /product="DNA primase, p49 subunit"
FT                   /note="gene_id=mCG17018.1 transcript_id=mCT15965.0 created
FT                   on 07-AUG-2002"
FT   CDS             join(9703365..9703467,9704080..9704237,9705997..9706103,
FT                   9706169..9706242,9708151..9708287,9709694..9709752,
FT                   9710884..9710987,9711598..9711695,9711802..9711940,
FT                   9714541..9714610,9715076..9715161,9717209..9717307,
FT                   9717789..9717808)
FT                   /codon_start=1
FT                   /gene="Prim1"
FT                   /locus_tag="mCG_17018"
FT                   /product="DNA primase, p49 subunit"
FT                   /note="gene_id=mCG17018.1 transcript_id=mCT15965.0
FT                   protein_id=mCP4382.1"
FT                   /protein_id="EDL24535.1"
FT                   /translation="MEPFDPAELPELLKLYYRRLFPYAQYYRWLNYGGVTKNYFQHREF
FT                   SFTLKDDIYIRYQSFNNQSELEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEK
FT                   ELVFDIDMTDYDDVRRCCSSADICSKCWTLMTMAMRIIDRALKEDFGFKHRLWVYSGRR
FT                   GVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLNEKVHPFVRKSINIIKKY
FT                   FEEYALVGQDILENKENWDKILALVPSPIHDELQRGFQKFHSSPQRWEHLRKVANSSQN
FT                   MKNDKCGPWLEWEVMLQYCFPRLDVNVSKGVNHLLKSPFSVHPKTGRISVPIDFHKVDQ
FT                   FDPFTVPTISAICRELDMVSTHEKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENL
FT                   DKSRKGELLKKSDLQKDF"
FT   assembly_gap    9705254..9705694
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   gene            9723139..9736164
FT                   /locus_tag="mCG_17022"
FT                   /note="gene_id=mCG17022.2"
FT   mRNA            join(9723139..9723210,9724016..9724087,9733695..9733780,
FT                   9734256..9734333,9735185..9735331,9735526..9735654,
FT                   9735772..9735894,9736020..9736164)
FT                   /locus_tag="mCG_17022"
FT                   /product="mCG17022, transcript variant mCT171779"
FT                   /note="gene_id=mCG17022.2 transcript_id=mCT171779.0 created
FT                   on 09-AUG-2002"
FT   mRNA            join(9723162..9723210,9724016..9724087,9726698..9732613,
FT                   9733695..9733780,9734256..9734333,9735185..9735331,
FT                   9735526..9735654,9735772..9735894,9736020..9736164)
FT                   /locus_tag="mCG_17022"
FT                   /product="mCG17022, transcript variant mCT15969"
FT                   /note="gene_id=mCG17022.2 transcript_id=mCT15969.1 created
FT                   on 09-AUG-2002"
FT   mRNA            join(9723183..9723210,9724016..9724087,9733695..9733780,
FT                   9734256..9734324,9735290..9735331,9735526..9735654,
FT                   9735772..9735894,9736020..9736150)
FT                   /locus_tag="mCG_17022"
FT                   /product="mCG17022, transcript variant mCT171780"
FT                   /note="gene_id=mCG17022.2 transcript_id=mCT171780.0 created
FT                   on 09-AUG-2002"
FT   CDS             join(9724018..9724087,9726698..9732613,9733695..9733780,
FT                   9734256..9734333,9735185..9735331,9735526..9735654,
FT                   9735772..9735894,9736020..9736034)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17022"
FT                   /product="mCG17022, isoform CRA_a"
FT                   /note="gene_id=mCG17022.2 transcript_id=mCT15969.1
FT                   protein_id=mCP4411.2 isoform=CRA_a"
FT                   /protein_id="EDL24536.1"
FT                   /translation="MPGEATETVPATEQELPQPQAETAVLPMSSALKVAAVGQPGPTPP
FT                   SSLGPQQSPIVTAHQPSPLPSSVSSTPFEVPFAQPITAETALPSGTAPPTPTFLPHLIG
FT                   PPISPAALALASPMIGLAQKGARSSSAPLSLVALAPHSVQKSSVCPPHPLTSPPSAAGA
FT                   ELGALTASIPPLEPKTSTSQVPSQGTLNLKGTAPCPPDVVRAFPSHLENPLASVQPGLM
FT                   SCPQTLSNTSPVKGVPISSALTQSRLSLNLKGPVSPPARNTAAPSIPLAPSTSLGCHLP
FT                   LLHHSSVDSPIQPPGQSGLAVSNPTSVGHSGIAASCPPERCVVPALPSRLLAVDSGAAP
FT                   SDDKGSSAVTNELCSPPGSSNVAGTSLSPKASLVPKGSNVALQPLVTQVPASQKTGLKE
FT                   IPVSCIGATHHALDNPSAISVAPATHVPPPTSSGLVSSKDPASPVTSLVVPAAHKQFPA
FT                   PPASATLGVPVSPLPATEGLKNLPISALVNVGAPVSPAQAGLPTRKDTTLQPLAPIALK
FT                   ESPSSQSASSLEVLSEDTVTKKTTGGPAPVVRPAIAGVATTTSLRADSPPAVIRADSCV
FT                   SPNTVSQPLKRSVTDPAMAPRTAKNTAPSTTSPLVPLASEGCPVASSMALSPQNASVSE
FT                   TALALSPEIPKSVPFPDPPLAEISFSNARKVDAVSHMESSGSSRQGHPDASVTAKGTVV
FT                   CLADSSLDTSVSASKGSALSGASSPLYPLEVSFLPEAGLAVQGPKGSLNKLSPTPPSSK
FT                   GAPVPSTGAPPSPKGAPIVPTESSISSKQVPAEILPSPQKTPEVTASRLISAVQSPKVD
FT                   PIMSDVTPTSPKKTSATAVPKDTSATLSLKSVPAVTSLSPPKAPVAPSNEATIVPTEIP
FT                   TSLKNALAAATPKETLATSIPKVTSPSPQKTPKSVSLKGAPAMTSKKATEIAASKDVSP
FT                   SQFPKEVPLLPHVPPTSPPKSPVSDTLSGALTSPPPKGPPATLAETPTYPKKSPKPAAS
FT                   KKTPATPSPEGVTAVPLEIPPCSKKAPKTAAPKESSATSSSKRAPKTAVSKEIPSKGVT
FT                   AVPLEISLPLKETSKSATPGEKSASSPKRSPKTAGPKETPPGGVTAVPPEISLPPKETP
FT                   QNATPNESLAASSQKRSPKTSVPKETPPGGVTAMPLEIPSAPQKAPKTAVPKQIPTPED
FT                   AVTILAGSPLSPKKASKTAAPKEAPATPSVGVIAVSGEISPSPKKTSKTAAPKENSATL
FT                   PPKRSPKTAAPKETPATSSEGVTAVPSEISPSPPTPASKGVPVTLTPKGAPNALAESPA
FT                   SPKKVPKTAAPEETSTTPSPQKIPKVAGPKEASATPPSKKTPKTAVPKETSAPSEGVTA
FT                   VPLEIPPSPRKAPKTAAPKETPAPSPEGATTAPVQIPPSPRKGSKKAGSKETPTTPSPE
FT                   GVTAAPLEIPISSKKTSKMASPKETLVTPSSKKLSQTVGPKETSLEGATAVPLEIPPSH
FT                   KKAPKTVDPKQVPLTPSPKDAPTTLAESPSSPKKAPKTAAPPSERVTTVPPEKPATPQK
FT                   ASGTTASKVPVPAETQEVAVSSRETPVTPAVPPVKNPSSHKKTSKTIELKEAPATLPPS
FT                   PTKSPKIPSSKKAPRTSAPKEFPASPSIKPVTTSLAQTAPPSLQKAPSTTIPKENLAAP
FT                   AVLPVSSKSPAAPAAASASLSPATAAPQTAPKEATTIPSCKKAAATETPIETSTAPSLE
FT                   GAPKETSETSVSKVLMSSPPKKASSSKRASTLPATTLPSLKEASVLSPTATSSGKDSHI
FT                   SPVSDACSTGTTTPQASEKLPSKKGPTAFTEMLAAPAPESALAITAPIQKSPGANSNSA
FT                   SSPKCPDPSSKKDTKGLPSAVALAPQTVPVEKDTSKAIETLLVSPAKGSDCLHSPKGPV
FT                   GSQVATPLAAFTSDKVPPEAVSASVAPKPAPAASLTLAPSPVAPLPPKQPLLESAPGSV
FT                   LESPSKLPVPAEEDELPPLIPPEAVSGGEPFQPILVNMPAPKPAGTPAPAPSAKQPVLK
FT                   NNKGSGTESDSDESVPELEEQDSTQTATQQAQLAAAAEIDEEPVSKAKQSRSEKKARKA
FT                   MSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLA
FT                   AAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVR
FT                   ALKNNSNDIVNAIMELTM"
FT   CDS             join(9724018..9724087,9733695..9733780,9734256..9734333,
FT                   9735185..9735331,9735526..9735654,9735772..9735894,
FT                   9736020..9736034)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17022"
FT                   /product="mCG17022, isoform CRA_b"
FT                   /note="gene_id=mCG17022.2 transcript_id=mCT171779.0
FT                   protein_id=mCP94698.0 isoform=CRA_b"
FT                   /protein_id="EDL24537.1"
FT                   /translation="MPGEATETVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQ
FT                   TATQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILF
FT                   VITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQ
FT                   EESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAIMELTM"
FT   CDS             join(9724018..9724087,9733695..9733780,9734256..9734324,
FT                   9735290..9735331,9735526..9735654,9735772..9735894,
FT                   9736020..9736034)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17022"
FT                   /product="mCG17022, isoform CRA_c"
FT                   /note="gene_id=mCG17022.2 transcript_id=mCT171780.0
FT                   protein_id=mCP94699.0 isoform=CRA_c"
FT                   /protein_id="EDL24538.1"
FT                   /translation="MPGEATETVPATEQELPQPQAETGSGTESDSDESVPELEEQDSTQ
FT                   TATQQAQLAAAAEIDEEPVSKAKQSRSEKKSPASDTYIVFGEAKIEDLSQQAQLAAAEK
FT                   FKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKN
FT                   NSNDIVNAIMELTM"
FT   assembly_gap    9740067..9740271
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    9742964..9743196
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            <9746524..9764899
FT                   /gene="Ptges3"
FT                   /locus_tag="mCG_17024"
FT                   /note="gene_id=mCG17024.3"
FT   mRNA            join(<9746524..9746830,9756247..9756360,9756791..9756860,
FT                   9757709..9757807,9759644..9759733,9761866..9761928,
FT                   9762982..9763010,9763713..9764647)
FT                   /gene="Ptges3"
FT                   /locus_tag="mCG_17024"
FT                   /product="prostaglandin E synthase 3 (cytosolic),
FT                   transcript variant mCT191983"
FT                   /note="gene_id=mCG17024.3 transcript_id=mCT191983.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<9746526..9746830,9756247..9756360,9756791..9756860,
FT                   9757709..9757807,9759644..9759733,9761866..9761928,
FT                   9762982..9763010,9763713..9763770)
FT                   /codon_start=1
FT                   /gene="Ptges3"
FT                   /locus_tag="mCG_17024"
FT                   /product="prostaglandin E synthase 3 (cytosolic), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17024.3 transcript_id=mCT191983.0
FT                   protein_id=mCP112934.0 isoform=CRA_b"
FT                   /protein_id="EDL24540.1"
FT                   /translation="AFCCVTSRRPASPPLARTHAPSPSSRPFSYTFLLSRVEGAALRAV
FT                   HSGHRGRARRRRRLRGARRGRDRAETAGVAAGEESTRQPPPARPAHPFVWPSAPFTMQP
FT                   ASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPN
FT                   DSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFD
FT                   RFSEMMDHMGGDEDVDLPEVDGADDDSQDSDDESECQIWSKGCCHRLDFEKGK"
FT   mRNA            join(9746527..9746830,9756247..9756360,9756791..9756860,
FT                   9757709..9757807,9759644..9759733,9761866..9761928,
FT                   9762982..9763006,9763711..9764899)
FT                   /gene="Ptges3"
FT                   /locus_tag="mCG_17024"
FT                   /product="prostaglandin E synthase 3 (cytosolic),
FT                   transcript variant mCT15971"
FT                   /note="gene_id=mCG17024.3 transcript_id=mCT15971.1 created
FT                   on 09-AUG-2002"
FT   mRNA            join(9746527..9746830,9756247..9756360,9756791..9756860,
FT                   9759644..9759733,9761866..9761928,9762982..9763006,
FT                   9763711..9764899)
FT                   /gene="Ptges3"
FT                   /locus_tag="mCG_17024"
FT                   /product="prostaglandin E synthase 3 (cytosolic),
FT                   transcript variant mCT171781"
FT                   /note="gene_id=mCG17024.3 transcript_id=mCT171781.0 created
FT                   on 09-AUG-2002"
FT   CDS             join(9746829..9746830,9756247..9756360,9756791..9756860,
FT                   9757709..9757807,9759644..9759733,9761866..9761928,
FT                   9762982..9763006,9763711..9763730)
FT                   /codon_start=1
FT                   /gene="Ptges3"
FT                   /locus_tag="mCG_17024"
FT                   /product="prostaglandin E synthase 3 (cytosolic), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG17024.3 transcript_id=mCT15971.1
FT                   protein_id=mCP4424.1 isoform=CRA_c"
FT                   /protein_id="EDL24541.1"
FT                   /translation="MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSD
FT                   NFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFN
FT                   NWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE"
FT   CDS             join(9746829..9746830,9756247..9756360,9756791..9756860,
FT                   9759644..9759733,9761866..9761928,9762982..9763006,
FT                   9763711..9763730)
FT                   /codon_start=1
FT                   /gene="Ptges3"
FT                   /locus_tag="mCG_17024"
FT                   /product="prostaglandin E synthase 3 (cytosolic), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17024.3 transcript_id=mCT171781.0
FT                   protein_id=mCP94700.0 isoform=CRA_a"
FT                   /protein_id="EDL24539.1"
FT                   /translation="MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSD
FT                   NFKHLNEIDLFHCIDPNLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVD
FT                   LPEVDGADDDSQDSDDEKMPDLE"
FT   assembly_gap    9760299..9760369
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            9770967..9777917
FT                   /gene="Atp5b"
FT                   /locus_tag="mCG_17025"
FT                   /note="gene_id=mCG17025.1"
FT   mRNA            join(9770967..9771098,9771538..9771720,9771943..9772117,
FT                   9772736..9772857,9773087..9773271,9773683..9773841,
FT                   9773943..9774065,9775966..9776178,9776602..9776803,
FT                   9777664..9777917)
FT                   /gene="Atp5b"
FT                   /locus_tag="mCG_17025"
FT                   /product="ATP synthase, H+ transporting mitochondrial F1
FT                   complex, beta subunit"
FT                   /note="gene_id=mCG17025.1 transcript_id=mCT15972.1 created
FT                   on 09-AUG-2002"
FT   CDS             join(9770972..9771098,9771538..9771720,9771943..9772117,
FT                   9772736..9772857,9773087..9773271,9773683..9773841,
FT                   9773943..9774065,9775966..9776178,9776602..9776803,
FT                   9777664..9777764)
FT                   /codon_start=1
FT                   /gene="Atp5b"
FT                   /locus_tag="mCG_17025"
FT                   /product="ATP synthase, H+ transporting mitochondrial F1
FT                   complex, beta subunit"
FT                   /note="gene_id=mCG17025.1 transcript_id=mCT15972.1
FT                   protein_id=mCP4442.2"
FT                   /protein_id="EDL24542.1"
FT                   /translation="MLSLVGRVASASASGALRGLSPSAALPQAQLLLRAAPAGVHPARD
FT                   YAAQASAAPKAGTATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRDSRLVLEVAQHLG
FT                   ESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQF
FT                   APIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINN
FT                   VAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARAR
FT                   VALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMG
FT                   TMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVD
FT                   PLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRAR
FT                   KIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAV
FT                   AKADKLAEEHGS"
FT   gene            <9796661..9814767
FT                   /gene="Baz2a"
FT                   /locus_tag="mCG_145400"
FT                   /note="gene_id=mCG145400.0"
FT   mRNA            join(<9796661..9796685,9798409..9799002,9800236..9800421,
FT                   9801117..9801335,9801988..9802437,9802679..9802739,
FT                   9803715..9803823,9803960..9804061,9804201..9804411,
FT                   9806208..9806308,9806608..9806673,9806923..9807153,
FT                   9807277..9807531,9808764..9808978,9809244..9809318,
FT                   9809453..9809633,9809721..9809780,9809959..9810103,
FT                   9810677..9811308,9811419..9811641,9811760..9811915,
FT                   9811988..9812139,9812546..9812835,9812922..9813054,
FT                   9813152..9813298,9813671..9813894,9813979..9814122,
FT                   9814241..9814767)
FT                   /gene="Baz2a"
FT                   /locus_tag="mCG_145400"
FT                   /product="bromodomain adjacent to zinc finger domain, 2A"
FT                   /note="gene_id=mCG145400.0 transcript_id=mCT184824.0
FT                   created on 05-JUN-2003"
FT   CDS             join(9796661..9796685,9798409..9799002,9800236..9800421,
FT                   9801117..9801335,9801988..9802437,9802679..9802739,
FT                   9803715..9803823,9803960..9804061,9804201..9804411,
FT                   9806208..9806308,9806608..9806673,9806923..9807153,
FT                   9807277..9807531,9808764..9808978,9809244..9809318,
FT                   9809453..9809633,9809721..9809780,9809959..9810103,
FT                   9810677..9811308,9811419..9811641,9811760..9811915,
FT                   9811988..9812139,9812546..9812835,9812922..9813054,
FT                   9813152..9813298,9813671..9813894,9813979..9814122,
FT                   9814241..9814406)
FT                   /codon_start=1
FT                   /gene="Baz2a"
FT                   /locus_tag="mCG_145400"
FT                   /product="bromodomain adjacent to zinc finger domain, 2A"
FT                   /note="gene_id=mCG145400.0 transcript_id=mCT184824.0
FT                   protein_id=mCP105308.0"
FT                   /protein_id="EDL24543.1"
FT                   /translation="MNFPQQGKSLNGDVNVNGLSTVSHTTTSGILNSAPHSSSTSHLHH
FT                   PNVAYDCLWNYSQYPSANPGNNLKDPPLLSQFPGGQYPLNGILGGNRQPSSPSHNTNLR
FT                   AGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQT
FT                   FAPSQDVSSDIHPDEAAEKELTSVVAENGTGLVGSLELEEEQPELKMCGYNGSVSSVES
FT                   LHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILSEDSLEPFDSLAAEPVSGSLYGIDDA
FT                   ELMGAEDKLPLEGNPVISALDCPALSNANAFSLLADDSQTSASIFVSPTSPPVLGESVL
FT                   QDNSFGLNSCSDSEQEEIETQSSNFQRPLTEPAPDQPPSTQLHPAVSPTASPAASLTAS
FT                   AEISPAVSPVASSPVPPEVFVAVSPASSPALPAISLEASMTTPVTSPQGSPEPSPAAAF
FT                   QTVSPARKNVSSAPKARADREETTGGAVAVSGSGDVLKRRIATPEEVRLPLQHGWRREV
FT                   RIKKGSHRWQGETWYYGPCGKRMKQFPEVIKYLSRNVVHSVRREHFSFSPRMPVGDFFE
FT                   ERDTPEGLQWVQLSAEEIPSRIQAITGKRGRPRNNEKAKNKEVPKVKRGRGRPPKIKMP
FT                   ELLNKTDNRLPKKLETQEILSEDDKAKMTKNKKKMRQKVQRGESQTPVQGQARNKRKQD
FT                   TKSLKQKDTKKKLKAEKEKMKTKQEKLKEKVKREKKEKVKAKGKEGPRARPSCRADKTL
FT                   ATQKRLEEQQRQQAILEEMKKPTEDMCLSDHQPLPDFTRIPGLTLSSRAFSDCLTIVEF
FT                   LHSFGKVLGFDLTKDVPSLGVLQEGLLCQGDSLDKVQDLLVRLLKAALHDPGLPPYCQS
FT                   LKILGEKMSEIPLTRDNVSEILRCFLMAYRVEPSFCDSLRTQPFQAQPPQQKAAILAFL
FT                   VHELNSSTIIINEIDKTLESVSSCRKNKWIVEGRLRRLKTALAKRTGRPEVMMEGAEDG
FT                   LGRRRSSRIMEETSGIEEEEEEENTTAVHGRRGRKEGEIDVAASSIPELERHIEKLSKR
FT                   QLFFRKKLLHSSQMLRAVSLGQDRYRRHYWVLPYLAGIFVEGSEGSTVTEDEIKQETES
FT                   LMEVVTSTPSSARASVKRELTGSNASTSPARSRGRPRKPKPGSLQPQHLQSTIRECDSE
FT                   QAQTQVHPEPQPQLQAPTQPHLQPSSGFLEPEGSPFSLGQSQHDLSQSAFLSWLSQTQS
FT                   HNSLLSSSVLTPDSSPGKLDSAPSQSLEEPEPDEAQSCPGPQGPWFNFSAQIPCDAAPT
FT                   PPPAVSEDQPTPSLQLLASSKPMNTPGAANPCSPVQLSSTHLPGGTPKRLSGDSEEMSQ
FT                   SPTGLGQPKRRGRPPSKFFKQVEQHYLTQLTAQPIPPEMCSGWWWIRDPETLDVLLKAL
FT                   HPRGIREKALHKHLSKHKDFLQEVCLQPLTDPIFEPNELPALEEGVMSWSPKEKTYETD
FT                   LAVLQWVEELEQRVVLSDLQIRGWTCPTPDSTREDLTYCEHLPDSPEDIPWRGRGREGT
FT                   VPQRQNNNPLDLAVMRLAVLEQNVERRYLREPLWAAHEVVVEKALLSTPNGAPDGTSTE
FT                   ISYEITPRVRVWRQTLERCRSAAQVCLCMGQLERSIAWEKSVNKVTCLVCRKGDNDEFL
FT                   LLCDGCDRGCHIYCHRPKMEAVPEGDWFCAVCLSQQVEEEYTQRPGFPKRGQKRKSSFP
FT                   LTFPEGDSRRRMLSRSRDSPAVPRYPEDGLSPPKRRRHSMRSHHSDLTFCEIILMEMES
FT                   HDAAWPFLEPVNPRLVSGYRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQ
FT                   TFNEDDSEVGKAGHVMRRFFESRWEEFYQGKQANL"
FT   assembly_gap    9805523..9805542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9820885..9863958)
FT                   /gene="Rbms2"
FT                   /locus_tag="mCG_17027"
FT                   /note="gene_id=mCG17027.1"
FT   mRNA            complement(join(9820885..9821020,9821294..9821378,
FT                   9821781..9821861,9822650..9822760,9825083..9825176,
FT                   9825270..9825316,9825529..9825638,9825727..9825806,
FT                   9831000..9831157,9833278..9833369,9834255..9834313,
FT                   9838836..9839008,9863867..9863958))
FT                   /gene="Rbms2"
FT                   /locus_tag="mCG_17027"
FT                   /product="RNA binding motif, single stranded interacting
FT                   protein 2"
FT                   /note="gene_id=mCG17027.1 transcript_id=mCT15974.1 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(9821298..9821378,9821781..9821861,
FT                   9822650..9822760,9825083..9825176,9825270..9825316,
FT                   9825529..9825638,9825727..9825806,9831000..9831157,
FT                   9833278..9833369,9834255..9834313,9838836..9839008,
FT                   9863867..9863932))
FT                   /codon_start=1
FT                   /gene="Rbms2"
FT                   /locus_tag="mCG_17027"
FT                   /product="RNA binding motif, single stranded interacting
FT                   protein 2"
FT                   /note="gene_id=mCG17027.1 transcript_id=mCT15974.1
FT                   protein_id=mCP4461.1"
FT                   /protein_id="EDL24544.1"
FT                   /translation="MLLSVTSRPGISTFGYNKNNKKLYVAQQMAPPSPRNSTPNSSGGG
FT                   GGGSGGNDQLSKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFV
FT                   DFDSPSSAQKAVTALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQELEGMLKPFGQV
FT                   ISTRILRDTSGASRGVGFARMESTEKCEAIITHFNGKYIKTPPGVAAPSDPLLCKFADG
FT                   GPKKRQSQGRYVQNGRAWPRNGDMGGMALTYDPTAALQNGFYAAPYSIAHSRMLAQSAL
FT                   APYLPSPVSSYQGSVLTPGMDHPLSLQPASMMGPLTQQLGHLSLNSLGTFMPAAAAMHG
FT                   AYISQYPAVPSSSVSAEESNGQQNQLAVEPPSDHGVYPFQFSK"
FT   assembly_gap    9824081..9824285
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    9833806..9833859
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    9850055..9850243
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    9872122..9872141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9876715..9877877
FT                   /estimated_length=1163
FT                   /gap_type="unknown"
FT   gene            <9882535..9897680
FT                   /gene="Gls2"
FT                   /locus_tag="mCG_146244"
FT                   /note="gene_id=mCG146244.0"
FT   mRNA            join(<9882535..9882696,9886940..9887039,9887395..9887516,
FT                   9887931..9888060,9888964..9889127,9889317..9889375,
FT                   9891571..9891603,9891823..9891881,9892409..9892475,
FT                   9892609..9892659,9892836..9893012,9894618..9894749,
FT                   9895044..9895136,9895307..9895368,9896337..9896413,
FT                   9896852..9896915,9897034..9897680)
FT                   /gene="Gls2"
FT                   /locus_tag="mCG_146244"
FT                   /product="glutaminase 2 (liver, mitochondrial)"
FT                   /note="gene_id=mCG146244.0 transcript_id=mCT186347.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<9887960..9888060,9888964..9889127,9889317..9889375,
FT                   9891571..9891603,9891823..9891881,9892409..9892475,
FT                   9892609..9892659,9892836..9893012,9894618..9894749,
FT                   9895044..9895136,9895307..9895368,9896337..9896413,
FT                   9896852..9896915,9897034..9897190)
FT                   /codon_start=1
FT                   /gene="Gls2"
FT                   /locus_tag="mCG_146244"
FT                   /product="glutaminase 2 (liver, mitochondrial)"
FT                   /note="gene_id=mCG146244.0 transcript_id=mCT186347.0
FT                   protein_id=mCP107354.0"
FT                   /protein_id="EDL24545.1"
FT                   /translation="LRHSERSLSFLTLRSSRAMWIAYLRMPKSPLEAKHSVGHTKIPFC
FT                   LQSCVKPLTYAISVSTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVS
FT                   SLIKMDCNKAEKFDFVLQYLNKMAGNEFMGFSNATFQSEKETGDRNYAIGYYLKEKKCF
FT                   PKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLM
FT                   HSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQ
FT                   KLVSLFNFHNYDNLRHCARKLDPRREGGEVRNKTVVNLLFAAYSGDVSALRRFALSAMD
FT                   MEQKDYDSRTALHVAAAEGHIEVVKFLIEACKVNPFVKDRWGNIPLDDAVQFNHLEVVK
FT                   LLQDYHDSYLLSETQAEAAAETLSKENLESMV"
FT   gene            complement(9897659..9900067)
FT                   /gene="Spryd4"
FT                   /locus_tag="mCG_17042"
FT                   /note="gene_id=mCG17042.1"
FT   mRNA            complement(join(9897659..9899137,9899974..9900067))
FT                   /gene="Spryd4"
FT                   /locus_tag="mCG_17042"
FT                   /product="SPRY domain containing 4, transcript variant
FT                   mCT15991"
FT                   /note="gene_id=mCG17042.1 transcript_id=mCT15991.1 created
FT                   on 20-AUG-2002"
FT   mRNA            complement(join(9898407..9899137,9899457..>9899541))
FT                   /gene="Spryd4"
FT                   /locus_tag="mCG_17042"
FT                   /product="SPRY domain containing 4, transcript variant
FT                   mCT172447"
FT                   /note="gene_id=mCG17042.1 transcript_id=mCT172447.0 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(9898599..9899137,9899974..9900061))
FT                   /codon_start=1
FT                   /gene="Spryd4"
FT                   /locus_tag="mCG_17042"
FT                   /product="SPRY domain containing 4, isoform CRA_b"
FT                   /note="gene_id=mCG17042.1 transcript_id=mCT15991.1
FT                   protein_id=mCP4401.2 isoform=CRA_b"
FT                   /protein_id="EDL24547.1"
FT                   /translation="MALPFARCWEVVPLGHQAMGGVPAVESRRGISFKLEEKTAHSSLA
FT                   LFRGDTGVKYGLVGLEPTKVALNLERFREWAVVLGDTTVTSGRHYWEVTVKRSQQFRIG
FT                   VADVDMSRDSCVGADDRSWVFSYAQRKWHSMLANEKAPIKGIGQPEKVGLLLDYEAKKL
FT                   SLVDVSRISVIHTLQTDFRGPVAPAFALWDGELLTHSGLEVPKGL"
FT   CDS             complement(join(9898599..9899137,9899457..9899541))
FT                   /codon_start=1
FT                   /gene="Spryd4"
FT                   /locus_tag="mCG_17042"
FT                   /product="SPRY domain containing 4, isoform CRA_a"
FT                   /note="gene_id=mCG17042.1 transcript_id=mCT172447.0
FT                   protein_id=mCP95366.0 isoform=CRA_a"
FT                   /protein_id="EDL24546.1"
FT                   /translation="MALPFARCWKLYRWGTKRWGVPAVESRRGISFKLEEKTAHSSLAL
FT                   FRGDTGVKYGLVGLEPTKVALNLERFREWAVVLGDTTVTSGRHYWEVTVKRSQQFRIGV
FT                   ADVDMSRDSCVGADDRSWVFSYAQRKWHSMLANEKAPIKGIGQPEKVGLLLDYEAKKLS
FT                   LVDVSRISVIHTLQTDFRGPVAPAFALWDGELLTHSGLEVPKGL"
FT   assembly_gap    9899934..9899953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9901584..9901603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9903996..9925310
FT                   /estimated_length=21315
FT                   /gap_type="unknown"
FT   gene            <9925636..9931434
FT                   /gene="Timeless"
FT                   /locus_tag="mCG_134484"
FT                   /note="gene_id=mCG134484.0"
FT   mRNA            join(<9925636..9925748,9925838..9925955,9926080..9926281,
FT                   9926866..9927011,9927849..9927934,9928023..9928143,
FT                   9928230..9928312,9928470..9928612,9928787..9928964,
FT                   9929048..9929116,9929196..9929314,9930172..9930385,
FT                   9930495..9930590,9930694..9931434)
FT                   /gene="Timeless"
FT                   /locus_tag="mCG_134484"
FT                   /product="timeless homolog (Drosophila), transcript variant
FT                   mCT135869"
FT                   /note="gene_id=mCG134484.0 transcript_id=mCT135869.0
FT                   created on 09-AUG-2002"
FT   CDS             join(<9925637..9925748,9925838..9925955,9926080..9926281,
FT                   9926866..9927011,9927849..9927934,9928023..9928143,
FT                   9928230..9928312,9928470..9928612,9928787..9928964,
FT                   9929048..9929116,9929196..9929314,9930172..9930385,
FT                   9930495..9930590,9930694..9930758)
FT                   /codon_start=1
FT                   /gene="Timeless"
FT                   /locus_tag="mCG_134484"
FT                   /product="timeless homolog (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG134484.0 transcript_id=mCT135869.0
FT                   protein_id=mCP44467.0 isoform=CRA_b"
FT                   /protein_id="EDL24549.1"
FT                   /translation="PSVSREVWPEGNAFGSPVISPGEEMQLLKQILSTPLPRQQEPEEG
FT                   DAEEEEEEEEEEELQVVQVSEKEFNFLEYLKRFASSTIVRAYVLLLRSYRQNSAHTNHC
FT                   IAKMLHRLAHGLGMEALLFQLSLFCLFNRLLSDPAAAAYKELVTFAKYIIGKFFALAAV
FT                   NQKAFVELLFWKNTAVVREMTQGYGSLDSGSSSHRAPLWSPEEEAQLQELYLAHKDVEG
FT                   QDVVETILAHLKVVPRTRKQVIHHLVRMGLADSVKEFQKRKGTQIVLWTEDQELELQRL
FT                   FEEFRDSDDVLGQIMKNITAKRSRARVVDKLLALGLVSERRQLYKKRRKKLAPSCMQNG
FT                   EKSPRDPWQEDPEEEDEHLPEDESEDEESEEGLPSGQGQGSSSLSAENLGESLRQEGLS
FT                   APLLWLQSSLIRAANDREEDGCSQAIPLVPLTEENEEAMENEQFQHLLRKLGIRPPSSG
FT                   QETFWRIPAKLSSTQLRRVAASLSQQENEEEREEEPEPGVPGEQGPSEEHRTEALRALL
FT                   SARKRKAGLGPTEEEATGEEEWNSAPKKRQLLDSDEEEDDEGRRQAVSGTPRVHRKKRF
FT                   QIEDEDD"
FT   mRNA            join(<9925857..9925955,9926080..9926281,9926866..9927011,
FT                   9927849..9927934,9928023..9928143,9928230..9928312,
FT                   9928470..9928612,9928790..9928964,9929048..9929116,
FT                   9929196..9929314,9930172..9930385,9930495..9930590,
FT                   9930694..9931430)
FT                   /gene="Timeless"
FT                   /locus_tag="mCG_134484"
FT                   /product="timeless homolog (Drosophila), transcript variant
FT                   mCT191960"
FT                   /note="gene_id=mCG134484.0 transcript_id=mCT191960.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<9925858..9925955,9926080..9926281,9926866..9927011,
FT                   9927849..9927934,9928023..9928143,9928230..9928312,
FT                   9928470..9928612,9928790..9928964,9929048..9929116,
FT                   9929196..9929314,9930172..9930385,9930495..9930590,
FT                   9930694..9930758)
FT                   /codon_start=1
FT                   /gene="Timeless"
FT                   /locus_tag="mCG_134484"
FT                   /product="timeless homolog (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG134484.0 transcript_id=mCT191960.0
FT                   protein_id=mCP112923.0 isoform=CRA_a"
FT                   /protein_id="EDL24548.1"
FT                   /translation="GDAEEEEEEEEEEELQVVQVSEKEFNFLEYLKRFASSTIVRAYVL
FT                   LLRSYRQNSAHTNHCIAKMLHRLAHGLGMEALLFQLSLFCLFNRLLSDPAAAAYKELVT
FT                   FAKYIIGKFFALAAVNQKAFVELLFWKNTAVVREMTQGYGSLDSGSSSHRAPLWSPEEE
FT                   AQLQELYLAHKDVEGQDVVETILAHLKVVPRTRKQVIHHLVRMGLADSVKEFQKRKGTQ
FT                   IVLWTEDQELELQRLFEEFRDSDDVLGQIMKNITAKRSRARVVDKLLALGLVSERRQLY
FT                   KKRRKKLAPSCMNGEKSPRDPWQEDPEEEDEHLPEDESEDEESEEGLPSGQGQGSSSLS
FT                   AENLGESLRQEGLSAPLLWLQSSLIRAANDREEDGCSQAIPLVPLTEENEEAMENEQFQ
FT                   HLLRKLGIRPPSSGQETFWRIPAKLSSTQLRRVAASLSQQENEEEREEEPEPGVPGEQG
FT                   PSEEHRTEALRALLSARKRKAGLGPTEEEATGEEEWNSAPKKRQLLDSDEEEDDEGRRQ
FT                   AVSGTPRVHRKKRFQIEDEDD"
FT   gene            9932660..9934138
FT                   /gene="Apon"
FT                   /locus_tag="mCG_17031"
FT                   /note="gene_id=mCG17031.2"
FT   mRNA            join(9932660..9932783,9932937..>9933712)
FT                   /gene="Apon"
FT                   /locus_tag="mCG_17031"
FT                   /product="apolipoprotein N, transcript variant mCT15978"
FT                   /note="gene_id=mCG17031.2 transcript_id=mCT15978.1 created
FT                   on 09-AUG-2002"
FT   mRNA            9932719..9934138
FT                   /gene="Apon"
FT                   /locus_tag="mCG_17031"
FT                   /product="apolipoprotein N, transcript variant mCT171782"
FT                   /note="gene_id=mCG17031.2 transcript_id=mCT171782.0 created
FT                   on 09-AUG-2002"
FT   CDS             9932957..9933712
FT                   /codon_start=1
FT                   /gene="Apon"
FT                   /locus_tag="mCG_17031"
FT                   /product="apolipoprotein N, isoform CRA_a"
FT                   /note="gene_id=mCG17031.2 transcript_id=mCT15978.1
FT                   protein_id=mCP4446.2 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9D6"
FT                   /db_xref="InterPro:IPR026114"
FT                   /db_xref="MGI:MGI:88931"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9D6"
FT                   /protein_id="EDL24550.1"
FT                   /translation="MIQAALLLGCILLSPVTAFPWKTQNGSLPAVTRTEPTSNVLPNKI
FT                   PPPTPITCRDLLYTVLPAAPLSEFLSLLALRVVLENIGCPAEAYSLQLRISEMGGKDSA
FT                   ETLVLQSQKSSQEEGIGNNEVILRHLVPSPGDMRRVRRSVTLPEACTYEPGWVLYDMAQ
FT                   VLLETANKLPPIDLVREFKASVVNVTQHCTMESWESMNEVARRLMSSPELKDAKIPVED
FT                   RVYLVAQLAVVLKRIFVNLVWEYFQTYFG"
FT   CDS             9932957..9933712
FT                   /codon_start=1
FT                   /gene="Apon"
FT                   /locus_tag="mCG_17031"
FT                   /product="apolipoprotein N, isoform CRA_a"
FT                   /note="gene_id=mCG17031.2 transcript_id=mCT171782.0
FT                   protein_id=mCP94701.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9D6"
FT                   /db_xref="InterPro:IPR026114"
FT                   /db_xref="MGI:MGI:88931"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9D6"
FT                   /protein_id="EDL24551.1"
FT                   /translation="MIQAALLLGCILLSPVTAFPWKTQNGSLPAVTRTEPTSNVLPNKI
FT                   PPPTPITCRDLLYTVLPAAPLSEFLSLLALRVVLENIGCPAEAYSLQLRISEMGGKDSA
FT                   ETLVLQSQKSSQEEGIGNNEVILRHLVPSPGDMRRVRRSVTLPEACTYEPGWVLYDMAQ
FT                   VLLETANKLPPIDLVREFKASVVNVTQHCTMESWESMNEVARRLMSSPELKDAKIPVED
FT                   RVYLVAQLAVVLKRIFVNLVWEYFQTYFG"
FT   assembly_gap    9935838..9936130
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    9939508..9939817
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    9943668..9943835
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            9947403..9948870
FT                   /gene="Apof"
FT                   /locus_tag="mCG_140901"
FT                   /note="gene_id=mCG140901.0"
FT   mRNA            join(9947403..9947488,9947714..9948870)
FT                   /gene="Apof"
FT                   /locus_tag="mCG_140901"
FT                   /product="apolipoprotein F"
FT                   /note="gene_id=mCG140901.0 transcript_id=mCT135883.1
FT                   created on 14-AUG-2002"
FT   CDS             join(9947473..9947488,9947714..9948678)
FT                   /codon_start=1
FT                   /gene="Apof"
FT                   /locus_tag="mCG_140901"
FT                   /product="apolipoprotein F"
FT                   /note="gene_id=mCG140901.0 transcript_id=mCT135883.1
FT                   protein_id=mCP44568.1"
FT                   /db_xref="GOA:A0A0R4J0M4"
FT                   /db_xref="InterPro:IPR026114"
FT                   /db_xref="MGI:MGI:104539"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0M4"
FT                   /protein_id="EDL24552.1"
FT                   /translation="MAGLYGCSAPDMHSLRLILMSIQLLCYLLLCPVDATSHGEATSVS
FT                   TVLPPSKLGYQMQTSDKPLSCQMLLPKSLPGFTYMPPVSKFLVGLALRNALEAAGCQAE
FT                   VWALQLQLYRLGGVEATQALIHHLQELQKSGHTDREVSVDALSSALQLLAWEQPGPKRA
FT                   KRSISNTDCDNDQEQSVHNVVDLLPAVGTYYNLGTALYYAIKNCSDKAKERGRDGAIDL
FT                   GYDLLMAMVGASGGPAGAVITAALKPAMKAGVQRLIQYYYDEKEVTTPQPEVTTHQPET
FT                   GKDATTDIGVVEEIAMSNFVSEVESTTSNWEWPLLKNYGVLAYKR"
FT   gene            <9949295..9974078
FT                   /gene="Stat2"
FT                   /locus_tag="mCG_140850"
FT                   /note="gene_id=mCG140850.0"
FT   mRNA            join(<9949295..9949436,9955160..9955302,9955427..9955579,
FT                   9955805..9955900,9956331..9956420,9956510..9956585,
FT                   9959787..9959940,9962195..9962353,9962463..9962555,
FT                   9962763..9962822,9963216..9963233,9963980..9964073,
FT                   9964381..9964425,9964501..9964584,9964752..9964850,
FT                   9964952..9965087,9965195..9965247,9965366..9965460,
FT                   9966215..9966351,9966540..9966722,9966929..9966986,
FT                   9971727..9972253,9972451..9974078)
FT                   /gene="Stat2"
FT                   /locus_tag="mCG_140850"
FT                   /product="signal transducer and activator of transcription
FT                   2"
FT                   /note="gene_id=mCG140850.0 transcript_id=mCT161211.1
FT                   created on 09-AUG-2002"
FT   assembly_gap    9954737..9954845
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   CDS             join(<9955499..9955579,9955805..9955900,9956331..9956420,
FT                   9956510..9956585,9959787..9959940,9962195..9962353,
FT                   9962463..9962555,9962763..9962822,9963216..9963233,
FT                   9963980..9964073,9964381..9964425,9964501..9964584,
FT                   9964752..9964850,9964952..9965087,9965195..9965247,
FT                   9965366..9965460,9966215..9966351,9966540..9966722,
FT                   9966929..9966986,9971727..9972253,9972451..9972596)
FT                   /codon_start=1
FT                   /gene="Stat2"
FT                   /locus_tag="mCG_140850"
FT                   /product="signal transducer and activator of transcription
FT                   2"
FT                   /note="gene_id=mCG140850.0 transcript_id=mCT161211.1
FT                   protein_id=mCP90213.1"
FT                   /protein_id="EDL24553.1"
FT                   /translation="TQWDHYSSDSNHFLLQHNLRKFSRDIQTFPNGPTQLAEMIFNLLL
FT                   EEQRILNQAQRAQEVQPPPAPEAVVESQQLEIENRIQGLHVDIEFLVRSIRQLKDEQDV
FT                   FSFRYTVFSLKEVLDISKGLVGRLTTLVDLLLPKLDEWKVQQQKSCIGAPPPELQLEQL
FT                   EQWLTAGAKFLFHLRQLLKQLKEMSHMLRYKGDMFGQGVDLQNAQVMELLQRLLQRSFV
FT                   VETQPCMPQTLHRPLILKTGNKFTVRTRLLVRLQEGSESLKAEVSVDRNSDLPGFRKFN
FT                   ILTSNQKTLTPEEGQRQGLIWDFGFLTLVEQRAVGAGKGNKGPLAVTEELHVISFVVEY
FT                   VYQGLKMKLQTDTLPVVIISNMNQLSIAWASILWFNMLSPNPKNQQFFCQAPKAPWSLL
FT                   GPVLSWQFSSYVGRGLDSEQLGMLRTKLFGKSCKMEDALLSWVDFCKRESPPGKIPFWT
FT                   WLDKILELVHDHLKDLWKDGRIMGFVSRNQERRLLKKMLSGTFLLRFSETSEGGITCSW
FT                   VEHQDDDKVEIYSVQPYTKEVLQSLPLTEIIRHYQVLAEENIPENPLRFLYPRIPRDEA
FT                   FGCYYQEKVNFEEQRKYLKHKLIVISNRQVDELQQPLELKQDSESLEVNAELLLAHDQE
FT                   LPLMMQTGLVLGTELKVDPILSTAPQVLLEPAPQVQLEPAPQVLLEPAPQVQLEPAPQV
FT                   LLEPAPQVQLEPAPQVLLEPAPQVQLEPAPQVLLELAPQVLLEPAPQVLLELAPQVQLE
FT                   PAHLLQQPSESDLPEDLQQISVEDLKKLSNPSTEYITTNENPMLAGESSGDETSIPYHS
FT                   HFDADGLLGWTLDTF"
FT   assembly_gap    9956847..9956866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9958393..9959708
FT                   /estimated_length=1316
FT                   /gap_type="unknown"
FT   assembly_gap    9963423..9963648
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    9970418..9970437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9971207..9971497
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   gene            complement(9977373..9979316)
FT                   /gene="Il23a"
FT                   /locus_tag="mCG_18684"
FT                   /note="gene_id=mCG18684.1"
FT   mRNA            complement(join(9977373..9978207,9978310..9978456,
FT                   9978722..9978823,9979043..9979316))
FT                   /gene="Il23a"
FT                   /locus_tag="mCG_18684"
FT                   /product="interleukin 23, alpha subunit p19"
FT                   /note="gene_id=mCG18684.1 transcript_id=mCT15226.1 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(9978028..9978207,9978310..9978456,
FT                   9978722..9978823,9979043..9979204))
FT                   /codon_start=1
FT                   /gene="Il23a"
FT                   /locus_tag="mCG_18684"
FT                   /product="interleukin 23, alpha subunit p19"
FT                   /note="gene_id=mCG18684.1 transcript_id=mCT15226.1
FT                   protein_id=mCP4432.1"
FT                   /protein_id="EDL24554.1"
FT                   /translation="MLDCRAVIMLWLLPWVTQGLAVPRSSSPDWAQCQQLSRNLCMLAW
FT                   NAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHL
FT                   LDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLR
FT                   SKILRSLQAFLAIAARVFAHGAATLTEPLVPTA"
FT   gene            9984581..10002560
FT                   /gene="Usp52"
FT                   /locus_tag="mCG_18699"
FT                   /note="gene_id=mCG18699.2"
FT   mRNA            join(9984581..9984692,9985316..9985610,9989278..9989447,
FT                   9989549..9989669,9989817..9989894,9990250..9990517,
FT                   9991383..9991725,9991916..9992012,9994090..9994206,
FT                   9994353..9994472,9994827..9994955,9995054..9995253,
FT                   9995387..9995758,9995930..9996028,9996127..9996197,
FT                   9996302..9996440,9996691..9996861,9996980..9997039,
FT                   9997630..9997720,9998833..9998990,9999089..9999232,
FT                   9999362..10000237,10001447..10001644,10001933..10002560)
FT                   /gene="Usp52"
FT                   /locus_tag="mCG_18699"
FT                   /product="ubiquitin specific peptidase 52, transcript
FT                   variant mCT175262"
FT                   /note="gene_id=mCG18699.2 transcript_id=mCT175262.0 created
FT                   on 28-OCT-2002"
FT   mRNA            join(9984581..9984692,9985316..9985714,9989278..9989447,
FT                   9989549..9989669,9989817..9989894,9990250..9990517,
FT                   9991383..9991725,9991916..9992012,9994090..9994206,
FT                   9994353..9994472,9994827..9994955,9995054..9995253,
FT                   9995387..9995520,9995652..9995758,9995930..9996028,
FT                   9996127..9996197,9996302..9996440,9996691..9996861,
FT                   9996980..9997039,9997630..9997720,9998833..9998990,
FT                   9999089..9999232,9999362..9999541,10000144..10000237,
FT                   10001447..10001644,10001933..10002559)
FT                   /gene="Usp52"
FT                   /locus_tag="mCG_18699"
FT                   /product="ubiquitin specific peptidase 52, transcript
FT                   variant mCT15241"
FT                   /note="gene_id=mCG18699.2 transcript_id=mCT15241.2 created
FT                   on 28-OCT-2002"
FT   CDS             join(9985433..9985714,9989278..9989447,9989549..9989669,
FT                   9989817..9989894,9990250..9990517,9991383..9991725,
FT                   9991916..9992012,9994090..9994206,9994353..9994472,
FT                   9994827..9994955,9995054..9995253,9995387..9995520,
FT                   9995652..9995758,9995930..9996028,9996127..9996197,
FT                   9996302..9996440,9996691..9996861,9996980..9997039,
FT                   9997630..9997720,9998833..9998990,9999089..9999232,
FT                   9999362..9999541,10000144..10000237,10001447..10001644,
FT                   10001933..10001967)
FT                   /codon_start=1
FT                   /gene="Usp52"
FT                   /locus_tag="mCG_18699"
FT                   /product="ubiquitin specific peptidase 52, isoform CRA_a"
FT                   /note="gene_id=mCG18699.2 transcript_id=mCT15241.2
FT                   protein_id=mCP4379.2 isoform=CRA_a"
FT                   /protein_id="EDL24555.1"
FT                   /translation="MNFEGLDPGLAEFSPAMHSTLDPVLDAHLNPSLLQNVELDPEGVA
FT                   LEALPVQESVHIMEGVYSELHSVVAEVGVPVSVSHFDLHEEMLWVGSHGGHATSFFGPA
FT                   LERYSSFQVNGGDDIRQIQSLENGILFLTKNNLKYMARGGLIIFDYLLDENEDMHSVLL
FT                   TDNSTLLVGGLQNHVLEIDLNTVQETQKYAVETPGVTIMRQTNRFFFCGHTSGKVSLRD
FT                   LRSFKVEHEFDAFSGSLSDFDVHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITPL
FT                   QVHVDPAFLRFIPTYTSRLAIISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSA
FT                   SKQALAFGDSEGCVHLWTDSPEPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIP
FT                   VPLTTDALLSDWPAANSAPAPRRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRL
FT                   KESDHEFDNFSQVTESPTGREEEPLHTVSKKYRKVTIKYSKLGLEDFDFKHYNKTLFAG
FT                   LEPHIPNAYCNCMIQVLYFLEPVRCLIQNHLCQKEFCLACELGFLFHMLDLSRGDPCQG
FT                   SNFLRAFRTIPEASALGLILADSDEASGKGSLARLIQRWNRFILTQLHQDMQELEVPQA
FT                   YRGAGGSFCSSGDSIIGQLFSCEMENCSLCRCGSETVRASSTLLFTLSYPEDKTGKNYD
FT                   FAQVLKRSICLEQNTQAWCDNCEKYQPTIQTRNIRHLPDILVINCEVNSSKEADFWRLQ
FT                   AEVAFKIAVKKYGGEMKSKEFALADRKELRSPEGFLCSSIEELKNVWLPFSIRMKMTKN
FT                   KGLDVCNWADEHELSSLGAPSQWGPARAEEELGVYVYDLMATVVHILDSRTGGSLVAHI
FT                   KVGETYHQRKEGVTHQQWYLFNDFLIEPIDKYEAVQFDMNWKVPAILYYVKRNLNSRYN
FT                   LNIKNPIEASVLLAEASLARKQRKTHTTFIPLMLNEMPQVGDLVGLDAEFVTLNEEEAE
FT                   LRSDGTKSTIKPSQMSVARITCVRGQGPNEGIPFIDDYISTQEQVVDYLTQYSGIKPGD
FT                   LDAKISSKHLTTLKSTYLKLRFLIDIGVKFVGHGLQKDFRVINLMVPKDQVLDTVYLFH
FT                   MPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVL
FT                   KGLYEKGRKMDWKVPEPESQTSPKNAAVFSSVLAL"
FT   gene            complement(9989029..9991244)
FT                   /locus_tag="mCG_147840"
FT                   /note="gene_id=mCG147840.0"
FT   mRNA            complement(9989029..9991244)
FT                   /locus_tag="mCG_147840"
FT                   /product="mCG147840"
FT                   /note="gene_id=mCG147840.0 transcript_id=mCT188103.0
FT                   created on 13-JAN-2004"
FT   CDS             join(9989413..9989447,9989549..9989669,9989817..9989894,
FT                   9990250..9990517,9991383..9991725,9991916..9992012,
FT                   9994090..9994206,9994353..9994472,9994827..9994955,
FT                   9995054..9995253,9995387..9995612)
FT                   /codon_start=1
FT                   /gene="Usp52"
FT                   /locus_tag="mCG_18699"
FT                   /product="ubiquitin specific peptidase 52, isoform CRA_b"
FT                   /note="gene_id=mCG18699.2 transcript_id=mCT175262.0
FT                   protein_id=mCP98181.0 isoform=CRA_b"
FT                   /protein_id="EDL24556.1"
FT                   /translation="MARGGLIIFDYLLDENEDMHSVLLTDNSTLLVGGLQNHVLEIDLN
FT                   TVQETQKYAVETPGVTIMRQTNRFFFCGHTSGKVSLRDLRSFKVEHEFDAFSGSLSDFD
FT                   VHGNLLAACGFSSRLTGLACDRFLKVYDLRMMRAITPLQVHVDPAFLRFIPTYTSRLAI
FT                   ISQSGQCQFCEPTGLANPADIFHVNPVGPLLMTFDVSASKQALAFGDSEGCVHLWTDSP
FT                   EPSFNPYSRETEFALPCLVDSLPPLDWSQDLLPLSLIPVPLTTDALLSDWPAANSAPAP
FT                   RRAPPVDAEILRTMKKVGFIGYAPNPRTRLRNQIPYRLKESDHEFDNFSQVTESPTGRE
FT                   EEPLHTVSKKYRKVTIKYSKLGLEDFDFKHYNKTLFAGLEPHIPNAYCNCMIQVLYFLE
FT                   PVRCLIQNHLCQKEFCLACELGFLFHMLDLSRGDPCQGSNFLRAFRTIPEASALGLILA
FT                   DSDEASGKGSLARLIQRWNRFILTQLHQDMQELEVPQAYRGAGGSFCSSGDSIIGQLFS
FT                   CEMENCSLCRCGSETVRASSTLLFTLSYPEGSICGIPCTWVGRLPQITCNTTEGSWGDR
FT                   G"
FT   CDS             complement(9989541..9989924)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147840"
FT                   /product="mCG147840"
FT                   /note="gene_id=mCG147840.0 transcript_id=mCT188103.0
FT                   protein_id=mCP108214.0"
FT                   /db_xref="MGI:MGI:3704372"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C9I8"
FT                   /protein_id="EDL24557.1"
FT                   /translation="MVGRDMGSGYLARCVATEEETICLSHDGDSGCLDCILEREANEMI
FT                   SHDQETGKSYPHLDTRRPKHSPTMTSGPTRVFPGHDLSAYLLSLLDSVQVNLQYVVLQP
FT                   PNEQSAVVCQEDAVHILVFIQPA"
FT   gene            10003661..10008387
FT                   /gene="Tmem4"
FT                   /locus_tag="mCG_18687"
FT                   /note="gene_id=mCG18687.1"
FT   mRNA            join(10003661..10003977,10004532..10004644,
FT                   10004786..10004901,10007264..10007467,10007777..10007873,
FT                   10008218..10008387)
FT                   /gene="Tmem4"
FT                   /locus_tag="mCG_18687"
FT                   /product="transmembrane protein 4"
FT                   /note="gene_id=mCG18687.1 transcript_id=mCT15229.1 created
FT                   on 09-AUG-2002"
FT   CDS             join(10004557..10004644,10004786..10004901,
FT                   10007264..10007467,10007777..10007873,10008218..10008261)
FT                   /codon_start=1
FT                   /gene="Tmem4"
FT                   /locus_tag="mCG_18687"
FT                   /product="transmembrane protein 4"
FT                   /note="gene_id=mCG18687.1 transcript_id=mCT15229.1
FT                   protein_id=mCP4479.2"
FT                   /protein_id="EDL24558.1"
FT                   /translation="MKGWGWLALLLGVLLGTAWARRSQDLHCGACRALVDELEWEIARV
FT                   DPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEVCDRMKEYGEQIDPSTHRKN
FT                   YVRVVSRNGESSELDLQGIRIDSDISGTLKFACESIVEEYEDELIEFFSREADNVKDKL
FT                   CSKRTDLCDHALHRSHDEL"
FT   assembly_gap    10010758..10010777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10013507..10013526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10018928..10042479
FT                   /locus_tag="mCG_18688"
FT                   /note="gene_id=mCG18688.2"
FT   mRNA            join(10018928..10019120,10030915..10030965,
FT                   10031595..10031702,10032361..10032426,10033854..10033985,
FT                   10034203..10034391,10039514..10039713,10040350..10040479,
FT                   10040614..10040715,10041124..10041333,10042148..10042479)
FT                   /locus_tag="mCG_18688"
FT                   /product="mCG18688"
FT                   /note="gene_id=mCG18688.2 transcript_id=mCT15230.1 created
FT                   on 09-AUG-2002"
FT   CDS             join(10019079..10019120,10030915..10030965,
FT                   10031595..10031702,10032361..10032426,10033854..10033985,
FT                   10034203..10034391,10039514..10039713,10040350..10040479,
FT                   10040614..10040715,10041124..10041333,10042148..10042312)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18688"
FT                   /product="mCG18688"
FT                   /note="gene_id=mCG18688.2 transcript_id=mCT15230.1
FT                   protein_id=mCP4485.1"
FT                   /protein_id="EDL24559.1"
FT                   /translation="MALLTAATRLLGAKNSSCLVLAARHASASSTNLKDVLSNLIPKEQ
FT                   ARIKTFKQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKM
FT                   LPKAKGGEEPLPEGLFWLLVTGQMPTEEQVSWLSREWAKRAALPSHVVTMLDNFPTNLH
FT                   PMSQLSAAITALNSESNFARAYAEGMNRAKYWELIYEDCMDLIAKLPCVAAKIYRNLYR
FT                   EGSSIGAIDSRLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSA
FT                   LSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGR
FT                   VVPGYGHAVLRKTDPRYSCQREFALKHLPKDPMFKLVAQLYKIVPNILLEQGKAKNPWP
FT                   NVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLM
FT                   KFVDSK"
FT   assembly_gap    10033247..10033284
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   gene            complement(10044274..10049897)
FT                   /locus_tag="mCG_18666"
FT                   /note="gene_id=mCG18666.1"
FT   mRNA            complement(join(10044274..10044971,10045585..10045686,
FT                   10046203..10046395,10049187..10049333,10049878..10049897))
FT                   /locus_tag="mCG_18666"
FT                   /product="mCG18666"
FT                   /note="gene_id=mCG18666.1 transcript_id=mCT15208.1 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(10044804..10044971,10045585..10045686,
FT                   10046203..10046395,10049187..10049333,10049878..10049882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18666"
FT                   /product="mCG18666"
FT                   /note="gene_id=mCG18666.1 transcript_id=mCT15208.1
FT                   protein_id=mCP4476.1"
FT                   /protein_id="EDL24560.1"
FT                   /translation="MRFLISCNLFLPRAAQALAAEAGLPHSRSFMGFAAPFTNKRKAYS
FT                   ERRIMGYSMQEMFEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVLERYTS
FT                   AVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPSYPRTCTVDFSISFEFRSLLHSQLA
FT                   TMFFDEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT"
FT   gene            <10058309..>10071874
FT                   /gene="Ankrd52"
FT                   /locus_tag="mCG_130553"
FT                   /note="gene_id=mCG130553.1"
FT   mRNA            join(<10058309..10058360,10058718..10058804,
FT                   10059240..10059339,10059505..10059575,10060534..10060734,
FT                   10061734..10061821,10062081..10062223,10062999..10063211,
FT                   10063488..10063566,10063785..10063899,10064054..10064136,
FT                   10064213..10064330,10064508..10064576,10064722..10064862,
FT                   10067254..10067365,10067562..10067633,10068112..10068313,
FT                   10068523..10068610,10068740..10068857,10069692..10069911,
FT                   10070054..10070141,10070240..10070323,10070401..10070546,
FT                   10070634..10070716,10070923..10071005,10071186..10071277,
FT                   10071624..>10071874)
FT                   /gene="Ankrd52"
FT                   /locus_tag="mCG_130553"
FT                   /product="ankyrin repeat domain 52"
FT                   /note="gene_id=mCG130553.1 transcript_id=mCT131878.1
FT                   created on 20-AUG-2002"
FT   assembly_gap    10058361..10058666
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   CDS             join(<10058718..10058804,10059240..10059339,
FT                   10059505..10059575,10060534..10060734,10061734..10061821,
FT                   10062081..10062223,10062999..10063211,10063488..10063566,
FT                   10063785..10063899,10064054..10064136,10064213..10064330,
FT                   10064508..10064576,10064722..10064862,10067254..10067365,
FT                   10067562..10067633,10068112..10068313,10068523..10068610,
FT                   10068740..10068857,10069692..10069911,10070054..10070141,
FT                   10070240..10070323,10070401..10070546,10070634..10070716,
FT                   10070923..10071005,10071186..10071277,10071624..10071874)
FT                   /codon_start=1
FT                   /gene="Ankrd52"
FT                   /locus_tag="mCG_130553"
FT                   /product="ankyrin repeat domain 52"
FT                   /note="gene_id=mCG130553.1 transcript_id=mCT131878.1
FT                   protein_id=mCP44412.1"
FT                   /protein_id="EDL24561.1"
FT                   /translation="QPPLVQAIFSRDVEEVRSLLSQKENINVLDQERRTPLHAAAYVGD
FT                   VPILQLLLMSGESGELGGANVNAKDTLWLTPLHRAAASRNEKVLGLLLAHSADVNARDK
FT                   LWQTPLHVAAANRATKCAEALAPLLSSLNVADRSGRSALHHAVHSGHLETVNLLLNKGA
FT                   SLNVCDKKERQPLHWAAFLGHLEVLKLLVARGADLSCKDRKGYGLLHTAAASGQIEVVK
FT                   HLLRMGAEIDEPNAFGNTALHIACYLGQDAVAIELVNAGANVNQPNDKGFTPLHVAAVS
FT                   TNGALCLELLVNNGADVNYQSKEGKSPLHMAAIHGRFTRSQILIQNGSEIDCADKFGNT
FT                   PLHVAARYGHELLISTLMTNGADTARRGIHDMFPLHLAVLFGFSDCCRKLLSSGQLYSI
FT                   VSSLSNEHVLSAGFDINTPDSLGRTCLHAAASGGNVECLNLLLSSGADLRRRDKFGRTP
FT                   LHYAAANGSYQCAVTLVTAGAGVNEADCKGCSPLHYAAASDTYRSCLEFLLDNGADPSL
FT                   RDRQGYTAVHYAAAYGNRQNLELLLEMSFNCLEDVESTVPVSPLHLAAYNGHCEALKTL
FT                   AETLVNLDVRDHKGRTALFLATERGSTECVEVLTAHGASALIKERKRKWTPLHAAAASG
FT                   HTDSLHLLIDSGERADITDVMDAYGQTPLMLAIMNGHVDCVHLLLEKGSTADAADLRGR
FT                   TALHRGAVTGCEDCLAALLDHDAFVLCRDFKGRTPIHLASACGHTAVLRTLLQAALSTD
FT                   PLDAGVDYSGYSPMHWASYTGHEDCLELLLEHSPFSYLEGNPFTPLHCAVINNQDSTTE
FT                   MLLGALGAKIVNSRDAKGRTPLHAAAFADNVSGLRMLLQHQAEVNATDHTGRTALMTAA
FT                   ESGQTAAVEFLLYRGKADLTVLDENKNTALHLACSKGHEKCALMILAETQDLGLINATN
FT                   SALQMPLHIAARNGLASVVQALLSRGATVLAVDEEGHTPALACAPNKDVADCLALILST
FT                   MKPFPPKDAVSPFSFSLLKNCGIAAAKTVGGCGALPHGASCPYSQERHGAIGLDGCYSE
FT                   "
FT   assembly_gap    10074471..10074493
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            complement(10076389..>10081697)
FT                   /gene="Slc39a5"
FT                   /locus_tag="mCG_18660"
FT                   /note="gene_id=mCG18660.3"
FT   mRNA            complement(join(10076389..10077355,10077631..10077821,
FT                   10077916..10077996,10078154..10078312,10078396..10078489,
FT                   10078853..10078993,10079234..10079403,10079571..10079733,
FT                   10080438..10080618,10080970..10081322,10081573..10081685))
FT                   /gene="Slc39a5"
FT                   /locus_tag="mCG_18660"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 5, transcript variant mCT15202"
FT                   /note="gene_id=mCG18660.3 transcript_id=mCT15202.2 created
FT                   on 20-AUG-2002"
FT   mRNA            complement(join(10077099..10077355,10077631..10077821,
FT                   10077916..10077996,10078154..10078312,10078396..10078489,
FT                   10078853..10078993,10079234..10079403,10079571..10079733,
FT                   10080438..10080618,10080970..10081322,10081600..>10081697))
FT                   /gene="Slc39a5"
FT                   /locus_tag="mCG_18660"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 5, transcript variant mCT191971"
FT                   /note="gene_id=mCG18660.3 transcript_id=mCT191971.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(10077099..10077355,10077631..10077821,
FT                   10077916..10077996,10078154..10078312,10078396..10078489,
FT                   10078853..10078993,10079234..10079403,10079571..10079733,
FT                   10080438..10080618,10080970..10081322,10081398..10081633))
FT                   /gene="Slc39a5"
FT                   /locus_tag="mCG_18660"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 5, transcript variant mCT172448"
FT                   /note="gene_id=mCG18660.3 transcript_id=mCT172448.0 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(10077212..10077355,10077631..10077821,
FT                   10077916..10077996,10078154..10078312,10078396..10078489,
FT                   10078853..10078993,10079234..10079403,10079571..10079733,
FT                   10080438..10080618,10080970..>10081289))
FT                   /codon_start=1
FT                   /gene="Slc39a5"
FT                   /locus_tag="mCG_18660"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 5, isoform CRA_b"
FT                   /note="gene_id=mCG18660.3 transcript_id=mCT191971.0
FT                   protein_id=mCP112936.0 isoform=CRA_b"
FT                   /protein_id="EDL24564.1"
FT                   /translation="KSETEPLTIALVMGPPVHHLLTGLCVGVALGWVGGSVPNLGPAEQ
FT                   EQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGHHEPPTGRAAPTSGDNF
FT                   THRLQEPELSVDIWAGMPLGPSGWGDQEESKAPDLHGSGPSSLDLFQRLLLLDHSLADH
FT                   LNEDCLNGSQLLVNFGLSPVAPLTPRQFALLCPALLYQIDSRVCIKTPAPAPPGDVLSA
FT                   LLHSGLAVLFLSLPAPLSLLLLRLLGPRLLRPVLGFLGALAVGTLCGDALLHLLPHAQG
FT                   GRHTGPSEQSEEDLGPGLSVLGGLFLLFMLENTLGLVRHRGLRPRCCRNKRDLGEPNPD
FT                   PEDGSGMVLRPLQAASEPEVQGQRENRQSSPSLAPPGHQGHSHEHRGGSIAWMVLLGDC
FT                   LHNLTDGLALGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQEGLSFRKLLLLSLV
FT                   SGALGLGGAALGVGLSLGPVPLTPWVFGTTAGVFLYVALVDMLPTLLRPPEPLPVFHVL
FT                   LQGLGLLLGGSLMFTIALLEEQLVPTVPDG"
FT   CDS             complement(join(10077212..10077355,10077631..10077821,
FT                   10077916..10077996,10078154..10078312,10078396..10078489,
FT                   10078853..10078993,10079234..10079403,10079571..10079733,
FT                   10080438..10080618,10080970..10081253))
FT                   /codon_start=1
FT                   /gene="Slc39a5"
FT                   /locus_tag="mCG_18660"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 5, isoform CRA_a"
FT                   /note="gene_id=mCG18660.3 transcript_id=mCT15202.2
FT                   protein_id=mCP4422.2 isoform=CRA_a"
FT                   /protein_id="EDL24562.1"
FT                   /translation="MGPPVHHLLTGLCVGVALGWVGGSVPNLGPAEQEQNHYLAQLFGL
FT                   YGENGTLTAGGLARLLHSLGLGRVQGLRLGHHEPPTGRAAPTSGDNFTHRLQEPELSVD
FT                   IWAGMPLGPSGWGDQEESKAPDLHGSGPSSLDLFQRLLLLDHSLADHLNEDCLNGSQLL
FT                   VNFGLSPVAPLTPRQFALLCPALLYQIDSRVCIKTPAPAPPGDVLSALLHSGLAVLFLS
FT                   LPAPLSLLLLRLLGPRLLRPVLGFLGALAVGTLCGDALLHLLPHAQGGRHTGPSEQSEE
FT                   DLGPGLSVLGGLFLLFMLENTLGLVRHRGLRPRCCRNKRDLGEPNPDPEDGSGMVLRPL
FT                   QAASEPEVQGQRENRQSSPSLAPPGHQGHSHEHRGGSIAWMVLLGDCLHNLTDGLALGA
FT                   AFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQEGLSFRKLLLLSLVSGALGLGGAALG
FT                   VGLSLGPVPLTPWVFGTTAGVFLYVALVDMLPTLLRPPEPLPVFHVLLQGLGLLLGGSL
FT                   MFTIALLEEQLVPTVPDG"
FT   CDS             complement(join(10077212..10077355,10077631..10077821,
FT                   10077916..10077996,10078154..10078312,10078396..10078489,
FT                   10078853..10078993,10079234..10079403,10079571..10079733,
FT                   10080438..10080618,10080970..10081253))
FT                   /codon_start=1
FT                   /gene="Slc39a5"
FT                   /locus_tag="mCG_18660"
FT                   /product="solute carrier family 39 (metal ion transporter),
FT                   member 5, isoform CRA_a"
FT                   /note="gene_id=mCG18660.3 transcript_id=mCT172448.0
FT                   protein_id=mCP95367.0 isoform=CRA_a"
FT                   /protein_id="EDL24563.1"
FT                   /translation="MGPPVHHLLTGLCVGVALGWVGGSVPNLGPAEQEQNHYLAQLFGL
FT                   YGENGTLTAGGLARLLHSLGLGRVQGLRLGHHEPPTGRAAPTSGDNFTHRLQEPELSVD
FT                   IWAGMPLGPSGWGDQEESKAPDLHGSGPSSLDLFQRLLLLDHSLADHLNEDCLNGSQLL
FT                   VNFGLSPVAPLTPRQFALLCPALLYQIDSRVCIKTPAPAPPGDVLSALLHSGLAVLFLS
FT                   LPAPLSLLLLRLLGPRLLRPVLGFLGALAVGTLCGDALLHLLPHAQGGRHTGPSEQSEE
FT                   DLGPGLSVLGGLFLLFMLENTLGLVRHRGLRPRCCRNKRDLGEPNPDPEDGSGMVLRPL
FT                   QAASEPEVQGQRENRQSSPSLAPPGHQGHSHEHRGGSIAWMVLLGDCLHNLTDGLALGA
FT                   AFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQEGLSFRKLLLLSLVSGALGLGGAALG
FT                   VGLSLGPVPLTPWVFGTTAGVFLYVALVDMLPTLLRPPEPLPVFHVLLQGLGLLLGGSL
FT                   MFTIALLEEQLVPTVPDG"
FT   assembly_gap    10085782..10085801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10085808..10091055)
FT                   /gene="Obfc2b"
FT                   /locus_tag="mCG_18683"
FT                   /note="gene_id=mCG18683.1"
FT   mRNA            complement(join(10085808..10086053,10089377..10089443,
FT                   10089539..10089620,10089758..10089829,10089921..10090059,
FT                   10090470..10090571,10090952..10091055))
FT                   /gene="Obfc2b"
FT                   /locus_tag="mCG_18683"
FT                   /product="oligonucleotide/oligosaccharide-binding fold
FT                   containing 2B"
FT                   /note="gene_id=mCG18683.1 transcript_id=mCT15225.1 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(10085854..10086053,10089377..10089443,
FT                   10089539..10089620,10089758..10089829,10089921..10090059,
FT                   10090470..10090548))
FT                   /codon_start=1
FT                   /gene="Obfc2b"
FT                   /locus_tag="mCG_18683"
FT                   /product="oligonucleotide/oligosaccharide-binding fold
FT                   containing 2B"
FT                   /note="gene_id=mCG18683.1 transcript_id=mCT15225.1
FT                   protein_id=mCP4473.2"
FT                   /protein_id="EDL24565.1"
FT                   /translation="MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVAD
FT                   KTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSE
FT                   VPNFSEPNPEYNTQQAPNKSVQNNDNSPTAPQATTGPPAASPASENQNGNGLSTQLGPV
FT                   GGPHPSHTPSHPPSTRITRSQPNHTPSGPPGPSSNPVSNGKETRRSSKR"
FT   gene            10096340..10121938
FT                   /gene="Rnf41"
FT                   /locus_tag="mCG_18662"
FT                   /note="gene_id=mCG18662.1"
FT   mRNA            join(10096340..10096523,10110336..10110448,
FT                   10116910..10117181,10118067..10118202,10118909..10119012,
FT                   10119684..10120060,10121166..10121938)
FT                   /gene="Rnf41"
FT                   /locus_tag="mCG_18662"
FT                   /product="ring finger protein 41, transcript variant
FT                   mCT15204"
FT                   /note="gene_id=mCG18662.1 transcript_id=mCT15204.2 created
FT                   on 20-AUG-2002"
FT   mRNA            join(<10096400..10096523,10110336..10110448,
FT                   10113952..10114072,10118067..10118202,10118909..10119012,
FT                   10119684..10120060,10120409..10121026)
FT                   /gene="Rnf41"
FT                   /locus_tag="mCG_18662"
FT                   /product="ring finger protein 41, transcript variant
FT                   mCT191975"
FT                   /note="gene_id=mCG18662.1 transcript_id=mCT191975.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    10109268..10109287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(10110359..10110448,10116910..10117181,
FT                   10118067..10118202,10118909..10119012,10119684..10120035)
FT                   /codon_start=1
FT                   /gene="Rnf41"
FT                   /locus_tag="mCG_18662"
FT                   /product="ring finger protein 41, isoform CRA_a"
FT                   /note="gene_id=mCG18662.1 transcript_id=mCT15204.2
FT                   protein_id=mCP4440.2 isoform=CRA_a"
FT                   /protein_id="EDL24566.1"
FT                   /translation="MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQ
FT                   WFSQQQTCPVDRSVVTVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLS
FT                   DCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRSVVQQQQSRIAELEKTSAEHKHQL
FT                   AEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPD
FT                   AVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIP
FT                   GKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI"
FT   CDS             join(<10114065..10114072,10118067..10118202,
FT                   10118909..10119012,10119684..10120035)
FT                   /codon_start=1
FT                   /gene="Rnf41"
FT                   /locus_tag="mCG_18662"
FT                   /product="ring finger protein 41, isoform CRA_b"
FT                   /note="gene_id=mCG18662.1 transcript_id=mCT191975.0
FT                   protein_id=mCP112937.0 isoform=CRA_b"
FT                   /protein_id="EDL24567.1"
FT                   /translation="QFSLEMPKDELPNHNCIKHLRSVVQQQQSRIAELEKTSAEHKHQL
FT                   AEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPARVTRWGGMISTPD
FT                   AVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRIP
FT                   GKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI"
FT   assembly_gap    10124588..10124607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10125784..10125803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10128640..10128659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10129926..10131372
FT                   /estimated_length=1447
FT                   /gap_type="unknown"
FT   assembly_gap    10133391..10134778
FT                   /estimated_length=1388
FT                   /gap_type="unknown"
FT   assembly_gap    10144288..10144657
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   gene            <10146353..10175448
FT                   /gene="Smarcc2"
FT                   /locus_tag="mCG_18663"
FT                   /note="gene_id=mCG18663.3"
FT   mRNA            join(<10146353..10146481,10147991..10148076,
FT                   10148702..10148783,10148877..10148969,10150167..10150236,
FT                   10150447..10150516,10153806..10153881,10154017..10154148,
FT                   10154253..10154368,10154676..10154800,10159212..10159271,
FT                   10159383..10159420,10159694..10159824,10160004..10160075,
FT                   10165171..10165284,10165672..10165825,10166904..10167023,
FT                   10167112..10167174,10167505..10167763,10167996..10168157,
FT                   10168412..10168476,10168900..10169035,10169118..10169284,
FT                   10170381..10170515,10172117..10172498,10172796..10172879,
FT                   10173758..10175034)
FT                   /gene="Smarcc2"
FT                   /locus_tag="mCG_18663"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily c, member 2,
FT                   transcript variant mCT191976"
FT                   /note="gene_id=mCG18663.3 transcript_id=mCT191976.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<10146353..10146481,10147991..10148076,
FT                   10148702..10148783,10148877..10148969,10150167..10150236,
FT                   10150447..10150516,10153806..10153881,10154017..10154148,
FT                   10154253..10154368,10154676..10154800,10159212..10159271,
FT                   10159383..10159420,10159694..10159824,10160004..10160075,
FT                   10165171..10165284,10165672..10165825,10166904..10167023,
FT                   10167112..10167174,10167505..10167763,10167996..10168157,
FT                   10168412..10168476,10168900..10169035,10169118..10169284,
FT                   10170381..10170515,10172117..10172498,10172796..10173221,
FT                   10173758..10174211)
FT                   /gene="Smarcc2"
FT                   /locus_tag="mCG_18663"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily c, member 2,
FT                   transcript variant mCT191977"
FT                   /note="gene_id=mCG18663.3 transcript_id=mCT191977.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<10146353..10146481,10147991..10148076,
FT                   10148702..10148783,10148877..10148969,10150167..10150236,
FT                   10150447..10150516,10153806..10153881,10154017..10154148,
FT                   10154253..10154368,10154676..10154800,10159212..10159271,
FT                   10159383..10159420,10159694..10159824,10160004..10160075,
FT                   10165171..10165284,10165672..10165825,10166904..10167023,
FT                   10167112..10167174,10167505..10167763,10167996..10168157,
FT                   10168412..10168476,10168900..10169035,10169118..10169284,
FT                   10170381..10170515,10172117..10172498,10172796..10173221,
FT                   10173758..10173834)
FT                   /codon_start=1
FT                   /gene="Smarcc2"
FT                   /locus_tag="mCG_18663"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily c, member 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG18663.3 transcript_id=mCT191977.0
FT                   protein_id=mCP112939.0 isoform=CRA_c"
FT                   /protein_id="EDL24570.1"
FT                   /translation="LPKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIK
FT                   CFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLS
FT                   RPNIFLCPEIEPKLLGKLKDIVKRHQGTISEDKSNASHVVYPVPGNLEEEEWVRPVMKR
FT                   DKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEED
FT                   YEVSDDKSPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKN
FT                   AKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKG
FT                   GTMTDLDEQDDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWF
FT                   DYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAG
FT                   DVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKPPQQ
FT                   SSASQQMLNFPEKGKEKPADMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLL
FT                   EALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQS
FT                   GNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVEEAAKVTGK
FT                   ADPAFGLESSGIAGTASDEPERIEESGTEEARPEGQAADEKKEPKEPREGGGAVEEEAK
FT                   EEISEVPKKDEEKGKEGDSEKESEKSDGDPIVDPEKDKEPTEGQEEVLKEVAEPEGERK
FT                   TKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRH
FT                   FEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQQPPT
FT                   LPPGSQPIPPTGAAGPPTVHGLAVPPAAVASAPPGSGAPPGSLGPSEQIGQAGTTAGPQ
FT                   QPQQAGAPQPGAVPPGVPPPGPHGPSPFPNQPTPPSMMPGAVPGSGHPGVAGNAPLGLP
FT                   FGMPPPPPAAPSVIPFGSLADSISINLPPPPNLHGHHHHLPFAPGTIPPPNLPVSMANP
FT                   LHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTA
FT                   PSPGTVTPVPPPQ"
FT   CDS             join(<10146353..10146481,10147991..10148076,
FT                   10148702..10148783,10148877..10148969,10150167..10150236,
FT                   10150447..10150516,10153806..10153881,10154017..10154148,
FT                   10154253..10154368,10154676..10154800,10159212..10159271,
FT                   10159383..10159420,10159694..10159824,10160004..10160075,
FT                   10165171..10165284,10165672..10165825,10166904..10167023,
FT                   10167112..10167174,10167505..10167763,10167996..10168157,
FT                   10168412..10168476,10168900..10169035,10169118..10169284,
FT                   10170381..10170515,10172117..10172498,10172796..10172879,
FT                   10173758..10173834)
FT                   /codon_start=1
FT                   /gene="Smarcc2"
FT                   /locus_tag="mCG_18663"
FT                   /product="SWI/SNF