spacer

EBI Dbfetch

ID   CH466576; SV 2; linear; genomic DNA; CON; MUS; 12378140 BP.
XX
AC   CH466576;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009805010 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-12378140
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-12378140
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-12378140
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 9fd012e2225cf92722ce47d4df98d4e1.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000228.
DR   Ensembl-Gn; ENSMUSG00000000003; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016382; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025056; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025058; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031202; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031402; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035491; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035651; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067684; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071738; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073085; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078315; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079525; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079536; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000003; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033543; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096389; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113969; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113976; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114054; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114057; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120286; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000137192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149863; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178974; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70978230.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12378140
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    2884..5824
FT                   /estimated_length=2941
FT                   /gap_type="unknown"
FT   assembly_gap    7048..8182
FT                   /estimated_length=1135
FT                   /gap_type="unknown"
FT   gene            9184..19520
FT                   /locus_tag="mCG_112836"
FT                   /note="gene_id=mCG112836.0"
FT   mRNA            join(9184..9224,13799..13935,14740..14809,15643..15677,
FT                   17050..17167,17985..18085,19418..19520)
FT                   /locus_tag="mCG_112836"
FT                   /product="mCG112836, transcript variant mCT113908"
FT                   /note="gene_id=mCG112836.0 transcript_id=mCT113908.1
FT                   created on 15-MAY-2002"
FT   mRNA            join(9319..9364,13799..14061,14740..14809,15643..15677,
FT                   17050..17167,17985..18085,19418..19519)
FT                   /locus_tag="mCG_112836"
FT                   /product="mCG112836, transcript variant mCT169397"
FT                   /note="gene_id=mCG112836.0 transcript_id=mCT169397.0
FT                   created on 15-MAY-2002"
FT   assembly_gap    11917..11936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(13830..13935,14740..14809,15643..15677,17050..17167,
FT                   17985..18075)
FT                   /codon_start=1
FT                   /locus_tag="mCG_112836"
FT                   /product="mCG112836, isoform CRA_a"
FT                   /note="gene_id=mCG112836.0 transcript_id=mCT113908.1
FT                   protein_id=mCP66612.1 isoform=CRA_a"
FT                   /protein_id="EDL29239.1"
FT                   /translation="MSSRERMATDTAGRHSRMDPNLSSDDSQNPGAVDAANREVLDAGR
FT                   EDITSSGTERQQARKEKQDLVQEFEESPNKVLQENRERFSRIMTSSFSAIEVKIKDVLK
FT                   TQCEQRQKLCKEYSLQVTNLSRKLTSDAYKLKKQA"
FT   CDS             join(13903..14061,14740..14809,15643..15677,17050..17103)
FT                   /codon_start=1
FT                   /locus_tag="mCG_112836"
FT                   /product="mCG112836, isoform CRA_b"
FT                   /note="gene_id=mCG112836.0 transcript_id=mCT169397.0
FT                   protein_id=mCP92177.0 isoform=CRA_b"
FT                   /protein_id="EDL29240.1"
FT                   /translation="MTARTQVQSMQVKNRRQQQNQNYIMKKTHKQTNQRGCQRAVSTPS
FT                   RHPKIPWHLTEKSLMLVGRTLLPQEQRGNRPGRKNRIWSKNSKSHLTKFFRKTEKDSQG
FT                   S"
FT   assembly_gap    14448..14726
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    20347..35788
FT                   /estimated_length=15442
FT                   /gap_type="unknown"
FT   gene            35936..40942
FT                   /locus_tag="mCG_112838"
FT                   /note="gene_id=mCG112838.0"
FT   mRNA            join(35936..36065,36751..36819,38637..38754,39592..39654,
FT                   40843..40942)
FT                   /locus_tag="mCG_112838"
FT                   /product="mCG112838"
FT                   /note="gene_id=mCG112838.0 transcript_id=mCT113910.1
FT                   created on 15-MAY-2002"
FT   CDS             join(35969..36065,36751..36819,38637..38754,39592..39604)
FT                   /codon_start=1
FT                   /locus_tag="mCG_112838"
FT                   /product="mCG112838"
FT                   /note="gene_id=mCG112838.0 transcript_id=mCT113910.1
FT                   protein_id=mCP66624.1"
FT                   /protein_id="EDL29238.1"
FT                   /translation="MASKIKGRPPKQPKVTPALPSEDSQQLHENNPGNNLALETCGESS
FT                   SSHGTGGPKPGPSKKTLNERKRKYGVSVSKTVQNIEWNVDHFLKVQHERRLWL"
FT   assembly_gap    39301..39591
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    41546..45282
FT                   /estimated_length=3737
FT                   /gap_type="unknown"
FT   gene            <49641..>50753
FT                   /locus_tag="mCG_1035527"
FT                   /note="gene_id=mCG1035527.1"
FT   mRNA            join(<49641..49993,50304..50432,50609..>50753)
FT                   /locus_tag="mCG_1035527"
FT                   /product="mCG1035527"
FT                   /note="gene_id=mCG1035527.1 transcript_id=mCT153231.1
FT                   created on 15-MAY-2002"
FT   CDS             join(49641..49993,50304..50432,50609..50753)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035527"
FT                   /product="mCG1035527"
FT                   /note="gene_id=mCG1035527.1 transcript_id=mCT153231.1
FT                   protein_id=mCP66656.1"
FT                   /db_xref="InterPro:IPR015419"
FT                   /db_xref="MGI:MGI:3644285"
FT                   /db_xref="UniProtKB/TrEMBL:A3KG45"
FT                   /protein_id="EDL29237.1"
FT                   /translation="MQNPVEGLDGRAGLEEGEDSQLRPQAPDAQASSQNSATEGDHGNV
FT                   PQSCPQDSGRPAAPGTLATPGSQAAPGSPSPGSTVGSGAAAEEAAVIPHSEQATLVPGP
FT                   SGDAASTGNRSLEFSVTVPFRTAVEADMARRSLVANAHPQQVMVQQEFTANDSILAVRW
FT                   TTDDPFLFRISINTFLDQLSLVMRNIQRLEFVAVVKRGRGRSRES"
FT   assembly_gap    51875..51894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    55649..56295
FT                   /estimated_length=647
FT                   /gap_type="unknown"
FT   gene            complement(<59183..>60373)
FT                   /locus_tag="mCG_1035526"
FT                   /note="gene_id=mCG1035526.1"
FT   mRNA            complement(join(<59183..59324,59501..59629,60048..>60373))
FT                   /locus_tag="mCG_1035526"
FT                   /product="mCG1035526"
FT                   /note="gene_id=mCG1035526.1 transcript_id=mCT153230.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(59183..59324,59501..59629,60048..60373))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035526"
FT                   /product="mCG1035526"
FT                   /note="gene_id=mCG1035526.1 transcript_id=mCT153230.1
FT                   protein_id=mCP66653.1"
FT                   /protein_id="EDL29236.1"
FT                   /translation="MQDPGEDNAGGSTGVDEGSEDGQHRPQAAGAQASSQSLATEDDHD
FT                   NSPLESGLQDAGSEAAPGNSRSGSPGVSGMSAEEAAVLPQEEQVPLLPGPSRDAVTTAS
FT                   RLLEFSVRVPFSSAVEADMARRSLVANTQHQLLMVPQEYTVNDSILAVRWTTEDPVLFR
FT                   ISINNFLDQLSLVMRNIQHLQFVAFKRRRERSRNN"
FT   assembly_gap    66871..66890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    76778..76797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    79464..79483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(79891..175701)
FT                   /gene="Gab3"
FT                   /locus_tag="mCG_55100"
FT                   /note="gene_id=mCG55100.1"
FT   mRNA            complement(join(79891..80175,81393..81509,91194..91329,
FT                   93080..93161,95593..95800,96585..96640,115941..116419,
FT                   117152..117368,124403..124706,175462..175701))
FT                   /gene="Gab3"
FT                   /locus_tag="mCG_55100"
FT                   /product="growth factor receptor bound protein 2-associated
FT                   protein 3"
FT                   /note="gene_id=mCG55100.1 transcript_id=mCT55283.2 created
FT                   on 15-MAY-2002"
FT   CDS             complement(join(80059..80175,81393..81509,91194..91329,
FT                   93080..93161,95593..95800,96585..96640,115941..116419,
FT                   117152..117368,124403..124706,175462..175533))
FT                   /codon_start=1
FT                   /gene="Gab3"
FT                   /locus_tag="mCG_55100"
FT                   /product="growth factor receptor bound protein 2-associated
FT                   protein 3"
FT                   /note="gene_id=mCG55100.1 transcript_id=mCT55283.2
FT                   protein_id=mCP34213.2"
FT                   /protein_id="EDL29235.1"
FT                   /translation="MSTGDTVCMGWLIKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVL
FT                   EYYRNKHSNKPIRVIDLSECTVWKHAGPGFIRKEFQKNFVFIVKTTSRTFYLVAKTEEE
FT                   MQVWVHSISQVCNFSHLEDGADSMESLSHMPSSFQPSPASSLHTVHVANSALLKDDRNT
FT                   NSVVTEETRRESEFLFLPDYLILSNCETGRLHHASLPTRCDSWSNSNHSLAQTSFDDVF
FT                   LDGLQPFISNNLVHPLHHGKVSQDFPSIRPQASLIWNREINGPSRNLMSSSPLLESSLN
FT                   PTVHVEEKQVSLPSGVKELNIMSNTPPPRPPKPSYLSEQRQDQPLLTGHSSNKKPGYTM
FT                   VPRRISLSGLDHVGSWKGDVQSQSLRHRDKRLSLNLPCKFSPIYPTASPSAEDSYVPMS
FT                   PKGTASELRPHCSQDDYIPMSSSMLPELPADLEPPPVNRNLKPQRKSRPPPLDSRNLST
FT                   IQEHTSLTRTYTVPCNRTSFLSPQRNGINCARLFSTPSEEEEEEEEEEEEEEEEEKYIQ
FT                   MEEYGTVSSLSRSALSWTKKFSLDYLALDFNSTSPAPVQKKLLLSEEQRVDYVQVDEQK
FT                   TQALRSTKQEWTDERQSKV"
FT   assembly_gap    88679..88698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    92766..92785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    108424..108622
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    112648..112667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    121850..121869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    124141..124160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    149716..150576
FT                   /estimated_length=861
FT                   /gap_type="unknown"
FT   assembly_gap    156334..156497
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    163586..163767
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    170007..170026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    173051..173142
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    175843..175894
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    182249..182268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            186596..200689
FT                   /locus_tag="mCG_7986"
FT                   /note="gene_id=mCG7986.1"
FT   mRNA            join(186596..186845,187552..187619,188001..188087,
FT                   189144..189235,189445..189629,190712..190776,
FT                   191115..191241,191665..191795,193094..193237,
FT                   195012..195133,196346..196464,196970..197073,
FT                   197864..197942,198871..198996,199388..200689)
FT                   /locus_tag="mCG_7986"
FT                   /product="mCG7986"
FT                   /note="gene_id=mCG7986.1 transcript_id=mCT7292.2 created on
FT                   15-MAY-2002"
FT   CDS             join(186830..186845,187552..187619,188001..188087,
FT                   189144..189235,189445..189629,190712..190776,
FT                   191115..191241,191665..191795,193094..193237,
FT                   195012..195133,196346..196385)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7986"
FT                   /product="mCG7986"
FT                   /note="gene_id=mCG7986.1 transcript_id=mCT7292.2
FT                   protein_id=mCP12566.2"
FT                   /protein_id="EDL29234.1"
FT                   /translation="MADAEVITFPKKHKKKKDRKPLQEDDVAEIQHAEEFLIKPESKVA
FT                   QLDTSQWPLLLKNFDKLNVRTAHYTPLPCGSNPLKREIGDYIRTGFINLDKPSNPSSHE
FT                   VVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAI
FT                   EGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEA
FT                   GTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESY
FT                   LRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGLLRYEDGIEVNQEIVVITTKG
FT                   EAICMGNCIDDYSSDFYL"
FT   assembly_gap    188282..188301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    195134..195153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(199505..221700)
FT                   /gene="Mpp1"
FT                   /locus_tag="mCG_7985"
FT                   /note="gene_id=mCG7985.2"
FT   mRNA            complement(join(199505..201535,202619..202693,
FT                   202891..203093,204297..204377,204945..205025,
FT                   206766..206872,208466..208662,212212..212280,
FT                   214540..214625,216015..216093,216381..216524,
FT                   221419..221700))
FT                   /gene="Mpp1"
FT                   /locus_tag="mCG_7985"
FT                   /product="membrane protein, palmitoylated"
FT                   /note="gene_id=mCG7985.2 transcript_id=mCT7291.2 created on
FT                   15-MAY-2002"
FT   CDS             complement(join(201359..201535,202619..202693,
FT                   202891..203093,204297..204377,204945..205025,
FT                   206766..206872,208466..208662,212212..212280,
FT                   214540..214625,216015..216093,216381..216524,
FT                   221419..221520))
FT                   /codon_start=1
FT                   /gene="Mpp1"
FT                   /locus_tag="mCG_7985"
FT                   /product="membrane protein, palmitoylated"
FT                   /note="gene_id=mCG7985.2 transcript_id=mCT7291.2
FT                   protein_id=mCP12565.2"
FT                   /db_xref="GOA:Q542P4"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:105941"
FT                   /db_xref="UniProtKB/TrEMBL:Q542P4"
FT                   /protein_id="EDL29233.1"
FT                   /translation="MTLKSSEGEGGNSMRTALSDLYLEHLLQKRNRPETSLNQSNVTTE
FT                   DMYTNGSPAPGSPAHAKGQEARRVRLIQFEKITEEPMGITLKLNEKQSCTVARILHGGM
FT                   IHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIANQQSRLPALQMFM
FT                   RAQFDYDPQKDNLIPCKEAGLKFVTGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPE
FT                   LQEWRVASVAHSAPSEAPSCSPFGKKKKCKDKYLAKHSSIFDQLDVVSYEEVVRLPAFK
FT                   RKTLVLIGASGVGRSHIKNGLLSHNPEKFAYPAPYTTRPPKKSEEDGKEYHFISTEEMT
FT                   KNISANEFLEFGSYQGNMFGTKFETVHQIHKQDKIAILDIEPQTLKTVRTAELSPFIVF
FT                   IAPTDQGTQTEALQQLQKDSEAIRSQYAHYFDLSLVNNSVDETLKKLQEAFDQACSSPQ
FT                   WVPVSWVY"
FT   assembly_gap    204008..204053
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    210304..210417
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    213251..213298
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    217396..217415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    224876..224895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    226293..226312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    231470..231489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    232630..233141
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   gene            233707..235876
FT                   /locus_tag="mCG_112839"
FT                   /note="gene_id=mCG112839.1"
FT   mRNA            233707..235876
FT                   /locus_tag="mCG_112839"
FT                   /product="mCG112839"
FT                   /note="gene_id=mCG112839.1 transcript_id=mCT113911.1
FT                   created on 15-MAY-2002"
FT   CDS             234195..234977
FT                   /codon_start=1
FT                   /locus_tag="mCG_112839"
FT                   /product="mCG112839"
FT                   /note="gene_id=mCG112839.1 transcript_id=mCT113911.1
FT                   protein_id=mCP66629.1"
FT                   /protein_id="EDL29232.1"
FT                   /translation="MKAGRGTLGVCLAKQSQGGDPDKLACGLKKRSQKRNPSPSVVPSW
FT                   TDQPVADSHGKSRAMAAAASEMKHGQSKASLLCYGGFKVLQSLKGSMGRNSTPAASLGK
FT                   AVALSPAPSEEQLAGMSRGIGDALGSDWPGREPRTTDNRGQYLKGESWVSGWPGHPKLR
FT                   EVGFLRGEPLSAVPKGLGIWSELSHRYSELCQLHYAYPYYKVLPEGELRRVSLDCFNPV
FT                   LSEETVEDEKTLKYFRWSADSRGVTGSAIFQISKSLMP"
FT   gene            complement(236564..253816)
FT                   /locus_tag="mCG_66008"
FT                   /note="gene_id=mCG66008.2"
FT   mRNA            complement(join(236564..236755,239642..239739,
FT                   240244..240354,251551..251755,253775..253816))
FT                   /locus_tag="mCG_66008"
FT                   /product="mCG66008"
FT                   /note="gene_id=mCG66008.2 transcript_id=mCT66191.2 created
FT                   on 15-MAY-2002"
FT   CDS             complement(join(236741..236755,239642..239739,
FT                   240244..240354,251551..251740))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66008"
FT                   /product="mCG66008"
FT                   /note="gene_id=mCG66008.2 transcript_id=mCT66191.2
FT                   protein_id=mCP41817.2"
FT                   /protein_id="EDL29231.1"
FT                   /translation="MKPLKLFCIGLLLCPLVCLLLETAPPPSALLTLEVKEKTGLKSDA
FT                   MGVFAIRKNTSDINRQVSGLQRPWMTKFKNHLSDFFKSSIPPAAIFALFVTTAIMRAAI
FT                   VNKRLEEPHRQWTIDQRSSLEMQNMNLIKLFGG"
FT   assembly_gap    237349..237368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    243443..246715
FT                   /estimated_length=3273
FT                   /gap_type="unknown"
FT   assembly_gap    249213..249793
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   gene            complement(262839..466825)
FT                   /gene="F8"
FT                   /locus_tag="mCG_140395"
FT                   /note="gene_id=mCG140395.0"
FT   mRNA            complement(join(262839..263129,295596..295772,
FT                   296602..296750,297150..297294,342665..342820,
FT                   351005..351090,352652..352723,353425..353541,
FT                   354453..354635,354810..355038,355515..355724,
FT                   358392..358545,376691..379703,387314..387523,
FT                   407756..407906,414199..414413,420925..421018,
FT                   421955..422126,423066..423324,424516..424737,
FT                   425261..425377,428784..428852,444651..444863,
FT                   452858..452980,454870..454991,466271..466825))
FT                   /gene="F8"
FT                   /locus_tag="mCG_140395"
FT                   /product="coagulation factor VIII"
FT                   /note="gene_id=mCG140395.0 transcript_id=mCT169401.0
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(262974..263129,295596..295772,
FT                   296602..296750,297150..297294,342665..342820,
FT                   351005..351090,352652..352723,353425..353541,
FT                   354453..354635,354810..355038,355515..355724,
FT                   358392..358545,376691..379703,387314..387523,
FT                   407756..407906,414199..414413,420925..421018,
FT                   421955..422126,423066..423324,424516..424737,
FT                   425261..425377,428784..428852,444651..444863,
FT                   452858..452980,454870..454991,466271..466416))
FT                   /codon_start=1
FT                   /gene="F8"
FT                   /locus_tag="mCG_140395"
FT                   /product="coagulation factor VIII"
FT                   /note="gene_id=mCG140395.0 transcript_id=mCT169401.0
FT                   protein_id=mCP92174.0"
FT                   /db_xref="GOA:Q06194"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR014707"
FT                   /db_xref="InterPro:IPR024715"
FT                   /db_xref="MGI:MGI:88383"
FT                   /protein_id="EDL29229.1"
FT                   /translation="MQIALFACFFLSLFNFCSSAIRRYYLGAVELSWNYIQSDLLSVLH
FT                   TDSRFLPRMSTSFPFNTSIMYKKTVFVEYKDQLFNIAKPRPPWMGLLGPTIWTEVHDTV
FT                   VITLKNMASHPVSLHAVGVSYWKASEGDEYEDQTSQMEKEDDKVFPGESHTYVWQVLKE
FT                   NGPMASDPPCLTYSYMSHVDLVKDLNSGLIGALLVCKEGSLSKERTQMLYQFVLLFAVF
FT                   DEGKSWHSETNDSYTQSMDSASARDWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMG
FT                   TTPEIHSIFLEGHTFFVRNHRQASLEISPITFLTAQTLLIDLGQFLLFCHISSHKHDGM
FT                   EAYVKVDSCPEESQWQKKNNNEEMEDYDDDLYSEMDMFTLDYDSSPFIQIRSVAKKYPK
FT                   TWIHYISAEEEDWDYAPSVPTSDNGSYKSQYLSNGPHRIGRKYKKVRFIAYTDETFKTR
FT                   ETIQHESGLLGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVSPLHARRLPRGIKHV
FT                   KDLPIHPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFINPERDLASGLIGPLLICYKE
FT                   SVDQRGNQMMSDKRNVILFSIFDENQSWYITENMQRFLPNAAKTQPQDPGFQASNIMHS
FT                   INGYVFDSLELTVCLHEVAYWHILSVGAQTDFLSIFFSGYTFKHKMVYEDTLTLFPFSG
FT                   ETVFMSMENPGLWVLGCHNSDFRKRGMTALLKVSSCDKSTSDYYEEIYEDIPTQLVNEN
FT                   NVIDPRSFFQNTNHPNTRKKKFKDSTIPKNDMEKIEPQFEEIAEMLKVQSVSVSDMLML
FT                   LGQSHPTPHGLFLSDGQEAIYEAIHDDHSPNAIDSNEGPSKVTQLRPESHHSEKIVFTP
FT                   QPGLQLRSNKSLETTIEVKWKKLGLQVSSLPSNLMTTTILSDNLKATFEKTDSSGFPDM
FT                   PVHSSSKLSTTAFGKKAYSLVGSHVPLNVSEENSDSNILDSTLMYSQESLPRDNILSME
FT                   NDRLLREKRFHGIALLTKDNTLFKDNVSLMKTNKTYNHSTTNEKLHTESPTSIENSTTD
FT                   LQDAILKVNSEIQEVTALIHDGTLLGKNSTYLRLNHMLNRTTSTKNKDIFHRKDEDPIP
FT                   QDEENTIMPFSKMLFLSESSNWFKKTNGNNSLNSEQEHSPKQLVYLMFKKYVKNQSFLS
FT                   EKNKVTVEQDGFTKNIGLKDMAFPHNMSIFLTTLSNVHENGRHNQEKNIQEEIEKEALI
FT                   EEKVVLPQVHEATGSKNFLKDILILGTRQNISLYEVHVPVLQNITSINNSTNTVQIHME
FT                   HFFKRRKDKETNSEGLVNKTREMVKNYPSQKNITTQRSKRALGQFRLSTQWLKTINCST
FT                   QCIIKQIDHSKEMKKFITKSSLSDSSVIKSTTQTNSSDSHIVKTSAFPPIDLKRSPFQN
FT                   KFSHVQASSYIYDFKTKSSRIQESNNFLKETKINNPSLAILPWNMFIDQGKFTSPGKSN
FT                   TNSVTYKKRENIIFLKPTLPEESGKIELLPQVSIQEEEILPTETSHGSPGHLNLMKEVF
FT                   LQKIQGPTKWNKAKRHGESIKGKTESSKNTRSKLLNHHAWDYHYAAQIPKDMWKSKEKS
FT                   PEIISIKQEDTILSLRPHGNSHSIGANEKQNWPQRETTWVKQGQTQRTCSQIPPVLKRH
FT                   QRELSAFQSEQEATDYDDAITIETIEDFDIYSEDIKQGPRSFQQKTRHYFIAAVERLWD
FT                   YGMSTSHVLRNRYQSDNVPQFKKVVFQEFTDGSFSQPLYRGELNEHLGLLGPYIRAEVE
FT                   DNIMVTFKNQASRPYSFYSSLISYKEDQRGEEPRRNFVKPNETKIYFWKVQHHMAPTED
FT                   EFDCKAWAYFSDVDLERDMHSGLIGPLLICHANTLNPAHGRQVSVQEFALLFTIFDETK
FT                   SWYFTENVKRNCKTPCNFQMEDPTLKENYRFHAINGYVMDTLPGLVMAQDQRIRWYLLS
FT                   MGNNENIQSIHFSGHVFTVRKKEEYKMAVYNLYPGVFETLEMIPSRAGIWRVECLIGEH
FT                   LQAGMSTLFLVYSKQCQIPLGMASGSIRDFQITASGHYGQWAPNLARLHYSGSINAWST
FT                   KEPFSWIKVDLLAPMIVHGIKTQGARQKFSSLYISQFIIMYSLDGKKWLSYQGNSTGTL
FT                   MVFFGNVDSSGIKHNSFNPPIIARYIRLHPTHSSIRSTLRMELMGCDLNSCSIPLGMES
FT                   KVISDTQITASSYFTNMFATWSPSQARLHLQGRTNAWRPQVNDPKQWLQVDLQKTMKVT
FT                   GIITQGVKSLFTSMFVKEFLISSSQDGHHWTQILYNGKVKVFQGNQDSSTPMMNSLDPP
FT                   LLTRYLRIHPQIWEHQIALRLEILGCEAQQQY"
FT   assembly_gap    263862..263881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    266248..266267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    268171..270121
FT                   /estimated_length=1951
FT                   /gap_type="unknown"
FT   assembly_gap    277184..277208
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    283710..284582
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   assembly_gap    300537..305354
FT                   /estimated_length=4818
FT                   /gap_type="unknown"
FT   assembly_gap    309460..310086
FT                   /estimated_length=627
FT                   /gap_type="unknown"
FT   assembly_gap    311583..311602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    313450..313549
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    318342..318443
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    319111..319222
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    325191..325613
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   gene            325618..328135
FT                   /locus_tag="mCG_112831"
FT                   /note="gene_id=mCG112831.1"
FT   mRNA            325618..328135
FT                   /locus_tag="mCG_112831"
FT                   /product="mCG112831"
FT                   /note="gene_id=mCG112831.1 transcript_id=mCT113903.1
FT                   created on 15-MAY-2002"
FT   CDS             325639..326724
FT                   /codon_start=1
FT                   /locus_tag="mCG_112831"
FT                   /product="mCG112831"
FT                   /note="gene_id=mCG112831.1 transcript_id=mCT113903.1
FT                   protein_id=mCP66595.1"
FT                   /protein_id="EDL29230.1"
FT                   /translation="MDDFRTSAPEPRGPPNPNVEYIPFDEMKGRILKIVTGFNGIPFTI
FT                   QRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCVCPSSEKNNSNSLNRMNGVMFPGNSP
FT                   NYTDRSNINGPGTPRPLNRPKLSLSAPLTTNGLPESTDSKDSELQLSEEKGHSDSSASE
FT                   SEVSLLSPVKNKHPDEDAVESEEHEVKRLKFDKEGDVRETASQTVSGEVSSVRAEETET
FT                   AIPPPDKDRESRTRQHCTEEEEEEEEEEEEEEEESFMTPREMVPERKNQEKESDDTLTV
FT                   NEETSEESHQMEGSGVSPAQTDSTSERSDSAGASRSGSDCLETQESGGPPSSKTGESVS
FT                   VPSSMENEEATEVTDDPMEQD"
FT   assembly_gap    335895..335914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    339123..339441
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    357523..357611
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   gene            complement(361977..363496)
FT                   /pseudo
FT                   /locus_tag="mCG_3673"
FT                   /note="gene_id=mCG3673.2"
FT   mRNA            complement(361977..363496)
FT                   /pseudo
FT                   /locus_tag="mCG_3673"
FT                   /note="gene_id=mCG3673.2 transcript_id=mCT3184.2 created on
FT                   15-MAY-2002"
FT   assembly_gap    370414..370433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    371668..372674
FT                   /estimated_length=1007
FT                   /gap_type="unknown"
FT   assembly_gap    376474..376547
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    380631..381203
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    394651..401331
FT                   /estimated_length=6681
FT                   /gap_type="unknown"
FT   assembly_gap    412319..412338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    417175..417624
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    431595..431614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    447441..448031
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    449058..449077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    453299..454311
FT                   /estimated_length=1013
FT                   /gap_type="unknown"
FT   assembly_gap    457111..457130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    468219..468245
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   gene            469061..482146
FT                   /gene="Fundc2"
FT                   /locus_tag="mCG_17121"
FT                   /note="gene_id=mCG17121.3"
FT   mRNA            join(469061..469090,473746..473896,477428..477503,
FT                   478284..478415,480954..482146)
FT                   /gene="Fundc2"
FT                   /locus_tag="mCG_17121"
FT                   /product="FUN14 domain containing 2"
FT                   /note="gene_id=mCG17121.3 transcript_id=mCT16225.3 created
FT                   on 13-JUN-2003"
FT   CDS             join(469072..469090,473746..473896,477428..477503,
FT                   478284..478415,480954..481031)
FT                   /codon_start=1
FT                   /gene="Fundc2"
FT                   /locus_tag="mCG_17121"
FT                   /product="FUN14 domain containing 2"
FT                   /note="gene_id=mCG17121.3 transcript_id=mCT16225.3
FT                   protein_id=mCP17163.2"
FT                   /protein_id="EDL29228.1"
FT                   /translation="MAANSQGNFDGKFEALDLAELTKKQPWWRKLFGQESGPSAEKYSV
FT                   ATQLVIGGVTGWCTGFVFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMKKA
FT                   KEQLKIRKNKQIPTEVKSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS"
FT   assembly_gap    482705..482724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    483934..483953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(492635..504444)
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /note="gene_id=mCG17122.2"
FT   mRNA            complement(join(492635..493077,497404..497471,
FT                   503871..504400))
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /product="mature T-cell proliferation 1, transcript variant
FT                   mCT16226"
FT                   /note="gene_id=mCG17122.2 transcript_id=mCT16226.1 created
FT                   on 15-MAY-2002"
FT   mRNA            complement(join(492635..493077,497404..497884))
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /product="mature T-cell proliferation 1, transcript variant
FT                   mCT169404"
FT                   /note="gene_id=mCG17122.2 transcript_id=mCT169404.0 created
FT                   on 15-MAY-2002"
FT   CDS             complement(join(492929..493077,497404..497461))
FT                   /codon_start=1
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /product="mature T-cell proliferation 1, isoform CRA_b"
FT                   /note="gene_id=mCG17122.2 transcript_id=mCT16226.1
FT                   protein_id=mCP17162.1 isoform=CRA_b"
FT                   /db_xref="GOA:A3KGA5"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="InterPro:IPR027179"
FT                   /db_xref="MGI:MGI:102699"
FT                   /db_xref="UniProtKB/TrEMBL:A3KGA5"
FT                   /protein_id="EDL29225.1"
FT                   /translation="MPQKDPCQKQACEIQKCLQANNYLESKCQAVIQELRKCCARYPKG
FT                   RSLVCSGFEKEEEEKLAMKSGSK"
FT   CDS             complement(join(492929..493077,497404..497461))
FT                   /codon_start=1
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /product="mature T-cell proliferation 1, isoform CRA_b"
FT                   /note="gene_id=mCG17122.2 transcript_id=mCT169404.0
FT                   protein_id=mCP92173.0 isoform=CRA_b"
FT                   /db_xref="GOA:A3KGA5"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="InterPro:IPR027179"
FT                   /db_xref="MGI:MGI:102699"
FT                   /db_xref="UniProtKB/TrEMBL:A3KGA5"
FT                   /protein_id="EDL29227.1"
FT                   /translation="MPQKDPCQKQACEIQKCLQANNYLESKCQAVIQELRKCCARYPKG
FT                   RSLVCSGFEKEEEEKLAMKSGSK"
FT   mRNA            complement(join(498300..498989,499076..499127,
FT                   499210..499380,499493..499644,503871..504069,
FT                   504394..504444))
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /product="mature T-cell proliferation 1, transcript variant
FT                   mCT169405"
FT                   /note="gene_id=mCG17122.2 transcript_id=mCT169405.0 created
FT                   on 15-MAY-2002"
FT   mRNA            complement(join(498300..498989,499076..499127,
FT                   499210..499380,499493..499644,503871..504400))
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /product="mature T-cell proliferation 1, transcript variant
FT                   mCT123954"
FT                   /note="gene_id=mCG17122.2 transcript_id=mCT123954.1 created
FT                   on 15-MAY-2002"
FT   CDS             complement(join(499080..499127,499210..499380,
FT                   499493..499597))
FT                   /codon_start=1
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /product="mature T-cell proliferation 1, isoform CRA_a"
FT                   /note="gene_id=mCG17122.2 transcript_id=mCT123954.1
FT                   protein_id=mCP66681.1 isoform=CRA_a"
FT                   /protein_id="EDL29224.1"
FT                   /translation="MAREDVGAPPDHLWVHQEGVYRDEYQRTWVAVVEEETSFLKARVQ
FT                   QVQVPLGDATKPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLL
FT                   PDD"
FT   CDS             complement(join(499080..499127,499210..499380,
FT                   499493..499597))
FT                   /codon_start=1
FT                   /gene="Mtcp1"
FT                   /locus_tag="mCG_17122"
FT                   /product="mature T-cell proliferation 1, isoform CRA_a"
FT                   /note="gene_id=mCG17122.2 transcript_id=mCT169405.0
FT                   protein_id=mCP92175.0 isoform=CRA_a"
FT                   /protein_id="EDL29226.1"
FT                   /translation="MAREDVGAPPDHLWVHQEGVYRDEYQRTWVAVVEEETSFLKARVQ
FT                   QVQVPLGDATKPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLL
FT                   PDD"
FT   gene            504543..539675
FT                   /gene="Brcc3"
FT                   /locus_tag="mCG_17123"
FT                   /note="gene_id=mCG17123.1"
FT   mRNA            join(504543..504697,505433..505449,506267..506321,
FT                   510635..510756,523537..523622,524176..524264,
FT                   526006..526061,535381..535512,536028..536071,
FT                   538194..538370,538909..539675)
FT                   /gene="Brcc3"
FT                   /locus_tag="mCG_17123"
FT                   /product="BRCA1/BRCA2-containing complex, subunit 3"
FT                   /note="gene_id=mCG17123.1 transcript_id=mCT16227.2 created
FT                   on 15-MAY-2002"
FT   CDS             join(504575..504697,505433..505449,506267..506321,
FT                   510635..510756,523537..523622,524176..524264,
FT                   526006..526061,535381..535512,536028..536071,
FT                   538194..538345)
FT                   /codon_start=1
FT                   /gene="Brcc3"
FT                   /locus_tag="mCG_17123"
FT                   /product="BRCA1/BRCA2-containing complex, subunit 3"
FT                   /note="gene_id=mCG17123.1 transcript_id=mCT16227.2
FT                   protein_id=mCP17164.2"
FT                   /protein_id="EDL29223.1"
FT                   /translation="MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDD
FT                   IRSDSKFTYTGTEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEA
FT                   EMLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNT
FT                   KTGRVLYTCFQSIQAQKSSEYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAY
FT                   RRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKE
FT                   ELMEELSSLE"
FT   assembly_gap    516791..516908
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    520750..521003
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    527398..527575
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    528774..528936
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            547037..547791
FT                   /pseudo
FT                   /locus_tag="mCG_1035412"
FT                   /note="gene_id=mCG1035412.1"
FT   mRNA            547037..547791
FT                   /pseudo
FT                   /locus_tag="mCG_1035412"
FT                   /note="gene_id=mCG1035412.1 transcript_id=mCT153116.1
FT                   created on 15-MAY-2002"
FT   assembly_gap    553354..553373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    555369..555642
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   gene            complement(562721..563966)
FT                   /locus_tag="mCG_122723"
FT                   /note="gene_id=mCG122723.1"
FT   mRNA            complement(562721..563966)
FT                   /locus_tag="mCG_122723"
FT                   /product="mCG122723"
FT                   /note="gene_id=mCG122723.1 transcript_id=mCT123945.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(563699..563830)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122723"
FT                   /product="mCG122723"
FT                   /note="gene_id=mCG122723.1 transcript_id=mCT123945.1
FT                   protein_id=mCP66645.1"
FT                   /protein_id="EDL29222.1"
FT                   /translation="MPKRKVSADGAAKAEPKCLSARLSAKPAPAKVDAKPEKGRGKG"
FT   assembly_gap    573260..573279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    580742..581371
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    595947..596000
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    599285..599704
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   gene            602194..622844
FT                   /gene="Vbp1"
FT                   /locus_tag="mCG_17124"
FT                   /note="gene_id=mCG17124.2"
FT   mRNA            join(602194..602301,604962..605086,609236..609302,
FT                   611135..611233,618960..619098,621832..622653,
FT                   622674..622844)
FT                   /gene="Vbp1"
FT                   /locus_tag="mCG_17124"
FT                   /product="von Hippel-Lindau binding protein 1"
FT                   /note="gene_id=mCG17124.2 transcript_id=mCT16228.2 created
FT                   on 15-MAY-2002"
FT   CDS             join(602212..602301,604962..605086,609236..609302,
FT                   611135..611233,618960..619098,621832..621902)
FT                   /codon_start=1
FT                   /gene="Vbp1"
FT                   /locus_tag="mCG_17124"
FT                   /product="von Hippel-Lindau binding protein 1"
FT                   /note="gene_id=mCG17124.2 transcript_id=mCT16228.2
FT                   protein_id=mCP17165.2"
FT                   /protein_id="EDL29221.1"
FT                   /translation="MAAAKDGCGLETAAGNGRRLHLGIPEAVFVEDVDSFMKQPGNETA
FT                   DTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRF
FT                   LLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDF
FT                   LRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA"
FT   assembly_gap    619793..619812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    622654..622673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    629147..629314
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    646548..648517
FT                   /estimated_length=1970
FT                   /gap_type="unknown"
FT   assembly_gap    649083..649395
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   gene            complement(662444..666502)
FT                   /gene="Rab39b"
FT                   /locus_tag="mCG_49026"
FT                   /note="gene_id=mCG49026.1"
FT   mRNA            complement(join(662444..663293,666079..666502))
FT                   /gene="Rab39b"
FT                   /locus_tag="mCG_49026"
FT                   /product="RAB39B, member RAS oncogene family"
FT                   /note="gene_id=mCG49026.1 transcript_id=mCT49209.1 created
FT                   on 15-MAY-2002"
FT   CDS             complement(join(662867..663293,666079..666293))
FT                   /codon_start=1
FT                   /gene="Rab39b"
FT                   /locus_tag="mCG_49026"
FT                   /product="RAB39B, member RAS oncogene family"
FT                   /note="gene_id=mCG49026.1 transcript_id=mCT49209.1
FT                   protein_id=mCP37973.2"
FT                   /db_xref="GOA:Q0PD14"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1915040"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD14"
FT                   /protein_id="EDL29220.1"
FT                   /translation="MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDF
FT                   FSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWL
FT                   EETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKA
FT                   FTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVIKSERRCLC"
FT   assembly_gap    669862..674000
FT                   /estimated_length=4139
FT                   /gap_type="unknown"
FT   assembly_gap    677961..678041
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    679121..679898
FT                   /estimated_length=778
FT                   /gap_type="unknown"
FT   assembly_gap    680637..680992
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    682204..682227
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            698169..700455
FT                   /locus_tag="mCG_1035524"
FT                   /note="gene_id=mCG1035524.1"
FT   mRNA            join(698169..698608,698683..700455)
FT                   /locus_tag="mCG_1035524"
FT                   /product="mCG1035524"
FT                   /note="gene_id=mCG1035524.1 transcript_id=mCT153228.1
FT                   created on 15-MAY-2002"
FT   CDS             698793..699098
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035524"
FT                   /product="mCG1035524"
FT                   /note="gene_id=mCG1035524.1 transcript_id=mCT153228.1
FT                   protein_id=mCP66643.1"
FT                   /protein_id="EDL29219.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLKLCVEAVKTGQKILTE
FT                   QQESMSEEEKGLKRKRKKKDTVLSGGQKGQNKRAEAEEEGELASVPPPYASSAVKT"
FT   assembly_gap    709000..709019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    710429..711276
FT                   /estimated_length=848
FT                   /gap_type="unknown"
FT   assembly_gap    714120..715696
FT                   /estimated_length=1577
FT                   /gap_type="unknown"
FT   assembly_gap    722286..722371
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    724693..724963
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    733289..735869
FT                   /estimated_length=2581
FT                   /gap_type="unknown"
FT   assembly_gap    736926..738536
FT                   /estimated_length=1611
FT                   /gap_type="unknown"
FT   assembly_gap    742739..750407
FT                   /estimated_length=7669
FT                   /gap_type="unknown"
FT   assembly_gap    752847..754452
FT                   /estimated_length=1606
FT                   /gap_type="unknown"
FT   assembly_gap    756339..757795
FT                   /estimated_length=1457
FT                   /gap_type="unknown"
FT   assembly_gap    760392..760411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    762162..766332
FT                   /estimated_length=4171
FT                   /gap_type="unknown"
FT   assembly_gap    767677..768173
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    783166..783185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    786394..786552
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            813439..813958
FT                   /locus_tag="mCG_1035434"
FT                   /note="gene_id=mCG1035434.1"
FT   mRNA            813439..813958
FT                   /locus_tag="mCG_1035434"
FT                   /product="mCG1035434"
FT                   /note="gene_id=mCG1035434.1 transcript_id=mCT153138.1
FT                   created on 15-MAY-2002"
FT   CDS             813504..813758
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035434"
FT                   /product="mCG1035434"
FT                   /note="gene_id=mCG1035434.1 transcript_id=mCT153138.1
FT                   protein_id=mCP66665.1"
FT                   /protein_id="EDL29218.1"
FT                   /translation="MAKRRAAEPLTFRVPWKRLLLSDFPEEPPLWVPPSGTARPLKRQG
FT                   DAGIMAGTTDRSCRAVAGSPESRLLASRRNPGLRAAATE"
FT   assembly_gap    819062..819081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    821065..826311
FT                   /estimated_length=5247
FT                   /gap_type="unknown"
FT   assembly_gap    827409..848981
FT                   /estimated_length=21573
FT                   /gap_type="unknown"
FT   assembly_gap    859273..859561
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   gene            complement(874796..964578)
FT                   /gene="Pls3"
FT                   /locus_tag="mCG_122730"
FT                   /note="gene_id=mCG122730.1"
FT   mRNA            complement(join(874796..876030,879806..879930,
FT                   880129..880252,882433..882566,883021..883135,
FT                   884151..884229,885178..885373,888239..888334,
FT                   889346..889488,890420..890585,891369..891450,
FT                   893984..894116,894595..894724,904927..905090,
FT                   915717..915797,963483..>963682))
FT                   /gene="Pls3"
FT                   /locus_tag="mCG_122730"
FT                   /product="plastin 3 (T-isoform), transcript variant
FT                   mCT192589"
FT                   /note="gene_id=mCG122730.1 transcript_id=mCT192589.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(874797..876030,879806..879930,
FT                   880129..880252,882433..882566,883021..883135,
FT                   884151..884229,885178..885373,888239..888334,
FT                   889346..889488,890420..890585,891369..891450,
FT                   893984..894116,894595..894724,904927..905090,
FT                   915717..915808,964499..964578))
FT                   /gene="Pls3"
FT                   /locus_tag="mCG_122730"
FT                   /product="plastin 3 (T-isoform), transcript variant
FT                   mCT123953"
FT                   /note="gene_id=mCG122730.1 transcript_id=mCT123953.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(875898..876030,879806..879930,
FT                   880129..880252,882433..882566,883021..883135,
FT                   884151..884229,885178..885373,888239..888334,
FT                   889346..889488,890420..890585,891369..891450,
FT                   893984..894116,894595..894724,904927..905090,
FT                   915717..915797,963483..>963651))
FT                   /codon_start=1
FT                   /gene="Pls3"
FT                   /locus_tag="mCG_122730"
FT                   /product="plastin 3 (T-isoform), isoform CRA_b"
FT                   /note="gene_id=mCG122730.1 transcript_id=mCT192589.0
FT                   protein_id=mCP113547.0 isoform=CRA_b"
FT                   /protein_id="EDL29217.1"
FT                   /translation="VTRRVSEDPEAPKEAGRGAGAVPPPPPGTWPRRPTFCPLLSPALR
FT                   LSFGTAPRLPMNLYMDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEAN
FT                   MPLPGYKVREIIQKLMVDGDRNKDGKISFNEFVYIFQEVKSSDIAKTFRKAINRKEGIC
FT                   ALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDG
FT                   IVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAG
FT                   KPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHL
FT                   ENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESM
FT                   LQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETRE
FT                   ERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMK
FT                   KLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQ
FT                   KANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGN
FT                   LTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV"
FT   CDS             complement(join(875898..876030,879806..879930,
FT                   880129..880252,882433..882566,883021..883135,
FT                   884151..884229,885178..885373,888239..888334,
FT                   889346..889488,890420..890585,891369..891450,
FT                   893984..894116,894595..894724,904927..905090,
FT                   915717..915789))
FT                   /codon_start=1
FT                   /gene="Pls3"
FT                   /locus_tag="mCG_122730"
FT                   /product="plastin 3 (T-isoform), isoform CRA_a"
FT                   /note="gene_id=mCG122730.1 transcript_id=mCT123953.1
FT                   protein_id=mCP66674.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q99K51"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:104807"
FT                   /protein_id="EDL29216.1"
FT                   /translation="MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEAN
FT                   MPLPGYKVREIIQKLMVDGDRNKDGKISFNEFVYIFQEVKSSDIAKTFRKAINRKEGIC
FT                   ALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDG
FT                   IVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAG
FT                   KPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHL
FT                   ENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESM
FT                   LQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETRE
FT                   ERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMK
FT                   KLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQ
FT                   KANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGN
FT                   LTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV"
FT   assembly_gap    876622..877035
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    917025..917304
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    946482..946501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    963692..964254
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    998400..998743
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   gene            1004903..1006199
FT                   /pseudo
FT                   /locus_tag="mCG_122727"
FT                   /note="gene_id=mCG122727.1"
FT   mRNA            1004903..1006199
FT                   /pseudo
FT                   /locus_tag="mCG_122727"
FT                   /note="gene_id=mCG122727.1 transcript_id=mCT123950.1
FT                   created on 16-MAY-2002"
FT   assembly_gap    1011288..1011307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1013866..1014815
FT                   /estimated_length=950
FT                   /gap_type="unknown"
FT   assembly_gap    1028836..1030372
FT                   /estimated_length=1537
FT                   /gap_type="unknown"
FT   assembly_gap    1035970..1035989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1038190..1041376
FT                   /estimated_length=3187
FT                   /gap_type="unknown"
FT   gene            complement(1053508..1055239)
FT                   /pseudo
FT                   /locus_tag="mCG_122725"
FT                   /note="gene_id=mCG122725.0"
FT   mRNA            complement(1053508..1055239)
FT                   /pseudo
FT                   /locus_tag="mCG_122725"
FT                   /note="gene_id=mCG122725.0 transcript_id=mCT123948.1
FT                   created on 15-MAY-2002"
FT   gene            complement(1069209..1069663)
FT                   /pseudo
FT                   /locus_tag="mCG_122728"
FT                   /note="gene_id=mCG122728.0"
FT   mRNA            complement(1069209..1069663)
FT                   /pseudo
FT                   /locus_tag="mCG_122728"
FT                   /note="gene_id=mCG122728.0 transcript_id=mCT123951.1
FT                   created on 15-MAY-2002"
FT   assembly_gap    1073210..1073458
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    1101178..1101582
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    1108847..1108900
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    1117318..1117428
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    1120253..1120305
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    1128792..1130884
FT                   /estimated_length=2093
FT                   /gap_type="unknown"
FT   assembly_gap    1132114..1132133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1133486..1133935
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    1138008..1138125
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    1167249..1167268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1167983..1169487
FT                   /estimated_length=1505
FT                   /gap_type="unknown"
FT   assembly_gap    1193064..1193643
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   assembly_gap    1200167..1200186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1208506..1208816
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    1213389..1213720
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    1224997..1225016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1229779..1230182
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    1230718..1234442
FT                   /estimated_length=3725
FT                   /gap_type="unknown"
FT   gene            complement(<1236399..>1237473)
FT                   /locus_tag="mCG_1035522"
FT                   /note="gene_id=mCG1035522.1"
FT   mRNA            complement(join(<1236399..1236952,1237402..>1237473))
FT                   /locus_tag="mCG_1035522"
FT                   /product="mCG1035522"
FT                   /note="gene_id=mCG1035522.1 transcript_id=mCT153226.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(1236399..1236952,1237402..>1237471))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035522"
FT                   /product="mCG1035522"
FT                   /note="gene_id=mCG1035522.1 transcript_id=mCT153226.1
FT                   protein_id=mCP66638.1"
FT                   /protein_id="EDL29215.1"
FT                   /translation="RPHHDLSVRPHNGLSVRPHHDLPVRPIHDYSGRQYHNHAGRLQHG
FT                   HSDRFHLTHTKRVLPRHSEIAHPGHTQKDNQAQRGRAHDKHTGLSHQNHDGRSHHDHSG
FT                   RAYHGHAGRAHNNQSWRAHNNQSWRSWNNQSQRGHDNLSQRGHNNQSWRARNIQSQRNH
FT                   FDCSLRSSSIQSWMLHEGERYHGRRGRNGPRDASPLGSEPEIDR"
FT   gene            <1246037..>1246446
FT                   /locus_tag="mCG_53089"
FT                   /note="gene_id=mCG53089.2"
FT   mRNA            <1246037..>1246446
FT                   /locus_tag="mCG_53089"
FT                   /product="mCG53089"
FT                   /note="gene_id=mCG53089.2 transcript_id=mCT53272.2 created
FT                   on 16-MAY-2002"
FT   CDS             <1246039..>1246446
FT                   /codon_start=1
FT                   /locus_tag="mCG_53089"
FT                   /product="mCG53089"
FT                   /note="gene_id=mCG53089.2 transcript_id=mCT53272.2
FT                   protein_id=mCP34723.2"
FT                   /protein_id="EDL29214.1"
FT                   /translation="AARHCDLQVRIDHTSRTLSFGSDLNYATREDAPVGPHLQSMPSEQ
FT                   IRNQLTAMSSVLAKALEVIRPAHILQEKEEQHQLAVNAYLKNSRKEHQRILARRQTIEE
FT                   RKERLESLNIQREKEELEQREAELQKVRKAEE"
FT   assembly_gap    1246767..1248267
FT                   /estimated_length=1501
FT                   /gap_type="unknown"
FT   assembly_gap    1253871..1253890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1265863..1265882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1281218..1282483
FT                   /pseudo
FT                   /locus_tag="mCG_1035410"
FT                   /note="gene_id=mCG1035410.1"
FT   mRNA            1281218..1282483
FT                   /pseudo
FT                   /locus_tag="mCG_1035410"
FT                   /note="gene_id=mCG1035410.1 transcript_id=mCT153114.1
FT                   created on 16-MAY-2002"
FT   assembly_gap    1287986..1288005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1294154..1294276
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    1298866..1299116
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    1301466..1301696
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    1302791..1303645
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    1316350..1317147
FT                   /estimated_length=798
FT                   /gap_type="unknown"
FT   assembly_gap    1329528..1329547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1331284..1332298
FT                   /estimated_length=1015
FT                   /gap_type="unknown"
FT   assembly_gap    1340262..1340636
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   gene            <1343621..1344468
FT                   /locus_tag="mCG_1035519"
FT                   /note="gene_id=mCG1035519.1"
FT   mRNA            <1343621..1344468
FT                   /locus_tag="mCG_1035519"
FT                   /product="mCG1035519"
FT                   /note="gene_id=mCG1035519.1 transcript_id=mCT153223.1
FT                   created on 16-MAY-2002"
FT   CDS             1343621..1344250
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035519"
FT                   /product="mCG1035519"
FT                   /note="gene_id=mCG1035519.1 transcript_id=mCT153223.1
FT                   protein_id=mCP66626.1"
FT                   /db_xref="GOA:Q80ZS5"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR006187"
FT                   /db_xref="MGI:MGI:3648293"
FT                   /db_xref="UniProtKB/TrEMBL:Q80ZS5"
FT                   /protein_id="EDL29213.1"
FT                   /translation="MPLKKCHRQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVILKP
FT                   TVALVGMWRACIFHTDSNSSNTRVCYQYKYDGSIHLYIQVNQHLLLVSSFLGLFGKITT
FT                   IIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFN
FT                   LPFQPDIRKMGSATALAIIAAVFFLLSGTICLSSNLAIGKVPHSKM"
FT   assembly_gap    1359459..1359690
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    1361625..1361733
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            complement(1369530..1370242)
FT                   /pseudo
FT                   /locus_tag="mCG_1035518"
FT                   /note="gene_id=mCG1035518.1"
FT   mRNA            complement(1369530..1370242)
FT                   /pseudo
FT                   /locus_tag="mCG_1035518"
FT                   /note="gene_id=mCG1035518.1 transcript_id=mCT153222.1
FT                   created on 15-MAY-2002"
FT   assembly_gap    1370287..1370306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1371466..1371485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1376757..1377700
FT                   /estimated_length=944
FT                   /gap_type="unknown"
FT   assembly_gap    1388859..1388950
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    1399098..1399117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1413350..1413369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1416075..>1416317
FT                   /locus_tag="mCG_10359"
FT                   /note="gene_id=mCG10359.0"
FT   mRNA            <1416075..>1416317
FT                   /locus_tag="mCG_10359"
FT                   /product="mCG10359"
FT                   /note="gene_id=mCG10359.0 transcript_id=mCT10071.0 created
FT                   on 16-MAY-2002"
FT   CDS             1416075..1416317
FT                   /codon_start=1
FT                   /locus_tag="mCG_10359"
FT                   /product="mCG10359"
FT                   /note="gene_id=mCG10359.0 transcript_id=mCT10071.0
FT                   protein_id=mCP14562.0"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="InterPro:IPR021072"
FT                   /db_xref="UniProtKB/TrEMBL:O89011"
FT                   /protein_id="EDL29212.1"
FT                   /translation="MDDSHNTQYCNLQESAQSQQESDNDQATMDTSEEEEDTTTSNKVY
FT                   GSGIPNPPQSPQSASSPCVMMASIPDSPSEEASIK"
FT   assembly_gap    1419751..1419770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1430467..1432332
FT                   /estimated_length=1866
FT                   /gap_type="unknown"
FT   assembly_gap    1436974..1437348
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    1439688..1439900
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    1441858..1441935
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            <1458140..1458980
FT                   /locus_tag="mCG_1035453"
FT                   /note="gene_id=mCG1035453.1"
FT   mRNA            <1458140..1458980
FT                   /locus_tag="mCG_1035453"
FT                   /product="mCG1035453"
FT                   /note="gene_id=mCG1035453.1 transcript_id=mCT153157.1
FT                   created on 16-MAY-2002"
FT   CDS             1458140..1458775
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035453"
FT                   /product="mCG1035453"
FT                   /note="gene_id=mCG1035453.1 transcript_id=mCT153157.1
FT                   protein_id=mCP66670.1"
FT                   /db_xref="GOA:Q3V0X2"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR006187"
FT                   /db_xref="MGI:MGI:3588232"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0X2"
FT                   /protein_id="EDL29211.1"
FT                   /translation="MLIKNRCNSQMGGFALTTVAWLICCISIGLPQWRVWHFQDPVVFK
FT                   STTAFVGMWRVCTLQYDEDFRNMRICHQYNYHDTFLPLNIRMIQQLLLVSSFFGLVGKV
FT                   TTIIALWNVCQGRVHRKATYNPFGLSGILNIISSSFICLAILINYVSIIFQEGIIFPPS
FT                   FNIPSQPDTQEIGSAMALAFIAAVLFLLSGTILLTSNFPVDKPVCSKY"
FT   assembly_gap    1459618..1462155
FT                   /estimated_length=2538
FT                   /gap_type="unknown"
FT   assembly_gap    1472925..1472944
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1481282..1481301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<1481302..1481672)
FT                   /locus_tag="mCG_49894"
FT                   /note="gene_id=mCG49894.2"
FT   mRNA            complement(<1481302..1481672)
FT                   /locus_tag="mCG_49894"
FT                   /product="mCG49894"
FT                   /note="gene_id=mCG49894.2 transcript_id=mCT50077.2 created
FT                   on 15-MAY-2002"
FT   CDS             complement(<1481302..1481540)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49894"
FT                   /product="mCG49894"
FT                   /note="gene_id=mCG49894.2 transcript_id=mCT50077.2
FT                   protein_id=mCP28714.2"
FT                   /protein_id="EDL29210.1"
FT                   /translation="MSTNENANLPAARLNRFKNKGKDSTEMHRRRIEVNVELRKAKKDE
FT                   QMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVE"
FT   assembly_gap    1506977..1507184
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    1509028..1509057
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    1517919..1517938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1524294..1525082
FT                   /estimated_length=789
FT                   /gap_type="unknown"
FT   assembly_gap    1526515..1527225
FT                   /estimated_length=711
FT                   /gap_type="unknown"
FT   assembly_gap    1582924..1582943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<1593788..>1594417)
FT                   /locus_tag="mCG_140471"
FT                   /note="gene_id=mCG140471.0"
FT   mRNA            complement(<1593788..>1594417)
FT                   /locus_tag="mCG_140471"
FT                   /product="mCG140471"
FT                   /note="gene_id=mCG140471.0 transcript_id=mCT169676.0
FT                   created on 15-MAY-2002"
FT   CDS             complement(1593788..1594417)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140471"
FT                   /product="mCG140471"
FT                   /note="gene_id=mCG140471.0 transcript_id=mCT169676.0
FT                   protein_id=mCP92702.0"
FT                   /protein_id="EDL29209.1"
FT                   /translation="MLMKKCNHQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVILKP
FT                   TVALVGMWRACVFHTDSNTSNTRVCYQYKYGDSIPLYIRVNQHLLLVSSFLGLFGKITT
FT                   IIALSNVRMGRVQRNATCNPFRLSGILNIIASSFLYLPVLFNYIAIMLKWKVAFPPSFN
FT                   FPFQPDTQKMGSAVALAIISAVFFLLSGTICLSSNLAIGKMPRSKI"
FT   assembly_gap    1603132..1608383
FT                   /estimated_length=5252
FT                   /gap_type="unknown"
FT   assembly_gap    1611236..1611255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1612714..1621790
FT                   /estimated_length=9077
FT                   /gap_type="unknown"
FT   gene            complement(1640104..1660921)
FT                   /locus_tag="mCG_52469"
FT                   /note="gene_id=mCG52469.2"
FT   mRNA            complement(join(1640104..1640966,1660781..1660921))
FT                   /locus_tag="mCG_52469"
FT                   /product="mCG52469"
FT                   /note="gene_id=mCG52469.2 transcript_id=mCT52652.2 created
FT                   on 11-JUN-2003"
FT   CDS             complement(1640306..1640938)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52469"
FT                   /product="mCG52469"
FT                   /note="gene_id=mCG52469.2 transcript_id=mCT52652.2
FT                   protein_id=mCP28717.1"
FT                   /db_xref="GOA:A2AGU5"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR006187"
FT                   /db_xref="MGI:MGI:1922237"
FT                   /db_xref="UniProtKB/TrEMBL:A2AGU5"
FT                   /protein_id="EDL29208.1"
FT                   /translation="MARKHAKWQIGGFAAGAIAWFLCIVSMGLPQWRVWFFQDPMDSKH
FT                   GMTLVGMWKTCIYHQESNSTFNRMCYKYTYQDDFIPLDIRVAQHLLLIASFLGIIATIS
FT                   VIIALWKLNSGRLRKKATFNPFRLPGILNIIASSFVFLSILYNYLSIIRKDGIAFPPSF
FT                   HTPSFPDHQKIGTALAMATLSCFLFLVGGIIPLSFTLPPRSRVRYTI"
FT   assembly_gap    1646482..1656577
FT                   /estimated_length=10096
FT                   /gap_type="unknown"
FT   assembly_gap    1658572..1658623
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    1664017..1664552
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    1686203..1686222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1705150..1705181
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    1705944..1706618
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   assembly_gap    1707759..1707933
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    1709834..1709950
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    1714702..1714803
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1717601..1722081
FT                   /estimated_length=4481
FT                   /gap_type="unknown"
FT   assembly_gap    1724403..1724422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1731125..1731615
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    1736574..1736806
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    1740211..1741303
FT                   /estimated_length=1093
FT                   /gap_type="unknown"
FT   assembly_gap    1744288..1744465
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    1756729..1756748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1759064..1759083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1777505..1780697
FT                   /estimated_length=3193
FT                   /gap_type="unknown"
FT   assembly_gap    1782232..1782351
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    1789652..1789671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1791423..1792726
FT                   /estimated_length=1304
FT                   /gap_type="unknown"
FT   assembly_gap    1794790..1796025
FT                   /estimated_length=1236
FT                   /gap_type="unknown"
FT   assembly_gap    1822264..1822283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1823779..1823893
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    1825248..1825267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1835408..1835484
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    1836558..1836691
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    1839142..1839469
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    1848413..1848563
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1852666..1853791
FT                   /estimated_length=1126
FT                   /gap_type="unknown"
FT   assembly_gap    1856478..1857397
FT                   /estimated_length=920
FT                   /gap_type="unknown"
FT   assembly_gap    1869331..1869744
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    1871149..1871887
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    1878636..1878764
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    1884051..1884130
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            1906701..1906959
FT                   /locus_tag="mCG_1035433"
FT                   /note="gene_id=mCG1035433.1"
FT   mRNA            1906701..1906959
FT                   /locus_tag="mCG_1035433"
FT                   /product="mCG1035433"
FT                   /note="gene_id=mCG1035433.1 transcript_id=mCT153137.1
FT                   created on 16-MAY-2002"
FT   CDS             1906707..1906895
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035433"
FT                   /product="mCG1035433"
FT                   /note="gene_id=mCG1035433.1 transcript_id=mCT153137.1
FT                   protein_id=mCP66660.1"
FT                   /protein_id="EDL29207.1"
FT                   /translation="MPLARDLLHPFLKEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITT
FT                   VFSHAQTVVLCVGCSTL"
FT   assembly_gap    1909034..1909141
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    1912782..1914206
FT                   /estimated_length=1425
FT                   /gap_type="unknown"
FT   assembly_gap    1917440..1917524
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    1920650..1921368
FT                   /estimated_length=719
FT                   /gap_type="unknown"
FT   assembly_gap    1925650..1932492
FT                   /estimated_length=6843
FT                   /gap_type="unknown"
FT   assembly_gap    1944219..1944238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1956212..1956431
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    1970168..1977752
FT                   /estimated_length=7585
FT                   /gap_type="unknown"
FT   assembly_gap    1979457..1979687
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    1985586..1985605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1989405..1989424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1992054..1992073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1997448..1997467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2005188..2005381
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    2011314..2011333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2018156..2021522
FT                   /estimated_length=3367
FT                   /gap_type="unknown"
FT   assembly_gap    2026274..2026293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2027760..2027779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2032932..2033451
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    2034390..2034553
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    2058074..2058574
FT                   /estimated_length=501
FT                   /gap_type="unknown"
FT   assembly_gap    2061297..2061777
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    2100942..2103142
FT                   /estimated_length=2201
FT                   /gap_type="unknown"
FT   assembly_gap    2106107..2106165
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    2113537..2113556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2115061..2115080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2120329..2120348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2126171..2126190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2130681..2130895
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    2143856..2144201
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    2145465..2145484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2150773..2150792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2157427..2157446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2166292..2170141
FT                   /estimated_length=3850
FT                   /gap_type="unknown"
FT   assembly_gap    2174476..2174687
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    2178956..2179445
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    2180277..2181237
FT                   /estimated_length=961
FT                   /gap_type="unknown"
FT   assembly_gap    2189550..2189569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2191477..2191496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2202028..2202047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2202800..2202887
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    2206235..2215474
FT                   /estimated_length=9240
FT                   /gap_type="unknown"
FT   assembly_gap    2217648..2217667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2222056..2222075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2259541..2259560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2264446..2264689
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    2275460..2277307
FT                   /estimated_length=1848
FT                   /gap_type="unknown"
FT   assembly_gap    2278659..2280951
FT                   /estimated_length=2293
FT                   /gap_type="unknown"
FT   assembly_gap    2286219..2286851
FT                   /estimated_length=633
FT                   /gap_type="unknown"
FT   assembly_gap    2289047..2292421
FT                   /estimated_length=3375
FT                   /gap_type="unknown"
FT   gene            complement(2308581..2309529)
FT                   /pseudo
FT                   /locus_tag="mCG_20376"
FT                   /note="gene_id=mCG20376.2"
FT   mRNA            complement(2308581..2309529)
FT                   /pseudo
FT                   /locus_tag="mCG_20376"
FT                   /note="gene_id=mCG20376.2 transcript_id=mCT20419.1 created
FT                   on 15-MAY-2002"
FT   assembly_gap    2310386..2310405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2311450..2311999
FT                   /pseudo
FT                   /locus_tag="mCG_49324"
FT                   /note="gene_id=mCG49324.2"
FT   mRNA            2311450..2311999
FT                   /pseudo
FT                   /locus_tag="mCG_49324"
FT                   /note="gene_id=mCG49324.2 transcript_id=mCT49507.2 created
FT                   on 16-MAY-2002"
FT   gene            <2313411..2313575
FT                   /locus_tag="mCG_1035514"
FT                   /note="gene_id=mCG1035514.1"
FT   mRNA            <2313411..2313575
FT                   /locus_tag="mCG_1035514"
FT                   /product="mCG1035514"
FT                   /note="gene_id=mCG1035514.1 transcript_id=mCT153218.1
FT                   created on 16-MAY-2002"
FT   CDS             <2313413..2313568
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035514"
FT                   /product="mCG1035514"
FT                   /note="gene_id=mCG1035514.1 transcript_id=mCT153218.1
FT                   protein_id=mCP66739.1"
FT                   /protein_id="EDL29206.1"
FT                   /translation="AWPSDFPTATDLSNPGPLDSTDPVCCWHLRCNKWPGVLPLSLAAL
FT                   GDTGEE"
FT   assembly_gap    2314144..2314248
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    2317153..2317172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2322442..2322555
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    2323808..2323827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2332942..2332961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2338665..2338684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2341180..2341336
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    2343680..2343780
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    2347997..2349554
FT                   /estimated_length=1558
FT                   /gap_type="unknown"
FT   assembly_gap    2352884..2354505
FT                   /estimated_length=1622
FT                   /gap_type="unknown"
FT   assembly_gap    2356308..2357806
FT                   /estimated_length=1499
FT                   /gap_type="unknown"
FT   assembly_gap    2360077..2360392
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    2379556..2379600
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    2381018..2381037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2383059..2383553
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    2387304..2387602
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    2389161..2389283
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    2391686..2391705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2393998..2395239
FT                   /estimated_length=1242
FT                   /gap_type="unknown"
FT   assembly_gap    2401465..2401484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2410705..2416472
FT                   /estimated_length=5768
FT                   /gap_type="unknown"
FT   assembly_gap    2425831..2426062
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    2429229..2429637
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   assembly_gap    2438239..2438258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2445092..2445448
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   assembly_gap    2461416..2461435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2462820..2468023
FT                   /estimated_length=5204
FT                   /gap_type="unknown"
FT   gene            2468670..2469771
FT                   /locus_tag="mCG_50622"
FT                   /note="gene_id=mCG50622.1"
FT   mRNA            join(2468670..2469062,2469085..2469771)
FT                   /locus_tag="mCG_50622"
FT                   /product="mCG50622"
FT                   /note="gene_id=mCG50622.1 transcript_id=mCT50805.2 created
FT                   on 17-SEP-2002"
FT   CDS             join(2468775..2469062,2469085..2469105)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50622"
FT                   /product="mCG50622"
FT                   /note="gene_id=mCG50622.1 transcript_id=mCT50805.2
FT                   protein_id=mCP42972.2"
FT                   /protein_id="EDL29205.1"
FT                   /translation="MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKC
FT                   SERWKTMSAKEKGKFEDMAKADKAGYEREMKTYTPQRGDQKEVQGPQYTQEYCCLQS"
FT   assembly_gap    2469065..2469084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2488585..2489252
FT                   /estimated_length=668
FT                   /gap_type="unknown"
FT   assembly_gap    2506235..2506392
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    2511140..2511159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2522193..2674398
FT                   /gene="Tbl1x"
FT                   /locus_tag="mCG_57161"
FT                   /note="gene_id=mCG57161.2"
FT   mRNA            join(<2522193..2522450,2644229..2644323,2652801..2652914,
FT                   2654819..2654964,2657616..2657877,2659200..2659332,
FT                   2659660..2659801,2660062..2660125,2660231..2660328,
FT                   2661281..2661341,2661777..2661898,2664172..2664246,
FT                   2664622..2664749,2666814..2666979,2670108..2670209,
FT                   2671122..2671502)
FT                   /gene="Tbl1x"
FT                   /locus_tag="mCG_57161"
FT                   /product="transducin (beta)-like 1 X-linked, transcript
FT                   variant mCT192590"
FT                   /note="gene_id=mCG57161.2 transcript_id=mCT192590.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(2522240..2522450,2596001..2596066,2644229..2644323,
FT                   2652801..2652914,2654819..2654964,2657616..2657877,
FT                   2659200..2659332,2659660..2659801,2660062..2660125,
FT                   2660231..2660328,2661281..2661341,2661777..2661898,
FT                   2664172..2664246,2664622..2664749,2666814..2666979,
FT                   2670108..2670209,2671122..2674398)
FT                   /gene="Tbl1x"
FT                   /locus_tag="mCG_57161"
FT                   /product="transducin (beta)-like 1 X-linked, transcript
FT                   variant mCT57344"
FT                   /note="gene_id=mCG57161.2 transcript_id=mCT57344.2 created
FT                   on 16-MAY-2002"
FT   mRNA            join(<2522395..2522450,2596001..2596066,2644229..2644323,
FT                   2652801..2652914,2654819..2654964,2657616..2657877,
FT                   2659200..2659332,2659660..2661898,2664172..2664246,
FT                   2664622..2664749,2666814..2666979,2670108..2670209,
FT                   2671122..2671150)
FT                   /gene="Tbl1x"
FT                   /locus_tag="mCG_57161"
FT                   /product="transducin (beta)-like 1 X-linked, transcript
FT                   variant mCT192591"
FT                   /note="gene_id=mCG57161.2 transcript_id=mCT192591.0 created
FT                   on 09-MAR-2004"
FT   gene            2530034..2535953
FT                   /locus_tag="mCG_147986"
FT                   /note="gene_id=mCG147986.0"
FT   mRNA            join(2530034..2533353,2535917..2535953)
FT                   /locus_tag="mCG_147986"
FT                   /product="mCG147986"
FT                   /note="gene_id=mCG147986.0 transcript_id=mCT188249.0
FT                   created on 13-JAN-2004"
FT   CDS             2531295..2531567
FT                   /codon_start=1
FT                   /locus_tag="mCG_147986"
FT                   /product="mCG147986"
FT                   /note="gene_id=mCG147986.0 transcript_id=mCT188249.0
FT                   protein_id=mCP109537.0"
FT                   /protein_id="EDL29204.1"
FT                   /translation="MLFVYMCARHCELHVYTSVRRPEVNIGHLPHLIFGDSSLTGACLF
FT                   VDWTVSSGALPVSMYPALVLQTTAAAFYVGSGEGSRFHVRAICAL"
FT   assembly_gap    2539045..2539592
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    2544213..2544232
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2557665..2557844
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    2580366..2580481
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    2599125..2599144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2609178..2609209
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    2633872..2633918
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    2634858..2635180
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   CDS             join(<2644284..2644323,2652801..2652914,2654819..2654964,
FT                   2657616..2657877,2659200..2659332,2659660..2659801,
FT                   2660062..2660125,2660231..2660328,2661281..2661341,
FT                   2661777..2661898,2664172..2664246,2664622..2664749,
FT                   2666814..2666979,2670108..2670209,2671122..2671148)
FT                   /codon_start=1
FT                   /gene="Tbl1x"
FT                   /locus_tag="mCG_57161"
FT                   /product="transducin (beta)-like 1 X-linked, isoform CRA_a"
FT                   /note="gene_id=mCG57161.2 transcript_id=mCT192590.0
FT                   protein_id=mCP113549.0 isoform=CRA_a"
FT                   /protein_id="EDL29201.1"
FT                   /translation="PTVPEVYTCTHCDEGGSHLIETKTSSPKGEAKMSITSDEVNFLVY
FT                   RYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTV
FT                   FDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQANAAAAAAAAAATATSTAATTPAA
FT                   AAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKATVLRGHESEVFICAW
FT                   NPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSD
FT                   GTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDA
FT                   HTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNA
FT                   IKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPNSNI
FT                   MLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQ
FT                   SGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK"
FT   CDS             join(<2644284..2644323,2652801..2652914,2654819..2654964,
FT                   2657616..2657877,2659200..2659332,2659660..2659861)
FT                   /codon_start=1
FT                   /gene="Tbl1x"
FT                   /locus_tag="mCG_57161"
FT                   /product="transducin (beta)-like 1 X-linked, isoform CRA_b"
FT                   /note="gene_id=mCG57161.2 transcript_id=mCT192591.0
FT                   protein_id=mCP113550.0 isoform=CRA_b"
FT                   /protein_id="EDL29202.1"
FT                   /translation="PTVPEVYTCTHCDEGGSHLIETKTSSPKGEAKMSITSDEVNFLVY
FT                   RYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTV
FT                   FDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQANAAAAAAAAAATATSTAATTPAA
FT                   AAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKATVLRGHESEVFICAW
FT                   NPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNVS
FT                   FYHQCVQMKHMQTQSGR"
FT   assembly_gap    2650721..2651934
FT                   /estimated_length=1214
FT                   /gap_type="unknown"
FT   CDS             join(2652857..2652914,2654819..2654964,2657616..2657877,
FT                   2659200..2659332,2659660..2659801,2660062..2660125,
FT                   2660231..2660328,2661281..2661341,2661777..2661898,
FT                   2664172..2664246,2664622..2664749,2666814..2666979,
FT                   2670108..2670209,2671122..2671148)
FT                   /codon_start=1
FT                   /gene="Tbl1x"
FT                   /locus_tag="mCG_57161"
FT                   /product="transducin (beta)-like 1 X-linked, isoform CRA_c"
FT                   /note="gene_id=mCG57161.2 transcript_id=mCT57344.2
FT                   protein_id=mCP42971.2 isoform=CRA_c"
FT                   /protein_id="EDL29203.1"
FT                   /translation="MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVP
FT                   PAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLA
FT                   QQQANAAAAAAAAAATATSTAATTPAAAAQQNPPKNGEATVNGEENGAHAINNHSKPME
FT                   IDGDVEIPPSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQL
FT                   VLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGP
FT                   IFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCST
FT                   DMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHD
FT                   LQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHQEPV
FT                   YSVAFSPDGKYLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASD
FT                   GSVCVLDLRK"
FT   assembly_gap    2684944..2685161
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   gene            complement(<2686289..>2686927)
FT                   /locus_tag="mCG_1035512"
FT                   /note="gene_id=mCG1035512.1"
FT   mRNA            complement(<2686289..>2686927)
FT                   /locus_tag="mCG_1035512"
FT                   /product="mCG1035512"
FT                   /note="gene_id=mCG1035512.1 transcript_id=mCT153216.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(2686289..2686927)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035512"
FT                   /product="mCG1035512"
FT                   /note="gene_id=mCG1035512.1 transcript_id=mCT153216.1
FT                   protein_id=mCP66735.1"
FT                   /protein_id="EDL29200.1"
FT                   /translation="MLLLSKSANCQVGGFALASIAWVLCSISTGLPQWRVWYLNETMFT
FT                   EPTTVFIGMWRVCIYHQNSKFGSARVCHGYTYDDSFIPLDVHIVQHLLLISSMLGLIGT
FT                   VATIFALRKVYAGKVQKNTTHNPFVLSAILNIIASIFLLLAVLFNYLSVVHKAGIAFPP
FT                   SFHLPLYPPSQRIGIASIIASLCALMFLGSGIIFISYTSPVEKQVFPEI"
FT   assembly_gap    2689182..2690650
FT                   /estimated_length=1469
FT                   /gap_type="unknown"
FT   assembly_gap    2692286..2692342
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    2695047..2695758
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   assembly_gap    2728538..2734470
FT                   /estimated_length=5933
FT                   /gap_type="unknown"
FT   gene            complement(2734532..2735316)
FT                   /pseudo
FT                   /locus_tag="mCG_117615"
FT                   /note="gene_id=mCG117615.0"
FT   mRNA            complement(join(2734532..2734776,2734959..2735316))
FT                   /pseudo
FT                   /locus_tag="mCG_117615"
FT                   /note="gene_id=mCG117615.0 transcript_id=mCT118757.1
FT                   created on 15-MAY-2002"
FT   assembly_gap    2736451..2737739
FT                   /estimated_length=1289
FT                   /gap_type="unknown"
FT   assembly_gap    2743481..2743567
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    2745299..2746024
FT                   /estimated_length=726
FT                   /gap_type="unknown"
FT   assembly_gap    2764326..2764345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2768815..2768885
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    2771496..2771515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2773794..2774779)
FT                   /pseudo
FT                   /locus_tag="mCG_18256"
FT                   /note="gene_id=mCG18256.2"
FT   mRNA            complement(2773794..2774779)
FT                   /pseudo
FT                   /locus_tag="mCG_18256"
FT                   /note="gene_id=mCG18256.2 transcript_id=mCT13826.2 created
FT                   on 15-MAY-2002"
FT   gene            complement(2777560..2813079)
FT                   /gene="Prkx"
FT                   /locus_tag="mCG_18253"
FT                   /note="gene_id=mCG18253.1"
FT   mRNA            complement(join(2777560..2780452,2780668..2780816,
FT                   2781136..2781213,2781912..2781969,2787820..2787915,
FT                   2789689..2789808,2798992..2799255,2812642..2813079))
FT                   /gene="Prkx"
FT                   /locus_tag="mCG_18253"
FT                   /product="protein kinase, X-linked"
FT                   /note="gene_id=mCG18253.1 transcript_id=mCT13823.1 created
FT                   on 15-MAY-2002"
FT   CDS             complement(join(2780691..2780816,2781136..2781213,
FT                   2781912..2781969,2787820..2787915,2789689..2789808,
FT                   2798992..2799255,2812642..2812802))
FT                   /codon_start=1
FT                   /gene="Prkx"
FT                   /locus_tag="mCG_18253"
FT                   /product="protein kinase, X-linked"
FT                   /note="gene_id=mCG18253.1 transcript_id=mCT13823.1
FT                   protein_id=mCP3489.2"
FT                   /protein_id="EDL29199.1"
FT                   /translation="MEPPAGAAATVKDPDHDPVKTKVSAPAADPKPRTSSQKAGHSLQD
FT                   WDTIATVGELWTGHDNRFLYMLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEY
FT                   LHSKEIVYRDLKPENILLDREGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGH
FT                   GRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLV
FT                   VDRTRRLGNMKNGAEDIKRHRWFRGVEWESVPQRKLKPPIVPKLSGDGDISNFETYPES
FT                   ELDKTPSVSDKDLETFKNF"
FT   assembly_gap    2786973..2786992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2791099..2791118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2797727..2798224
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   assembly_gap    2803022..2803784
FT                   /estimated_length=763
FT                   /gap_type="unknown"
FT   assembly_gap    2808520..2808722
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   gene            complement(<2813171..>2813771)
FT                   /locus_tag="mCG_1035511"
FT                   /note="gene_id=mCG1035511.0"
FT   mRNA            complement(join(<2813171..2813255,2813321..2813337,
FT                   2813484..>2813771))
FT                   /locus_tag="mCG_1035511"
FT                   /product="mCG1035511"
FT                   /note="gene_id=mCG1035511.0 transcript_id=mCT153215.0
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(<2813171..2813255,2813321..2813337,
FT                   2813484..>2813770))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035511"
FT                   /product="mCG1035511"
FT                   /note="gene_id=mCG1035511.0 transcript_id=mCT153215.0
FT                   protein_id=mCP66731.0"
FT                   /protein_id="EDL29198.1"
FT                   /translation="SLETRSTQEPQGSGSAGAAGPLRARAFGRAALGDYRTPGVQSPEI
FT                   KEKPRNPAQPGLLLVPLPTAKALLVNIQAAAGSSCTSSFPLPAKGEEPGMRVCVCVSGP
FT                   RGPSAAPSITFTLVQVHPMGVGPAG"
FT   assembly_gap    2813338..2813483
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    2820582..2821538
FT                   /estimated_length=957
FT                   /gap_type="unknown"
FT   assembly_gap    2823406..2823518
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    2834302..2834855
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    2841069..2841193
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    2847277..2847543
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    2852118..2852172
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    2853815..2854316
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   assembly_gap    2855422..2855441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2855752..2871582)
FT                   /gene="Pbsn"
FT                   /locus_tag="mCG_18254"
FT                   /note="gene_id=mCG18254.1"
FT   mRNA            complement(join(2855752..2855967,2859937..2859988,
FT                   2860592..2860693,2860974..2861084,2863096..2863163,
FT                   2866052..2866191,2871489..2871582))
FT                   /gene="Pbsn"
FT                   /locus_tag="mCG_18254"
FT                   /product="probasin"
FT                   /note="gene_id=mCG18254.1 transcript_id=mCT13824.1 created
FT                   on 15-MAY-2002"
FT   assembly_gap    2857315..2857334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2859160..2859292
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   CDS             complement(join(2859960..2859988,2860592..2860693,
FT                   2860974..2861084,2863096..2863163,2866052..2866191,
FT                   2871489..2871563))
FT                   /codon_start=1
FT                   /gene="Pbsn"
FT                   /locus_tag="mCG_18254"
FT                   /product="probasin"
FT                   /note="gene_id=mCG18254.1 transcript_id=mCT13824.1
FT                   protein_id=mCP3490.2"
FT                   /db_xref="GOA:Q3UV89"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002448"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:1860484"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UV89"
FT                   /protein_id="EDL29197.1"
FT                   /translation="MMRVIILLLTLHVLGVSSVMSLKKKIDGPWQTIYLAASTMEKINE
FT                   GSPLRTYFRHILCGRRCNQVYLYFFIKKGTKCQLYKVIGRKKQEVYYAQYEGSIAFMLK
FT                   MVNEKILLFHYFNKNRRNDVTRVAGVLAKGKQLNKEEMTEFMNLVEEMGIEEENVQRIM
FT                   DTDNCPSKIKP"
FT   gene            2882838..2887336
FT                   /locus_tag="mCG_117617"
FT                   /note="gene_id=mCG117617.0"
FT   mRNA            join(2882838..2882973,2883458..2883597,2884039..2884109,
FT                   2887129..2887336)
FT                   /locus_tag="mCG_117617"
FT                   /product="mCG117617"
FT                   /note="gene_id=mCG117617.0 transcript_id=mCT118761.0
FT                   created on 16-MAY-2002"
FT   CDS             join(2882893..2882973,2883458..2883597,2884039..2884109,
FT                   2887129..2887181)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117617"
FT                   /product="mCG117617"
FT                   /note="gene_id=mCG117617.0 transcript_id=mCT118761.0
FT                   protein_id=mCP66591.1"
FT                   /protein_id="EDL29196.1"
FT                   /translation="MVKFLLIALALGVSCAHHESLDISPSEVNGDWRTLYIAADKVEKV
FT                   KMNGDLRAYFEHMECNDDCGTLKIKFHVQMNGKCQTHTVVGEKQEDGRYTTDSSQMTAR
FT                   SEVFPTSPLS"
FT   assembly_gap    2884243..2886369
FT                   /estimated_length=2127
FT                   /gap_type="unknown"
FT   assembly_gap    2895947..2897243
FT                   /estimated_length=1297
FT                   /gap_type="unknown"
FT   assembly_gap    2901668..2902503
FT                   /estimated_length=836
FT                   /gap_type="unknown"
FT   assembly_gap    2911654..2924743
FT                   /estimated_length=13090
FT                   /gap_type="unknown"
FT   assembly_gap    2932969..2933050
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    2936644..2960259
FT                   /estimated_length=23616
FT                   /gap_type="unknown"
FT   assembly_gap    2968011..2968259
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    2977045..2977064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2979588..2979719
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    2983602..2984358
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    2988768..2988787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2995854..3019821
FT                   /estimated_length=23968
FT                   /gap_type="unknown"
FT   assembly_gap    3029395..3029566
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    3033518..3033537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3049690..3054910
FT                   /estimated_length=5221
FT                   /gap_type="unknown"
FT   assembly_gap    3061929..3062231
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    3064354..3064513
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   gene            complement(<3069685..>3074145)
FT                   /locus_tag="mCG_1035450"
FT                   /note="gene_id=mCG1035450.1"
FT   mRNA            complement(join(<3069685..3070095,3074043..>3074145))
FT                   /locus_tag="mCG_1035450"
FT                   /product="mCG1035450"
FT                   /note="gene_id=mCG1035450.1 transcript_id=mCT153154.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(<3069685..3070095,3074043..>3074143))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035450"
FT                   /product="mCG1035450"
FT                   /note="gene_id=mCG1035450.1 transcript_id=mCT153154.1
FT                   protein_id=mCP66661.1"
FT                   /protein_id="EDL29195.1"
FT                   /translation="QEHLVPKIPGILQHHRHGGGPPETERVQNCSGKMRKIIPFGFRSA
FT                   SLKGSSSWTMSHRNKIPRHRWIILLMLEILVPSISGELRWGIMSTFPLPMPVMHNAQIF
FT                   PRFFTTDKELGLAYLPLDEQIQALQENRTFFLQGSLCFMLISSLQDKSQCISLHYQSAA
FT                   WLKRASFG"
FT   gene            <3085600..>3091363
FT                   /locus_tag="mCG_8683"
FT                   /note="gene_id=mCG8683.2"
FT   mRNA            join(<3085600..3085759,3086662..3086735,3091266..>3091363)
FT                   /locus_tag="mCG_8683"
FT                   /product="mCG8683"
FT                   /note="gene_id=mCG8683.2 transcript_id=mCT7377.2 created on
FT                   16-MAY-2002"
FT   CDS             join(<3085602..3085759,3086662..3086735,3091266..>3091363)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8683"
FT                   /product="mCG8683"
FT                   /note="gene_id=mCG8683.2 transcript_id=mCT7377.2
FT                   protein_id=mCP10133.2"
FT                   /protein_id="EDL29194.1"
FT                   /translation="GPWKTIAIAADNVDKIEISGEDKIEISGELRLYFHQITCEKECKK
FT                   MNVTFYVNENGQCSLTTITGYLQDDGNTYRSQFQGDNHYATVRTTPENIVFYSENVDRA
FT                   GRKTKL"
FT   assembly_gap    3087191..3087305
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    3092000..3092164
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    3101807..3107905
FT                   /estimated_length=6099
FT                   /gap_type="unknown"
FT   gene            complement(3110980..3116889)
FT                   /locus_tag="mCG_117626"
FT                   /note="gene_id=mCG117626.0"
FT   mRNA            complement(join(3110980..3111179,3111798..3111827,
FT                   3113038..3113136,3113834..3113944,3115253..3115326,
FT                   3116218..3116357,3116785..3116889))
FT                   /locus_tag="mCG_117626"
FT                   /product="mCG117626"
FT                   /note="gene_id=mCG117626.0 transcript_id=mCT118769.0
FT                   created on 15-MAY-2002"
FT   assembly_gap    3111559..3111578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(3111811..3111827,3113038..3113136,
FT                   3113834..3113944,3115253..3115326,3116218..3116357,
FT                   3116785..3116835))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117626"
FT                   /product="mCG117626"
FT                   /note="gene_id=mCG117626.0 transcript_id=mCT118769.0
FT                   protein_id=mCP66689.1"
FT                   /db_xref="GOA:Q9D3H2"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002448"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="MGI:MGI:1277949"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3H2"
FT                   /protein_id="EDL29193.1"
FT                   /translation="MAKFLLLALTFGLAHAAMEGPWKTVAIAADRVDKIERGGELRIYC
FT                   RSLTCEKECKEMKVTFYVNENGQCSLTTITGYLQEDGKTYKTQFQGNNRYKLVDESPEN
FT                   LTFYSENVDRADRKTKLLFILGHGPLTSEQKEKFAELAEEKGIPAGNIREVLITDYCPE
FT                   "
FT   assembly_gap    3119398..3122362
FT                   /estimated_length=2965
FT                   /gap_type="unknown"
FT   assembly_gap    3131028..3131181
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   gene            <3151117..>3154473
FT                   /locus_tag="mCG_10921"
FT                   /note="gene_id=mCG10921.2"
FT   mRNA            join(<3151117..3151256,3152162..3152235,3153561..3153671,
FT                   3154343..>3154473)
FT                   /locus_tag="mCG_10921"
FT                   /product="mCG10921"
FT                   /note="gene_id=mCG10921.2 transcript_id=mCT10707.2 created
FT                   on 16-MAY-2002"
FT   CDS             join(3151117..3151256,3152162..3152235,3153561..3153671,
FT                   3154343..3154473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10921"
FT                   /product="mCG10921"
FT                   /note="gene_id=mCG10921.2 transcript_id=mCT10707.2
FT                   protein_id=mCP2749.2"
FT                   /protein_id="EDL29192.1"
FT                   /translation="MEGPWKTVAIAADRVDKIERGGKLRIYCRSLTCEKECKEMKVTFY
FT                   VLENGQCSLTTITGYLQEDGKTYKTQYQGDNHYELVKETPENLVFYSENVDRADRKTKL
FT                   IFVLGNKPLTSEENERLVKYAVSSHIPPENIRHVLGTGKINACCFLL"
FT   assembly_gap    3160116..3160135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3164609..3167512
FT                   /estimated_length=2904
FT                   /gap_type="unknown"
FT   assembly_gap    3169073..3171503
FT                   /estimated_length=2431
FT                   /gap_type="unknown"
FT   assembly_gap    3178399..3178418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3190266..3190385
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    3194885..3195179
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    3198031..3199594
FT                   /estimated_length=1564
FT                   /gap_type="unknown"
FT   assembly_gap    3200979..3200998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3204855..3205080
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    3207623..3207642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3212519..3218813
FT                   /locus_tag="mCG_15434"
FT                   /note="gene_id=mCG15434.1"
FT   mRNA            join(<3212519..3212658,3215034..3215107,3216731..3216841,
FT                   3217528..3217629,3217964..3217994,3218595..3218813)
FT                   /locus_tag="mCG_15434"
FT                   /product="mCG15434"
FT                   /note="gene_id=mCG15434.1 transcript_id=mCT16314.1 created
FT                   on 16-MAY-2002"
FT   CDS             join(<3212519..3212658,3215034..3215107,3216731..3216841,
FT                   3217528..3217629,3217964..3217980)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15434"
FT                   /product="mCG15434"
FT                   /note="gene_id=mCG15434.1 transcript_id=mCT16314.1
FT                   protein_id=mCP23852.0"
FT                   /protein_id="EDL29191.1"
FT                   /translation="LQGQWKTTAIMADNIDKIETSGPLELFVREITCDEGCQKMKVTFY
FT                   VKQNGQCSLTTVTGYKQEDGKTFKNQYEGENNYKLLKATSENLVFYDENVDRASRKTKL
FT                   LYILGKGEALTHEQKERLTELATQKGIPAGNLRELAHEDTCPE"
FT   assembly_gap    3213737..3213756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3214770..3214789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3221498..3221517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3231850..3234116
FT                   /estimated_length=2267
FT                   /gap_type="unknown"
FT   assembly_gap    3240467..3240486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3254947..3254966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3257497..3262917
FT                   /estimated_length=5421
FT                   /gap_type="unknown"
FT   assembly_gap    3266012..3267205
FT                   /estimated_length=1194
FT                   /gap_type="unknown"
FT   assembly_gap    3268241..3272098
FT                   /estimated_length=3858
FT                   /gap_type="unknown"
FT   assembly_gap    3281054..3281073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3291740..3291759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3294095..3294114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3313388..3313671
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    3314582..3317100
FT                   /estimated_length=2519
FT                   /gap_type="unknown"
FT   assembly_gap    3319575..3319820
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    3341363..3341382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3355879..3361777
FT                   /estimated_length=5899
FT                   /gap_type="unknown"
FT   assembly_gap    3364029..3364048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3368251..3368270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3370661..3370680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3372445..3372464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3374457..3375627
FT                   /estimated_length=1171
FT                   /gap_type="unknown"
FT   assembly_gap    3376945..3376964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3378903..3379233)
FT                   /pseudo
FT                   /locus_tag="mCG_1035449"
FT                   /note="gene_id=mCG1035449.1"
FT   mRNA            complement(3378903..3379233)
FT                   /pseudo
FT                   /locus_tag="mCG_1035449"
FT                   /note="gene_id=mCG1035449.1 transcript_id=mCT153153.1
FT                   created on 15-MAY-2002"
FT   assembly_gap    3380170..3380189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3390791..3392248
FT                   /locus_tag="mCG_52719"
FT                   /note="gene_id=mCG52719.2"
FT   mRNA            <3390791..3392248
FT                   /locus_tag="mCG_52719"
FT                   /product="mCG52719"
FT                   /note="gene_id=mCG52719.2 transcript_id=mCT52902.2 created
FT                   on 16-MAY-2002"
FT   CDS             3390791..3391975
FT                   /codon_start=1
FT                   /locus_tag="mCG_52719"
FT                   /product="mCG52719"
FT                   /note="gene_id=mCG52719.2 transcript_id=mCT52902.2
FT                   protein_id=mCP30388.1"
FT                   /db_xref="GOA:Q0VG34"
FT                   /db_xref="MGI:MGI:1922160"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VG34"
FT                   /protein_id="EDL29190.1"
FT                   /translation="MGDQRLPENQLPRLPRCKPVLKHKTEQQTSTPFMEDHHQHFSQEE
FT                   LDDFTTDYEPHEEISSQTIQGTVFPRISHKLSSTATKMNQRKLPKDLGLFSSISMGQQG
FT                   IRRPQYKLDHLSQMEDDAEEYSINLKEQPKCDQNLKKWPSFKNKMKVNKNSKHGKKLHN
FT                   LHPPENSRLGQKKFLPTHTSRNKNLLDPLYYRCTQRGGDNTHELNEAMGNLDVLQQFEM
FT                   DYANQPTYDEFSDKIISLPPSKLKYFRGLTKENGIKVCKQISKFDMKVQKPHDLSLSTK
FT                   EKFKHGPSYQKVKQLKTQAVKEPLNDPKSLPEIEGKNVCKPDVLENLYGAIAFKDFIVH
FT                   KGYDMPGILQKLFMKKGWNYNSVNTPIPSVLKYHEMIQKKMDDEDDENSGNELY"
FT   assembly_gap    3395273..3395556
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   assembly_gap    3398434..3398453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3402277..3402296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3406571..3406590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3411932..3412445
FT                   /pseudo
FT                   /locus_tag="mCG_13162"
FT                   /note="gene_id=mCG13162.1"
FT   mRNA            3411932..3412445
FT                   /pseudo
FT                   /locus_tag="mCG_13162"
FT                   /note="gene_id=mCG13162.1 transcript_id=mCT11453.1 created
FT                   on 16-MAY-2002"
FT   assembly_gap    3414447..3414466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3419209..3419667
FT                   /estimated_length=459
FT                   /gap_type="unknown"
FT   assembly_gap    3429538..3429716
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            3437363..3438441
FT                   /pseudo
FT                   /locus_tag="mCG_1035430"
FT                   /note="gene_id=mCG1035430.1"
FT   mRNA            3437363..3438441
FT                   /pseudo
FT                   /locus_tag="mCG_1035430"
FT                   /note="gene_id=mCG1035430.1 transcript_id=mCT153134.1
FT                   created on 16-MAY-2002"
FT   assembly_gap    3450443..3451277
FT                   /estimated_length=835
FT                   /gap_type="unknown"
FT   assembly_gap    3457737..3457756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3484212..3484762
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   gene            complement(3488899..3602616)
FT                   /locus_tag="mCG_67361"
FT                   /note="gene_id=mCG67361.2"
FT   mRNA            complement(join(3488899..3489759,3501382..3501417,
FT                   3502707..3502867,3512151..3512219,3536352..3536491,
FT                   3539684..3539734,3602529..3602616))
FT                   /locus_tag="mCG_67361"
FT                   /product="mCG67361"
FT                   /note="gene_id=mCG67361.2 transcript_id=mCT67544.2 created
FT                   on 15-MAY-2002"
FT   CDS             complement(join(3489423..3489759,3501382..3501417,
FT                   3502707..3502747))
FT                   /codon_start=1
FT                   /locus_tag="mCG_67361"
FT                   /product="mCG67361"
FT                   /note="gene_id=mCG67361.2 transcript_id=mCT67544.2
FT                   protein_id=mCP25092.2"
FT                   /protein_id="EDL29189.1"
FT                   /translation="MKKPERLLKIMKKLLHSFPNNLLLPCFHHCRCHHYFLPVLHLRQA
FT                   RGLHSQVNPTPEMEFQRRRGQHQHHWCPLHTSRVSMAYPLLILPATLTATLSSQVMQNN
FT                   HPDCEVPSTATSSPSSMSPTSTCPWLPSVTSEV"
FT   assembly_gap    3509775..3509794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3512550..3513004
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    3528419..3528469
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    3534672..3534927
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    3542382..3542407
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    3563595..3563651
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    3569886..3569905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3572991..3573010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3598390..3598409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3600467..3600486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3601883..3601902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3614581..3614600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3633088..3633153
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    3634875..3634933
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            3643501..3643866
FT                   /pseudo
FT                   /locus_tag="mCG_16058"
FT                   /note="gene_id=mCG16058.2"
FT   mRNA            3643501..3643866
FT                   /pseudo
FT                   /locus_tag="mCG_16058"
FT                   /note="gene_id=mCG16058.2 transcript_id=mCT15141.2 created
FT                   on 16-MAY-2002"
FT   assembly_gap    3662025..3662044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3663350..3663647
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    3671272..3671292
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    3672338..3672357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3677362..3677594
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    3681595..3682320
FT                   /estimated_length=726
FT                   /gap_type="unknown"
FT   assembly_gap    3687531..3688507
FT                   /estimated_length=977
FT                   /gap_type="unknown"
FT   gene            complement(3693605..3694626)
FT                   /pseudo
FT                   /locus_tag="mCG_146375"
FT                   /note="gene_id=mCG146375.0"
FT   mRNA            complement(3693605..3694626)
FT                   /pseudo
FT                   /locus_tag="mCG_146375"
FT                   /note="gene_id=mCG146375.0 transcript_id=mCT186576.0
FT                   created on 16-JUL-2003"
FT   assembly_gap    3697464..3697483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3702753..3702772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3721693..3726770
FT                   /estimated_length=5078
FT                   /gap_type="unknown"
FT   gene            3748686..3750325
FT                   /locus_tag="mCG_1035446"
FT                   /note="gene_id=mCG1035446.0"
FT   mRNA            3748686..3750325
FT                   /locus_tag="mCG_1035446"
FT                   /product="mCG1035446"
FT                   /note="gene_id=mCG1035446.0 transcript_id=mCT153150.0
FT                   created on 28-MAY-2003"
FT   CDS             3748738..3750030
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035446"
FT                   /product="mCG1035446"
FT                   /note="gene_id=mCG1035446.0 transcript_id=mCT153150.0
FT                   protein_id=mCP66580.0"
FT                   /db_xref="GOA:Q14BE7"
FT                   /db_xref="MGI:MGI:1918114"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BE7"
FT                   /protein_id="EDL29188.1"
FT                   /translation="MGEQWLPWNRPRQVLQPMPLGMTCKPWFKDRLPSKCFAKHKQEQH
FT                   KFPTSLDGRRWVFVKEGLDDFRKGCPPSEGMIIRGPKDGFLPTISHEVHHGSRKSQKNR
FT                   CQDLSLFSSLSLAQQARKAFVKRTEAKLTQRPLVFWPLEDGIPSDIELLENVLEALDTD
FT                   QKLEAKVDHCEDRRKYIHSVHLPSVAEESSEKEEPEPHRFPGSRKYSMLQEKKPRKKNP
FT                   AKQSLYYHHIPKGVYDFCAWVNSFGDLGIDEHFMMKQFDIGYECKPVYTDSAIKKISLL
FT                   PPDLRFCRRLSKVKEIRFSIQEANFERKLRKPFDPYKSNRDKIRYGAWYLKPYLWKKLV
FT                   NDEPLMDPEELFELEGGKYSKPDIIEDLYGTIAFKDFILSKGYSMPAILEKLFMRKGWN
FT                   YDTVNTPIPRVLKAHELIMQQRDEDYDDEND"
FT   assembly_gap    3758673..3758692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3791873..3791892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3796673..3797599
FT                   /pseudo
FT                   /locus_tag="mCG_49035"
FT                   /note="gene_id=mCG49035.2"
FT   mRNA            3796673..3797599
FT                   /pseudo
FT                   /locus_tag="mCG_49035"
FT                   /note="gene_id=mCG49035.2 transcript_id=mCT49218.2 created
FT                   on 16-MAY-2002"
FT   assembly_gap    3798217..3798236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3803512..3803764
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    3804789..3804887
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    3827668..3827800
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    3837695..3837714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3849889..3850430
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   gene            complement(3866222..>3869565)
FT                   /locus_tag="mCG_130887"
FT                   /note="gene_id=mCG130887.1"
FT   mRNA            complement(join(3866222..3867743,3869375..>3869565))
FT                   /locus_tag="mCG_130887"
FT                   /product="mCG130887"
FT                   /note="gene_id=mCG130887.1 transcript_id=mCT132214.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(3866678..3867743,3869375..>3869466))
FT                   /codon_start=1
FT                   /locus_tag="mCG_130887"
FT                   /product="mCG130887"
FT                   /note="gene_id=mCG130887.1 transcript_id=mCT132214.1
FT                   protein_id=mCP66601.0"
FT                   /protein_id="EDL29187.1"
FT                   /translation="EKVDLNKIWMELGKGLLIWRRRKMQPGYKARSRSFSSPSPSPTPS
FT                   PHRPPVRTKGEPTPPSSKAREKSIKKPATPPAPSQATKSTAPGPEPAKPGDLQEARRKE
FT                   RQTRTPPRRRTPSSSGSGSGSSYSGSSSRSRSLSVSSLSSVSSATSSSSSVHSVDSDDM
FT                   YADLASPVSSASSRSPTPAQTKKERGKSKKEDGVREEKRKRDPSTQPPKSSKAPAGGKA
FT                   SQQAAAPQPAAPGQPQQGSFVAHKEIKLTLLNKAADKGSRKRYEPSDKDHRQSPPAKKA
FT                   NLSPDRGSGDRKSGGRMGSPKPEMQRGQNAKAPAAPADRKRPLSPQSKGSSKVTIVPGK
FT                   ATDTATAGTKSGKASTLSRREELLKQLKKVEEAIARKRAKIPGKM"
FT   assembly_gap    3873394..3874373
FT                   /estimated_length=980
FT                   /gap_type="unknown"
FT   assembly_gap    3901804..3901823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3903161..3905908
FT                   /estimated_length=2748
FT                   /gap_type="unknown"
FT   assembly_gap    3917450..3917637
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    3945352..3945515
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    3952171..3952190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3969374..3969448
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    3975451..3976324
FT                   /estimated_length=874
FT                   /gap_type="unknown"
FT   assembly_gap    3981771..3983308
FT                   /estimated_length=1538
FT                   /gap_type="unknown"
FT   assembly_gap    3986595..3987018
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    3988898..3988998
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    4008329..4008348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4015626..4015645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4033371..4035856
FT                   /estimated_length=2486
FT                   /gap_type="unknown"
FT   assembly_gap    4036598..4037423
FT                   /estimated_length=826
FT                   /gap_type="unknown"
FT   assembly_gap    4049680..4049699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4052906..4053238
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    4069162..4074152
FT                   /estimated_length=4991
FT                   /gap_type="unknown"
FT   assembly_gap    4097902..4098228
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    4111389..4111408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4118912..4118931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4119941..4119960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4129933..4130504
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    4132530..4132930
FT                   /estimated_length=401
FT                   /gap_type="unknown"
FT   assembly_gap    4137662..4138035
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    4144644..4146518
FT                   /estimated_length=1875
FT                   /gap_type="unknown"
FT   assembly_gap    4147402..4148560
FT                   /estimated_length=1159
FT                   /gap_type="unknown"
FT   assembly_gap    4150451..4150470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4172282..4172382
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    4179703..4179722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4192369..4192388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4193802..4194321
FT                   /locus_tag="mCG_8156"
FT                   /note="gene_id=mCG8156.2"
FT   mRNA            4193802..4194321
FT                   /locus_tag="mCG_8156"
FT                   /product="mCG8156"
FT                   /note="gene_id=mCG8156.2 transcript_id=mCT7714.2 created on
FT                   16-MAY-2002"
FT   CDS             4193832..4194233
FT                   /codon_start=1
FT                   /locus_tag="mCG_8156"
FT                   /product="mCG8156"
FT                   /note="gene_id=mCG8156.2 transcript_id=mCT7714.2
FT                   protein_id=mCP8286.2"
FT                   /protein_id="EDL29186.1"
FT                   /translation="MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLA
FT                   KMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSR
FT                   KQRKERKNRMKKVRGTAKANVGVGKKPKE"
FT   assembly_gap    4196516..4196535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4212082..4212101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4214035..4215057
FT                   /estimated_length=1023
FT                   /gap_type="unknown"
FT   assembly_gap    4222309..4222328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4232928..4233847
FT                   /estimated_length=920
FT                   /gap_type="unknown"
FT   assembly_gap    4234853..4236196
FT                   /estimated_length=1344
FT                   /gap_type="unknown"
FT   gene            4240280..4240853
FT                   /pseudo
FT                   /locus_tag="mCG_1035499"
FT                   /note="gene_id=mCG1035499.1"
FT   mRNA            4240280..4240853
FT                   /pseudo
FT                   /locus_tag="mCG_1035499"
FT                   /note="gene_id=mCG1035499.1 transcript_id=mCT153203.1
FT                   created on 16-MAY-2002"
FT   assembly_gap    4242523..4242672
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    4244067..4244086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4247494..4247513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4252887..4253382
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   gene            complement(4264541..>4293103)
FT                   /locus_tag="mCG_140396"
FT                   /note="gene_id=mCG140396.0"
FT   mRNA            complement(join(4264541..4264759,4275679..4275847,
FT                   4293065..>4293103))
FT                   /locus_tag="mCG_140396"
FT                   /product="mCG140396"
FT                   /note="gene_id=mCG140396.0 transcript_id=mCT169406.0
FT                   created on 14-MAY-2002"
FT   CDS             complement(join(4264547..4264759,4275679..4275847,
FT                   4293065..>4293102))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140396"
FT                   /product="mCG140396"
FT                   /note="gene_id=mCG140396.0 transcript_id=mCT169406.0
FT                   protein_id=mCP92172.0"
FT                   /protein_id="EDL29185.1"
FT                   /translation="TSETEFRLTSQTRYYEPFVAHFLPGSDQEFFVKPQSGELPPFYTK
FT                   GIVIIVGFKPRMYSKKYQATLVIQTDEIYWLYEINGLAPSSKSLTHVTAKVDATSKIYD
FT                   CMPPIQRNFIRENAKLRSTAVSSTVKGAPLFKKHK"
FT   assembly_gap    4270000..4270425
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   assembly_gap    4283933..4285835
FT                   /estimated_length=1903
FT                   /gap_type="unknown"
FT   assembly_gap    4287165..4287890
FT                   /estimated_length=726
FT                   /gap_type="unknown"
FT   assembly_gap    4296598..4297877
FT                   /estimated_length=1280
FT                   /gap_type="unknown"
FT   assembly_gap    4298926..4299931
FT                   /estimated_length=1006
FT                   /gap_type="unknown"
FT   assembly_gap    4332619..4332785
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    4355346..4355416
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    4385283..4385337
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    4396873..4396892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4398442..4399666
FT                   /estimated_length=1225
FT                   /gap_type="unknown"
FT   assembly_gap    4409565..4409598
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    4415392..4415411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4431424..4431886
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    4453426..4453445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4459645..4459664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4478424..4478443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4498080..4498099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4503771..4503973
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    4507088..4507112
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    4510827..4511140
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    4519884..4520229
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    4531223..4531804
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    4536463..4538795
FT                   /estimated_length=2333
FT                   /gap_type="unknown"
FT   assembly_gap    4540081..4542913
FT                   /estimated_length=2833
FT                   /gap_type="unknown"
FT   assembly_gap    4561885..4564252
FT                   /estimated_length=2368
FT                   /gap_type="unknown"
FT   assembly_gap    4565854..4565873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4576130..4576772
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   assembly_gap    4577806..4577825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4588424..4588443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4590265..4590284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4599277..4599296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4608037..4609883
FT                   /estimated_length=1847
FT                   /gap_type="unknown"
FT   assembly_gap    4618081..4618996
FT                   /estimated_length=916
FT                   /gap_type="unknown"
FT   gene            complement(<4618999..4629869)
FT                   /locus_tag="mCG_58636"
FT                   /note="gene_id=mCG58636.2"
FT   mRNA            complement(join(<4618999..4619177,4622195..4622274,
FT                   4629842..4629869))
FT                   /locus_tag="mCG_58636"
FT                   /product="mCG58636"
FT                   /note="gene_id=mCG58636.2 transcript_id=mCT58819.2 created
FT                   on 14-MAY-2002"
FT   CDS             complement(<4618999..4619172)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58636"
FT                   /product="mCG58636"
FT                   /note="gene_id=mCG58636.2 transcript_id=mCT58819.2
FT                   protein_id=mCP27920.2"
FT                   /protein_id="EDL29184.1"
FT                   /translation="MSQSSEECAADQGQTCEETQKLQVAAASIDVEEPCSSPHLMATSL
FT                   KDQTSEETQVSKD"
FT   assembly_gap    4620784..4620841
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    4625409..4625428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4625517..4626227)
FT                   /pseudo
FT                   /locus_tag="mCG_130522"
FT                   /note="gene_id=mCG130522.1"
FT   mRNA            complement(4625517..4626227)
FT                   /pseudo
FT                   /locus_tag="mCG_130522"
FT                   /note="gene_id=mCG130522.1 transcript_id=mCT131847.1
FT                   created on 14-MAY-2002"
FT   assembly_gap    4665207..4665322
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    4667017..4667093
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    4671037..4671306
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    4675725..4675924
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    4682739..4682758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4686623..4687896
FT                   /estimated_length=1274
FT                   /gap_type="unknown"
FT   assembly_gap    4688596..4688679
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    4690381..4690400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4691698..4693399
FT                   /estimated_length=1702
FT                   /gap_type="unknown"
FT   assembly_gap    4695712..4696239
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    4702070..4706444
FT                   /estimated_length=4375
FT                   /gap_type="unknown"
FT   assembly_gap    4719925..4720064
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    4726976..4728249
FT                   /estimated_length=1274
FT                   /gap_type="unknown"
FT   assembly_gap    4736116..4736159
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    4749967..4749986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4763665..4763684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4765945..4766193
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    4769786..4776567
FT                   /estimated_length=6782
FT                   /gap_type="unknown"
FT   assembly_gap    4781751..4781770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4793516..4795424
FT                   /estimated_length=1909
FT                   /gap_type="unknown"
FT   assembly_gap    4796793..4797311
FT                   /estimated_length=519
FT                   /gap_type="unknown"
FT   assembly_gap    4802536..4810258
FT                   /estimated_length=7723
FT                   /gap_type="unknown"
FT   assembly_gap    4815075..4815722
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    4819165..4819946
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   assembly_gap    4824671..4824690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4836476..4836495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4838654..4840425
FT                   /estimated_length=1772
FT                   /gap_type="unknown"
FT   assembly_gap    4862692..4862711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4865664..4866121
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    4881859..4881878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4884883..4884902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4886156..>4887108)
FT                   /locus_tag="mCG_1035426"
FT                   /note="gene_id=mCG1035426.1"
FT   mRNA            complement(4886156..>4887108)
FT                   /locus_tag="mCG_1035426"
FT                   /product="mCG1035426"
FT                   /note="gene_id=mCG1035426.1 transcript_id=mCT153130.1
FT                   created on 14-MAY-2002"
FT   CDS             complement(4886248..4887108)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035426"
FT                   /product="mCG1035426"
FT                   /note="gene_id=mCG1035426.1 transcript_id=mCT153130.1
FT                   protein_id=mCP66749.0"
FT                   /protein_id="EDL29183.1"
FT                   /translation="MGYDVTRFQGFIDEDLICPICNGVLEDPVQAPHCEHAFCNACIIQ
FT                   WFSQQQTCPVDHSFVTVAHLRPVPRIMRNILSKLKIACDNTVFGCSARVRLDNLMSHLS
FT                   VCEYNLKQPVTCEQGCGLEIPKNELPNHNCIKHLRSVFQQQQTLISELEKTSAEHKHQL
FT                   AEQKHEIKLMKAYMRKIHRVNPNLQNLEEIIEYNEILEWLNSPQPPATETNWGGMISSP
FT                   DTVLQTVINHSTVESGSPTSPGNELSENAHEYSESQGVATLETRQMNQHYYENYMTRTL
FT                   LTIRL"
FT   gene            <4888223..4888379
FT                   /locus_tag="mCG_1035406"
FT                   /note="gene_id=mCG1035406.1"
FT   mRNA            <4888223..4888379
FT                   /locus_tag="mCG_1035406"
FT                   /product="mCG1035406"
FT                   /note="gene_id=mCG1035406.1 transcript_id=mCT153110.1
FT                   created on 16-MAY-2002"
FT   CDS             <4888224..4888346
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035406"
FT                   /product="mCG1035406"
FT                   /note="gene_id=mCG1035406.1 transcript_id=mCT153110.1
FT                   protein_id=mCP66618.1"
FT                   /protein_id="EDL29182.1"
FT                   /translation="GGHLIRFAFPVDSDGITLNSSHLPQFKFRNYKFQSQLNLC"
FT   assembly_gap    4892799..4892818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4897319..4897338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4905718..4908888
FT                   /estimated_length=3171
FT                   /gap_type="unknown"
FT   assembly_gap    4915084..4915843
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   assembly_gap    4925942..4925973
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4952062..4952081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4955417..4955436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4957546..4957665
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    4970544..4970751
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    4976416..4976853
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    4982642..4982661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4987089..4987108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5008221..5008255
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    5010748..5010767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5023809..5023828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<5043685..5044393)
FT                   /locus_tag="mCG_50268"
FT                   /note="gene_id=mCG50268.1"
FT   mRNA            complement(<5043685..5044393)
FT                   /locus_tag="mCG_50268"
FT                   /product="mCG50268"
FT                   /note="gene_id=mCG50268.1 transcript_id=mCT50451.1 created
FT                   on 14-MAY-2002"
FT   CDS             complement(5043685..5044350)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50268"
FT                   /product="mCG50268"
FT                   /note="gene_id=mCG50268.1 transcript_id=mCT50451.1
FT                   protein_id=mCP35808.0"
FT                   /protein_id="EDL29181.1"
FT                   /translation="MAAKVFESIGKFNLALSVAGGMVNSALHNVDAGHRAVIFDQFRGV
FT                   QDIVVGDGTHFLIPWVQKPIIFDCPSRPLDVLVITGSKDLQNINITLHILFLLVASQLP
FT                   CIYTSIGEDYDERVLLSIITEILKSAVAQFNAGELITQRELVSRQVSHDLTEREATFGL
FT                   ILDAMSLTYQTFRKKFTEVVEAKQVAHQEAERARSVVEKAEQQKKAAIISVEGDSKAA"
FT   assembly_gap    5050039..5050345
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    5061909..5061928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5075429..5077160
FT                   /estimated_length=1732
FT                   /gap_type="unknown"
FT   assembly_gap    5081849..5081941
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    5084468..5088387
FT                   /estimated_length=3920
FT                   /gap_type="unknown"
FT   assembly_gap    5107865..5108182
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    5112991..5113458
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    5122102..5128683
FT                   /estimated_length=6582
FT                   /gap_type="unknown"
FT   assembly_gap    5135304..5135323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5136452..5137612
FT                   /estimated_length=1161
FT                   /gap_type="unknown"
FT   assembly_gap    5139018..5139037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5149102..5149121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5151705..5151724
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5156118..5156289
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    5159138..5159157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5166210..5166229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5166230..5166852)
FT                   /locus_tag="mCG_130521"
FT                   /note="gene_id=mCG130521.1"
FT   mRNA            complement(5166230..5166852)
FT                   /locus_tag="mCG_130521"
FT                   /product="mCG130521"
FT                   /note="gene_id=mCG130521.1 transcript_id=mCT131846.1
FT                   created on 14-MAY-2002"
FT   CDS             complement(5166615..5166818)
FT                   /codon_start=1
FT                   /locus_tag="mCG_130521"
FT                   /product="mCG130521"
FT                   /note="gene_id=mCG130521.1 transcript_id=mCT131846.1
FT                   protein_id=mCP66570.1"
FT                   /protein_id="EDL29180.1"
FT                   /translation="MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIV
FT                   KDIIHDPGRGAPLAKVVFRDPY"
FT   assembly_gap    5167448..5167467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5179274..5180563)
FT                   /pseudo
FT                   /locus_tag="mCG_130520"
FT                   /note="gene_id=mCG130520.2"
FT   mRNA            complement(join(5179274..5180028,5180059..5180563))
FT                   /pseudo
FT                   /locus_tag="mCG_130520"
FT                   /note="gene_id=mCG130520.2 transcript_id=mCT131845.2
FT                   created on 21-NOV-2001"
FT   assembly_gap    5180037..5180056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5182391..5182885)
FT                   /pseudo
FT                   /locus_tag="mCG_1035425"
FT                   /note="gene_id=mCG1035425.1"
FT   mRNA            complement(5182391..5182885)
FT                   /pseudo
FT                   /locus_tag="mCG_1035425"
FT                   /note="gene_id=mCG1035425.1 transcript_id=mCT153129.1
FT                   created on 14-MAY-2002"
FT   assembly_gap    5186421..5186484
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    5189770..5189789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5193781..5194255
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    5202832..5203028
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    5208229..5208355
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    5220558..5220577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5225839..5225997
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    5227988..5228065
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            complement(5232300..5242861)
FT                   /pseudo
FT                   /locus_tag="mCG_1035490"
FT                   /note="gene_id=mCG1035490.1"
FT   mRNA            complement(join(5232300..5232496,5239615..5239830,
FT                   5240569..5242861))
FT                   /pseudo
FT                   /locus_tag="mCG_1035490"
FT                   /note="gene_id=mCG1035490.1 transcript_id=mCT153194.1
FT                   created on 14-MAY-2002"
FT   assembly_gap    5232497..5232516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5234283..5239475
FT                   /estimated_length=5193
FT                   /gap_type="unknown"
FT   assembly_gap    5245343..5245362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5246372..5246391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5251088..5251107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5255263..5255282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5269867..5270042
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    5284015..5284034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5301489..5301742
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    5305337..5305356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5314224..5314385
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    5330356..5330375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5354063..5355010
FT                   /estimated_length=948
FT                   /gap_type="unknown"
FT   assembly_gap    5357250..5359873
FT                   /estimated_length=2624
FT                   /gap_type="unknown"
FT   assembly_gap    5362485..5362504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5365251..5373625
FT                   /estimated_length=8375
FT                   /gap_type="unknown"
FT   assembly_gap    5374990..5375593
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    5380631..5380650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5404761..5405131
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    5416012..5416031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5420398..5420417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5435644..5435883
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   gene            5436845..5438961
FT                   /locus_tag="mCG_1035404"
FT                   /note="gene_id=mCG1035404.1"
FT   mRNA            join(5436845..5437518,5438361..5438961)
FT                   /locus_tag="mCG_1035404"
FT                   /product="mCG1035404"
FT                   /note="gene_id=mCG1035404.1 transcript_id=mCT153108.1
FT                   created on 16-MAY-2002"
FT   CDS             join(5436891..5437518,5438361..5438452)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035404"
FT                   /product="mCG1035404"
FT                   /note="gene_id=mCG1035404.1 transcript_id=mCT153108.1
FT                   protein_id=mCP66614.1"
FT                   /protein_id="EDL29179.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGVHSQKSYCSLNRK
FT                   PFLFRTVIATVCKKCSY"
FT   assembly_gap    5437519..5438360
FT                   /estimated_length=842
FT                   /gap_type="unknown"
FT   assembly_gap    5440976..5441456
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    5444887..5445149
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    5448832..5452442
FT                   /estimated_length=3611
FT                   /gap_type="unknown"
FT   assembly_gap    5459328..5459446
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    5463529..5463548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5480335..5480425
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    5481753..5495335
FT                   /estimated_length=13583
FT                   /gap_type="unknown"
FT   assembly_gap    5500572..5500591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5509085..5509111
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    5514528..5515432
FT                   /estimated_length=905
FT                   /gap_type="unknown"
FT   gene            complement(5516442..5518838)
FT                   /locus_tag="mCG_119749"
FT                   /note="gene_id=mCG119749.1"
FT   mRNA            complement(join(5516442..5518719,5518772..5518838))
FT                   /locus_tag="mCG_119749"
FT                   /product="mCG119749, transcript variant mCT169400"
FT                   /note="gene_id=mCG119749.1 transcript_id=mCT169400.0
FT                   created on 14-MAY-2002"
FT   mRNA            complement(join(5516442..5517642,5517762..5518835))
FT                   /locus_tag="mCG_119749"
FT                   /product="mCG119749, transcript variant mCT169399"
FT                   /note="gene_id=mCG119749.1 transcript_id=mCT169399.0
FT                   created on 14-MAY-2002"
FT   mRNA            complement(5516442..5518835)
FT                   /locus_tag="mCG_119749"
FT                   /product="mCG119749, transcript variant mCT120926"
FT                   /note="gene_id=mCG119749.1 transcript_id=mCT120926.1
FT                   created on 14-MAY-2002"
FT   CDS             complement(5517301..5518449)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119749"
FT                   /product="mCG119749, isoform CRA_a"
FT                   /note="gene_id=mCG119749.1 transcript_id=mCT120926.1
FT                   protein_id=mCP66632.1 isoform=CRA_a"
FT                   /protein_id="EDL29176.1"
FT                   /translation="MRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPL
FT                   RGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDLGRPSGKGIV
FT                   EFSGKPAAPKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKVRE
FT                   QPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVML
FT                   MRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRHCEEEMRRQQEEMMRRQQEGF
FT                   KGTFPDEREQEILMGQMAMGGAMGINNRGAMPPAPVPPGTPAPPGPATLMPDGTLGLTP
FT                   PTTEQFGQAATMEGIGAIGGTPPAFNRPAPGAEFAPNKRRRY"
FT   CDS             complement(5517301..5518449)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119749"
FT                   /product="mCG119749, isoform CRA_a"
FT                   /note="gene_id=mCG119749.1 transcript_id=mCT169400.0
FT                   protein_id=mCP92169.0 isoform=CRA_a"
FT                   /protein_id="EDL29178.1"
FT                   /translation="MRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPL
FT                   RGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDLGRPSGKGIV
FT                   EFSGKPAAPKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKVRE
FT                   QPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVML
FT                   MRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRHCEEEMRRQQEEMMRRQQEGF
FT                   KGTFPDEREQEILMGQMAMGGAMGINNRGAMPPAPVPPGTPAPPGPATLMPDGTLGLTP
FT                   PTTEQFGQAATMEGIGAIGGTPPAFNRPAPGAEFAPNKRRRY"
FT   CDS             complement(join(5517590..5517642,5517762..5518449))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119749"
FT                   /product="mCG119749, isoform CRA_b"
FT                   /note="gene_id=mCG119749.1 transcript_id=mCT169399.0
FT                   protein_id=mCP92178.0 isoform=CRA_b"
FT                   /protein_id="EDL29177.1"
FT                   /translation="MRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPL
FT                   RGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDLGRPSGKGIV
FT                   EFSGKPAAPKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKVRE
FT                   QPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVML
FT                   MRQDLMRPRGNDAPTAGRIQGNLP"
FT   assembly_gap    5522305..5526100
FT                   /estimated_length=3796
FT                   /gap_type="unknown"
FT   assembly_gap    5527941..5534875
FT                   /estimated_length=6935
FT                   /gap_type="unknown"
FT   assembly_gap    5535939..5535958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5547719..5552680
FT                   /estimated_length=4962
FT                   /gap_type="unknown"
FT   assembly_gap    5567405..5567424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5572361..5572380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5580805..5580824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5582321..5582448
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    5587669..5587897
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    5590732..5590835
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    5600662..5600681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5612289..5612308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5613885..>5614098
FT                   /locus_tag="mCG_1035424"
FT                   /note="gene_id=mCG1035424.1"
FT   mRNA            <5613885..>5614098
FT                   /locus_tag="mCG_1035424"
FT                   /product="mCG1035424"
FT                   /note="gene_id=mCG1035424.1 transcript_id=mCT153128.1
FT                   created on 16-MAY-2002"
FT   CDS             <5613893..>5614098
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035424"
FT                   /product="mCG1035424"
FT                   /note="gene_id=mCG1035424.1 transcript_id=mCT153128.1
FT                   protein_id=mCP66745.1"
FT                   /protein_id="EDL29175.1"
FT                   /translation="QDQSFRRMDSEVQRDVRILDLIDDAWQEDKLPYDDVAILLSELPE
FT                   PEQDNCGTTESVKEQEMKWTDLAL"
FT   assembly_gap    5623257..5623276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5634471..5634678
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    5640571..5640677
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    5642610..5642629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5667953..5668039
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    5678464..5678483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5685942..5689096
FT                   /estimated_length=3155
FT                   /gap_type="unknown"
FT   assembly_gap    5692390..5692409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5695979..5696125
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    5697719..5701278
FT                   /estimated_length=3560
FT                   /gap_type="unknown"
FT   assembly_gap    5710866..5712160
FT                   /estimated_length=1295
FT                   /gap_type="unknown"
FT   assembly_gap    5713357..5714784
FT                   /estimated_length=1428
FT                   /gap_type="unknown"
FT   assembly_gap    5719307..5719893
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    5739247..5739389
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    5764856..5768423
FT                   /estimated_length=3568
FT                   /gap_type="unknown"
FT   assembly_gap    5769999..5776863
FT                   /estimated_length=6865
FT                   /gap_type="unknown"
FT   assembly_gap    5779060..5779192
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    5781964..5782063
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    5790181..5790200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5794075..5794596
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    5806614..5806801
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    5815236..5815457
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    5828716..5828810
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    5839305..5842938
FT                   /estimated_length=3634
FT                   /gap_type="unknown"
FT   assembly_gap    5844599..5844718
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    5848662..5850480
FT                   /estimated_length=1819
FT                   /gap_type="unknown"
FT   assembly_gap    5865717..5865909
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    5869180..5869959
FT                   /estimated_length=780
FT                   /gap_type="unknown"
FT   assembly_gap    5871256..5871275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5887361..5887380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5903195..5903504
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    5906676..5907319
FT                   /estimated_length=644
FT                   /gap_type="unknown"
FT   assembly_gap    5911102..5911121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5912976..5915964
FT                   /estimated_length=2989
FT                   /gap_type="unknown"
FT   assembly_gap    5918263..5918430
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    5924370..5924397
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            5924398..5925377
FT                   /locus_tag="mCG_140467"
FT                   /note="gene_id=mCG140467.0"
FT   mRNA            join(5924398..5924710,5924782..5925377)
FT                   /locus_tag="mCG_140467"
FT                   /product="mCG140467, transcript variant mCT169670"
FT                   /note="gene_id=mCG140467.0 transcript_id=mCT169670.0
FT                   created on 16-MAY-2002"
FT   mRNA            5924398..>5925376
FT                   /locus_tag="mCG_140467"
FT                   /product="mCG140467, transcript variant mCT169669"
FT                   /note="gene_id=mCG140467.0 transcript_id=mCT169669.0
FT                   created on 16-MAY-2002"
FT   mRNA            join(5924398..5924743,5924817..>5925376)
FT                   /locus_tag="mCG_140467"
FT                   /product="mCG140467, transcript variant mCT169667"
FT                   /note="gene_id=mCG140467.0 transcript_id=mCT169667.0
FT                   created on 16-MAY-2002"
FT   mRNA            join(5924398..5924721,5924796..>5925376)
FT                   /locus_tag="mCG_140467"
FT                   /product="mCG140467, transcript variant mCT169668"
FT                   /note="gene_id=mCG140467.0 transcript_id=mCT169668.0
FT                   created on 16-MAY-2002"
FT   CDS             5924927..5925376
FT                   /codon_start=1
FT                   /locus_tag="mCG_140467"
FT                   /product="mCG140467, isoform CRA_a"
FT                   /note="gene_id=mCG140467.0 transcript_id=mCT169667.0
FT                   protein_id=mCP92699.0 isoform=CRA_a"
FT                   /protein_id="EDL29171.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLKLCVEAVKTGQKILIE
FT                   QQESMSEKEKGLKRKRKKKGDTVLSGGQEGRNKRAEVEEEGELAFVPPPYASSAATCRW
FT                   TFCLEIWRGSTRSGVDVGERVCLCVSTGPDGTSLGAGEVGETLQE"
FT   CDS             5924927..5925376
FT                   /codon_start=1
FT                   /locus_tag="mCG_140467"
FT                   /product="mCG140467, isoform CRA_a"
FT                   /note="gene_id=mCG140467.0 transcript_id=mCT169668.0
FT                   protein_id=mCP92700.0 isoform=CRA_a"
FT                   /protein_id="EDL29172.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLKLCVEAVKTGQKILIE
FT                   QQESMSEKEKGLKRKRKKKGDTVLSGGQEGRNKRAEVEEEGELAFVPPPYASSAATCRW
FT                   TFCLEIWRGSTRSGVDVGERVCLCVSTGPDGTSLGAGEVGETLQE"
FT   CDS             5924927..5925376
FT                   /codon_start=1
FT                   /locus_tag="mCG_140467"
FT                   /product="mCG140467, isoform CRA_a"
FT                   /note="gene_id=mCG140467.0 transcript_id=mCT169669.0
FT                   protein_id=mCP92703.0 isoform=CRA_a"
FT                   /protein_id="EDL29173.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLKLCVEAVKTGQKILIE
FT                   QQESMSEKEKGLKRKRKKKGDTVLSGGQEGRNKRAEVEEEGELAFVPPPYASSAATCRW
FT                   TFCLEIWRGSTRSGVDVGERVCLCVSTGPDGTSLGAGEVGETLQE"
FT   CDS             5924927..5925376
FT                   /codon_start=1
FT                   /locus_tag="mCG_140467"
FT                   /product="mCG140467, isoform CRA_a"
FT                   /note="gene_id=mCG140467.0 transcript_id=mCT169670.0
FT                   protein_id=mCP92698.0 isoform=CRA_a"
FT                   /protein_id="EDL29174.1"
FT                   /translation="MLFSPIDPLWVGLIVLVLFVLIYGLCYCLKLCVEAVKTGQKILIE
FT                   QQESMSEKEKGLKRKRKKKGDTVLSGGQEGRNKRAEVEEEGELAFVPPPYASSAATCRW
FT                   TFCLEIWRGSTRSGVDVGERVCLCVSTGPDGTSLGAGEVGETLQE"
FT   assembly_gap    5925962..5930486
FT                   /estimated_length=4525
FT                   /gap_type="unknown"
FT   assembly_gap    5935738..5935757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5938956..5939039
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    5972730..5972783
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    5990461..5990483
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    5995221..5995240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6007926..6007945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6009741..6009760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6014345..6041509
FT                   /gene="Tmem47"
FT                   /locus_tag="mCG_51828"
FT                   /note="gene_id=mCG51828.2"
FT   mRNA            join(6014345..6014801,6027895..6028035,6037986..6041509)
FT                   /gene="Tmem47"
FT                   /locus_tag="mCG_51828"
FT                   /product="transmembrane protein 47, transcript variant
FT                   mCT52011"
FT                   /note="gene_id=mCG51828.2 transcript_id=mCT52011.2 created
FT                   on 16-MAY-2002"
FT   mRNA            join(<6014345..6014801,6027895..6028035,6037986..6038189,
FT                   6038266..6039264)
FT                   /gene="Tmem47"
FT                   /locus_tag="mCG_51828"
FT                   /product="transmembrane protein 47, transcript variant
FT                   mCT192593"
FT                   /note="gene_id=mCG51828.2 transcript_id=mCT192593.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<6014447..6014801,6027895..6028035,6037986..6038164)
FT                   /codon_start=1
FT                   /gene="Tmem47"
FT                   /locus_tag="mCG_51828"
FT                   /product="transmembrane protein 47, isoform CRA_a"
FT                   /note="gene_id=mCG51828.2 transcript_id=mCT192593.0
FT                   protein_id=mCP113548.0 isoform=CRA_a"
FT                   /protein_id="EDL29169.1"
FT                   /translation="LRPKVRLLGAVSAAFLFGRSRSRLFGPSWRPRLRREGRQRRPGMA
FT                   SAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRKP
FT                   ANLDIWHCESTLGSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLF
FT                   AAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYED
FT                   YY"
FT   CDS             join(6014576..6014801,6027895..6028035,6037986..6038164)
FT                   /codon_start=1
FT                   /gene="Tmem47"
FT                   /locus_tag="mCG_51828"
FT                   /product="transmembrane protein 47, isoform CRA_b"
FT                   /note="gene_id=mCG51828.2 transcript_id=mCT52011.2
FT                   protein_id=mCP40349.2 isoform=CRA_b"
FT                   /protein_id="EDL29170.1"
FT                   /translation="MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVT
FT                   ADHQYYLSLWESCRKPANLDIWHCESTLGSDWQIATLALLLGGAAIILIAFLVGLISIC
FT                   VGSRRRFYRPVAVMLFAAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGATIFS
FT                   FGGAILYCLNPKNYEDYY"
FT   assembly_gap    6021948..6021967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6028181..6028353
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    6054826..6054845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6059231..6059250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6063216..6063235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6081617..6081636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6088379..6089193
FT                   /estimated_length=815
FT                   /gap_type="unknown"
FT   assembly_gap    6089998..6091288
FT                   /estimated_length=1291
FT                   /gap_type="unknown"
FT   assembly_gap    6093831..6093850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6095203..6151520
FT                   /estimated_length=56318
FT                   /gap_type="unknown"
FT   assembly_gap    6153921..6155897
FT                   /estimated_length=1977
FT                   /gap_type="unknown"
FT   gene            <6155942..6156514
FT                   /locus_tag="mCG_119748"
FT                   /note="gene_id=mCG119748.1"
FT   mRNA            <6155942..6156514
FT                   /locus_tag="mCG_119748"
FT                   /product="mCG119748"
FT                   /note="gene_id=mCG119748.1 transcript_id=mCT120925.1
FT                   created on 16-MAY-2002"
FT   CDS             <6155950..6156141
FT                   /codon_start=1
FT                   /locus_tag="mCG_119748"
FT                   /product="mCG119748"
FT                   /note="gene_id=mCG119748.1 transcript_id=mCT120925.1
FT                   protein_id=mCP66631.1"
FT                   /protein_id="EDL29168.1"
FT                   /translation="LSCLSLPTSTGQRQSKRRSKGCWPVLRRKLLAKATSQLRGHLSSE
FT                   QESIQSPPWWRTRRLSWW"
FT   assembly_gap    6157244..6158778
FT                   /estimated_length=1535
FT                   /gap_type="unknown"
FT   assembly_gap    6160063..6160391
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    6163415..6164524
FT                   /estimated_length=1110
FT                   /gap_type="unknown"
FT   assembly_gap    6169690..6169709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6174970..6175049
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    6177371..6185732
FT                   /estimated_length=8362
FT                   /gap_type="unknown"
FT   assembly_gap    6202926..6202945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6214873..6214941
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    6239675..6239694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6248773..6249117
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   gene            complement(6249268..6253850)
FT                   /pseudo
FT                   /locus_tag="mCG_1035482"
FT                   /note="gene_id=mCG1035482.0"
FT   mRNA            complement(join(6249268..6250175,6250489..6251211,
FT                   6251601..6251831,6252189..6253850))
FT                   /pseudo
FT                   /locus_tag="mCG_1035482"
FT                   /note="gene_id=mCG1035482.0 transcript_id=mCT153186.1
FT                   created on 14-MAY-2002"
FT   assembly_gap    6267509..6267622
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    6270057..6270076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6271429..6271448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6273740..6274352
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    6277489..6277611
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    6299530..6299619
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    6307723..6308629
FT                   /estimated_length=907
FT                   /gap_type="unknown"
FT   assembly_gap    6313627..6313662
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    6323698..6323717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6338058..6338134
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    6352764..6356338
FT                   /estimated_length=3575
FT                   /gap_type="unknown"
FT   gene            complement(6358098..6394765)
FT                   /gene="4930595M18Rik"
FT                   /locus_tag="mCG_1035442"
FT                   /note="gene_id=mCG1035442.2"
FT   mRNA            complement(join(6358098..6359625,6361250..6361321,
FT                   6364462..6364656,6394020..6394765))
FT                   /gene="4930595M18Rik"
FT                   /locus_tag="mCG_1035442"
FT                   /product="RIKEN cDNA 4930595M18"
FT                   /note="gene_id=mCG1035442.2 transcript_id=mCT153146.2
FT                   created on 10-JUN-2003"
FT   CDS             complement(join(6358133..6359625,6361250..6361321,
FT                   6364462..6364656,6394020..6394644))
FT                   /codon_start=1
FT                   /gene="4930595M18Rik"
FT                   /locus_tag="mCG_1035442"
FT                   /product="RIKEN cDNA 4930595M18"
FT                   /note="gene_id=mCG1035442.2 transcript_id=mCT153146.2
FT                   protein_id=mCP66750.2"
FT                   /protein_id="EDL29167.1"
FT                   /translation="MCCSHALLNVDGMTCLKVENLAHHTSSYTLKHVFEDYGPLGDVYI
FT                   PRNHLTEEHYGFAFIHFYNKCDANDALHSLNGFLLDGCKLKVQMVYNDDPHYAQPDCSS
FT                   GRQYQYKEENHDLQSECERQHFSNTRIQTRSHSRSSGDDSEFKSQSSNHLHRRSSSTRF
FT                   KTQSSVSTQQLPNRACPKSKNLPGKKKKPKPKSSYKSASKYPSGGGLLVGEKLENNQRQ
FT                   VENGQSNSMFEKPCRTKVNATHTLITRPSTRSQTRKRLRSPQNSSENSKLERKYAENKE
FT                   RQMEYPQSPSIIKRNICGANTADVLHSVDSESGQLNSLQQSEKRTKMGIEECGFWTANC
FT                   QGNSSNDITGRMRFTCNKGNTIPQNGLSGLSCHHSNRKIHKQLDYQELESMHVTPFTQE
FT                   GNITEVLMEDTCSKETSTRQKTPDILTLKETIESRLHPDTKDVALGGPHYCLSLETFED
FT                   LRKDKAYIFSNSHTFLPLRDNLAISELQKLYFFPSFPTIEHILTESTAHRSQSTSVTPT
FT                   KFTTVEIDQKEHTKTSSCSNQTDIQISDVISDDETLNTNLECTIPSAPCETSGNIMLGV
FT                   FEVDDNFTEFDLQSCDSLSSQNNRRVHSGHSRISRSVSSLNSNSTTSSSTNHSLLSLLN
FT                   YSQQFLPVSSTSDNIIGNDINLPHTSQINQESNEFIVFNCPPFEARQQMHVTSPETSND
FT                   SDYWPVLPDFSNFNDIHNNHPKGLTEEQINNLPVIYFCENDEISHCSICLTQYIKNSKI
FT                   RVLPCFHEYHDKCIDRWLSDNSTCPICRKHIINSDDTEFLF"
FT   assembly_gap    6361153..6361249
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    6371200..6371219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6372915..6373191
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    6376928..6379838
FT                   /estimated_length=2911
FT                   /gap_type="unknown"
FT   assembly_gap    6381848..6381970
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    6385602..6385781
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    6403025..6403093
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    6409480..6409847
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    6413506..6413525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6439707..6439777
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    6444538..6444557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6459007..6459597
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    6461091..6461398
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    6462490..6462728
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    6466161..6466180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6478272..6478291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6484028..6484047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6489711..6489730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6491277..6491307
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    6496429..6496448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6500914..6504548
FT                   /estimated_length=3635
FT                   /gap_type="unknown"
FT   assembly_gap    6513667..6513747
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    6526813..6526947
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    6561214..6561233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6563312..6564427
FT                   /estimated_length=1116
FT                   /gap_type="unknown"
FT   assembly_gap    6573500..6573677
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    6579374..6580246
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   assembly_gap    6601673..6601692
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6604782..6613205
FT                   /estimated_length=8424
FT                   /gap_type="unknown"
FT   assembly_gap    6644017..6644037
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    6661659..6661678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6663454..6663473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6669683..6670111
FT                   /estimated_length=429
FT                   /gap_type="unknown"
FT   assembly_gap    6684304..6684323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6720643..6720662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6723767..6723786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6726367..6726646
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    6727958..6727977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6733500..6733576
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    6735601..6735795
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    6741739..6741758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6743738..6746275)
FT                   /locus_tag="mCG_130717"
FT                   /note="gene_id=mCG130717.1"
FT   mRNA            complement(join(6743738..6744255,6745058..6746275))
FT                   /locus_tag="mCG_130717"
FT                   /product="mCG130717, transcript variant mCT169403"
FT                   /note="gene_id=mCG130717.1 transcript_id=mCT169403.0
FT                   created on 14-MAY-2002"
FT   mRNA            complement(6743738..6746275)
FT                   /locus_tag="mCG_130717"
FT                   /product="mCG130717, transcript variant mCT132042"
FT                   /note="gene_id=mCG130717.1 transcript_id=mCT132042.1
FT                   created on 14-MAY-2002"
FT   CDS             complement(6745540..6746085)
FT                   /codon_start=1
FT                   /locus_tag="mCG_130717"
FT                   /product="mCG130717, isoform CRA_a"
FT                   /note="gene_id=mCG130717.1 transcript_id=mCT132042.1
FT                   protein_id=mCP66682.1 isoform=CRA_a"
FT                   /protein_id="EDL29165.1"
FT                   /translation="MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGD
FT                   QAQRRVMKGVDDLDFFIGDETIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAE
FT                   PEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTVKTSRRADA
FT                   DGYSNRQWRRSHSCHSCG"
FT   CDS             complement(6745540..6746085)
FT                   /codon_start=1
FT                   /locus_tag="mCG_130717"
FT                   /product="mCG130717, isoform CRA_a"
FT                   /note="gene_id=mCG130717.1 transcript_id=mCT169403.0
FT                   protein_id=mCP92168.0 isoform=CRA_a"
FT                   /protein_id="EDL29166.1"
FT                   /translation="MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGD
FT                   QAQRRVMKGVDDLDFFIGDETIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAE
FT                   PEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTVKTSRRADA
FT                   DGYSNRQWRRSHSCHSCG"
FT   assembly_gap    6753581..6753626
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    6763280..6767390
FT                   /estimated_length=4111
FT                   /gap_type="unknown"
FT   assembly_gap    6788491..6788510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6798789..6799065
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    6800726..6800745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6808413..6808505
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    6809145..6809649
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    6811204..6811223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6812205..6812319
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    6822772..6822811
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    6853439..6854103
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    6856405..6856424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6863693..6863794
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    6887057..6887076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6891742..6891828
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    6906182..6914242
FT                   /estimated_length=8061
FT                   /gap_type="unknown"
FT   assembly_gap    6922322..6924056
FT                   /estimated_length=1735
FT                   /gap_type="unknown"
FT   assembly_gap    6953225..6953244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6956361..6965200
FT                   /estimated_length=8840
FT                   /gap_type="unknown"
FT   assembly_gap    6968627..6968877
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    6979119..6979138
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7007431..7012188
FT                   /estimated_length=4758
FT                   /gap_type="unknown"
FT   assembly_gap    7022786..7022805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7033443..7033692
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    7036908..7037193
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    7050609..7050628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7054248..7054267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7057946..7058025
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    7097931..7097975
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    7101252..7101271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7117331..7117464
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    7125155..7130141
FT                   /estimated_length=4987
FT                   /gap_type="unknown"
FT   assembly_gap    7135630..7137993
FT                   /estimated_length=2364
FT                   /gap_type="unknown"
FT   assembly_gap    7138711..7138730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7143192..7143474
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    7145639..7146195
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    7149127..7149246
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    7154991..7155135
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    7158040..7159295
FT                   /estimated_length=1256
FT                   /gap_type="unknown"
FT   assembly_gap    7162581..7162600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7165074..7165093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7167766..7167785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7180546..7185460
FT                   /estimated_length=4915
FT                   /gap_type="unknown"
FT   assembly_gap    7208320..7209040
FT                   /estimated_length=721
FT                   /gap_type="unknown"
FT   assembly_gap    7210229..7211276
FT                   /estimated_length=1048
FT                   /gap_type="unknown"
FT   gene            complement(7224951..7225541)
FT                   /pseudo
FT                   /locus_tag="mCG_1035440"
FT                   /note="gene_id=mCG1035440.0"
FT   mRNA            complement(7224951..7225541)
FT                   /pseudo
FT                   /locus_tag="mCG_1035440"
FT                   /note="gene_id=mCG1035440.0 transcript_id=mCT153144.1
FT                   created on 14-MAY-2002"
FT   assembly_gap    7238027..7238120
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    7285090..7285122
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    7288033..7288052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7291266..7292884
FT                   /estimated_length=1619
FT                   /gap_type="unknown"
FT   assembly_gap    7296349..7296368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7300154..7300173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7304316..7308513
FT                   /estimated_length=4198
FT                   /gap_type="unknown"
FT   gene            complement(7315608..7315936)
FT                   /pseudo
FT                   /locus_tag="mCG_140470"
FT                   /note="gene_id=mCG140470.0"
FT   mRNA            complement(7315608..7315936)
FT                   /pseudo
FT                   /locus_tag="mCG_140470"
FT                   /note="gene_id=mCG140470.0 transcript_id=mCT169674.0
FT                   created on 14-MAY-2002"
FT   assembly_gap    7331536..7331600
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    7338831..7339201
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    7341997..7342736
FT                   /estimated_length=740
FT                   /gap_type="unknown"
FT   assembly_gap    7345449..7359809
FT                   /estimated_length=14361
FT                   /gap_type="unknown"
FT   assembly_gap    7361481..7361500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7364351..7365871
FT                   /estimated_length=1521
FT                   /gap_type="unknown"
FT   assembly_gap    7369033..7371181
FT                   /estimated_length=2149
FT                   /gap_type="unknown"
FT   assembly_gap    7374344..7374363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7384255..7384375
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    7387505..7387649
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    7388220..7388934
FT                   /estimated_length=715
FT                   /gap_type="unknown"
FT   assembly_gap    7390252..7396216
FT                   /estimated_length=5965
FT                   /gap_type="unknown"
FT   assembly_gap    7401299..7401318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7410311..7410330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7442698..7442717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7447766..7448834
FT                   /estimated_length=1069
FT                   /gap_type="unknown"
FT   assembly_gap    7451272..7451981
FT                   /estimated_length=710
FT                   /gap_type="unknown"
FT   assembly_gap    7468080..7468464
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    7473924..7473943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7478629..7479458
FT                   /locus_tag="mCG_1035439"
FT                   /note="gene_id=mCG1035439.1"
FT   mRNA            <7478629..7479458
FT                   /locus_tag="mCG_1035439"
FT                   /product="mCG1035439"
FT                   /note="gene_id=mCG1035439.1 transcript_id=mCT153143.1
FT                   created on 16-MAY-2002"
FT   CDS             <7478849..7479055
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035439"
FT                   /product="mCG1035439"
FT                   /note="gene_id=mCG1035439.1 transcript_id=mCT153143.1
FT                   protein_id=mCP66742.1"
FT                   /protein_id="EDL29164.1"
FT                   /translation="NEDNLKFLKFACKTLQSLIYEGGHSYELLLYTTQYTILHEGNSSS
FT                   AEVNKNQVLIYCSSFYLAGERKK"
FT   assembly_gap    7480898..7480917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7517184..7520647
FT                   /estimated_length=3464
FT                   /gap_type="unknown"
FT   assembly_gap    7521386..7523203
FT                   /estimated_length=1818
FT                   /gap_type="unknown"
FT   assembly_gap    7525900..7526084
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    7530252..7530271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7535195..7535214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7542015..7542034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7562306..>7562970
FT                   /locus_tag="mCG_1035466"
FT                   /note="gene_id=mCG1035466.0"
FT   mRNA            join(<7562306..7562579,7562600..>7562970)
FT                   /locus_tag="mCG_1035466"
FT                   /product="mCG1035466"
FT                   /note="gene_id=mCG1035466.0 transcript_id=mCT153170.1
FT                   created on 17-MAY-2002"
FT   assembly_gap    7562580..7562599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <7562719..7562970
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035466"
FT                   /product="mCG1035466"
FT                   /note="gene_id=mCG1035466.0 transcript_id=mCT153170.1
FT                   protein_id=mCP66582.0"
FT                   /protein_id="EDL29163.1"
FT                   /translation="RHGKVQLKRLEKIILKIYIELEITQAPNRQSAKPQKSQASNRVLS
FT                   RILHHYEVKSAIDKRLLWSYKSMIDITSTGIKTEIIYL"
FT   assembly_gap    7565518..7569246
FT                   /estimated_length=3729
FT                   /gap_type="unknown"
FT   assembly_gap    7571217..7578864
FT                   /estimated_length=7648
FT                   /gap_type="unknown"
FT   assembly_gap    7583059..7583084
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    7590269..7590288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7602891..7603876)
FT                   /pseudo
FT                   /locus_tag="mCG_48943"
FT                   /note="gene_id=mCG48943.2"
FT   mRNA            complement(7602891..7603876)
FT                   /pseudo
FT                   /locus_tag="mCG_48943"
FT                   /note="gene_id=mCG48943.2 transcript_id=mCT49126.2 created
FT                   on 14-MAY-2002"
FT   assembly_gap    7613070..7613089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7661942..7662292
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    7675727..7675781
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    7681382..7681477
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    7683427..7683446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7696953..7696972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7706790..7707266
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   assembly_gap    7743736..7743755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7749110..7749372
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    7755207..7755302
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    7765436..7765598
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    7769166..7769250
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    7782509..7782528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7787941..7788920
FT                   /estimated_length=980
FT                   /gap_type="unknown"
FT   assembly_gap    7793821..7793840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7800654..7800673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7803153..7803363
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    7805140..7806257
FT                   /estimated_length=1118
FT                   /gap_type="unknown"
FT   assembly_gap    7807757..7807979
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    7810735..7810854
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    7825913..7825932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7840308..7840327
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7847552..7847571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7852080..7855990
FT                   /estimated_length=3911
FT                   /gap_type="unknown"
FT   gene            7864003..10085801
FT                   /gene="Dmd"
FT                   /locus_tag="mCG_141812"
FT                   /note="gene_id=mCG141812.0"
FT   mRNA            join(7864003..7864248,8049675..8049736,8259613..8259696,
FT                   8264317..8264394,8288372..8288464,8294499..8294671,
FT                   8400147..8400265,8517390..8517574,8518695..8518826,
FT                   8554183..8554371,8555183..8555364,8568400..8568550,
FT                   8581846..8581965,8603871..8603972,8604068..8604175,
FT                   8611677..8611856,8619094..8619269,8645127..8645250,
FT                   8662286..8662373,8671302..8671543,8675842..8676022,
FT                   8692089..8692234,8693148..8693360,8695968..8696081,
FT                   8697178..8697333,8703312..8703482,8707969..8708151,
FT                   8717795..8717929,8720260..8720409,8745557..8745718,
FT                   8767946..8768056,8768375..8768548,8771179..8771334,
FT                   8776986..8777156,8795223..8795402,8796264..8796392,
FT                   8798656..8798826,8812745..8812867,8815130..8815267,
FT                   8818123..8818275,8819081..8819263,8845397..8845549,
FT                   8855187..8855359,8912570..8912717,9157413..9157588,
FT                   9194792..9194933,9197472..9197621,9258271..9258435,
FT                   9311131..9311232,9317585..9317693,9359502..9359734,
FT                   9417525..9417642,9454781..9454992,9478295..9478449,
FT                   9526452..9526641,9652827..9652999,9661165..9661321,
FT                   9697692..9697960,9728417..9728563,9823803..9823881,
FT                   9854340..9854400,9934871..9934932,9970305..9970379,
FT                   9985636..9985837,9988081..9988166,9990466..9990622,
FT                   10020049..10020215,10022282..10022393,10024644..10024780,
FT                   10025526..10025564,10029722..10029787,10030805..10030870,
FT                   10033620..10033778,10058358..10058601,10059353..10059476,
FT                   10071370..10071462,10078264..10078295,10083231..10085801)
FT                   /gene="Dmd"
FT                   /locus_tag="mCG_141812"
FT                   /product="dystrophin, muscular dystrophy"
FT                   /note="gene_id=mCG141812.0 transcript_id=mCT176782.0
FT                   created on 04-DEC-2002"
FT   CDS             join(7864218..7864248,8049675..8049736,8259613..8259696,
FT                   8264317..8264394,8288372..8288464,8294499..8294671,
FT                   8400147..8400265,8517390..8517574,8518695..8518826,
FT                   8554183..8554371,8555183..8555364,8568400..8568550,
FT                   8581846..8581965,8603871..8603972,8604068..8604175,
FT                   8611677..8611856,8619094..8619269,8645127..8645250,
FT                   8662286..8662373,8671302..8671543,8675842..8676022,
FT                   8692089..8692234,8693148..8693360,8695968..8696081,
FT                   8697178..8697333,8703312..8703482,8707969..8708151,
FT                   8717795..8717929,8720260..8720409,8745557..8745718,
FT                   8767946..8768056,8768375..8768548,8771179..8771334,
FT                   8776986..8777156,8795223..8795402,8796264..8796392,
FT                   8798656..8798826,8812745..8812867,8815130..8815267,
FT                   8818123..8818275,8819081..8819263,8845397..8845549,
FT                   8855187..8855359,8912570..8912717,9157413..9157588,
FT                   9194792..9194933,9197472..9197621,9258271..9258435,
FT                   9311131..9311232,9317585..9317693,9359502..9359734,
FT                   9417525..9417642,9454781..9454992,9478295..9478449,
FT                   9526452..9526641,9652827..9652999,9661165..9661321,
FT                   9697692..9697778)
FT                   /codon_start=1
FT                   /gene="Dmd"
FT                   /locus_tag="mCG_141812"
FT                   /product="dystrophin, muscular dystrophy"
FT                   /note="gene_id=mCG141812.0 transcript_id=mCT176782.0
FT                   protein_id=mCP99704.0"
FT                   /protein_id="EDL29159.1"
FT                   /translation="MLWWEEVEDCYEREDVQKKTFTKWINAQFSKFGKQHIDNLFSDLQ
FT                   DGKRLLDLLEGLTGPKEKGSTRVHALNNVNKALRVLQKNNVDLVNIGSTDIVDGNHKLT
FT                   LGLIWNIILHWQVKNVMKTIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTSSWSDG
FT                   LALNALIHSHRPDLFDWNSVVSQHSATQRLEHAFNIAKCQLGIEKLLDPEDVATTYPDK
FT                   KSILMYITSLFQVLPQQVSIEAIQEVEMLPRTSSKVTREEHFQLHHQMHYSQQITVSLA
FT                   QGYEQTSSSPKPRFKSYAFTQAAYVATSDSTQSPYPSQHLEAPRDKSLDSSLMETEVNL
FT                   DSYQTALEEVLSWLLSAEDTLRAQGEISNDVEEVKEQFHAHEGFMMDLTSHQGLVGNVL
FT                   QLGSQLVGKGKLSEDEEAEVQEQMNLLNSRWECLRVASMEKQSKLHKVLMDLQNQKLKE
FT                   LDDWLTKTEERTKKMEEEPFGPDLEDLKCQVQQHKVLQEDLEQEQVRVNSLTHMVVVVD
FT                   ESSGDHATAALEEQLKVLGDRWANICRWTEDRWIVLQDILLKWQHFTEEQCLFSTWLSE
FT                   KEDAMKNIQTSGFKDQNEMMSSLHKISTLKIDLEKKKPTMEKLSSLNQDLLSALKNKSV
FT                   TQKMEIWMENFAQRWDNLTQKLEKSSAQISQAVTTTQPSLTQTTVMETVTMVTTREQIM
FT                   VKHAQEELPPPPPQKKRQITVDSELRKRLDVDITELHSWITRSEAVLQSSEFAVYRKEG
FT                   NISDLQEKVNAIAREKAEKFRKLQDASRSAQALVEQMANEGVNAESIRQASEQLNSRWT
FT                   EFCQLLSERVNWLEYQTNIITFYNQLQQLEQMTTTAENLLKTQSTTLSEPTAIKSQLKI
FT                   CKDEVNRLSALQPQIEQLKIQSLQLKEKGQGPMFLDADFVAFTNHFNHIFDGVRAKEKE
FT                   LQTIFDTLPPMRYQETMSSIRTWIQQSESKLSVPYLSVTEYEIMEERLGKLQALQSSLK
FT                   EQQNGFNYLSDTVKEMAKKAPSEICQKYLSEFEEIEGHWKKLSSQLVESCQKLEEHMNK
FT                   LRKFQNHIKTLQKWMAEVDVFLKEEWPALGDAEILKKQLKQCRLLVGDIQTIQPSLNSV
FT                   NEGGQKIKSEAELEFASRLETELRELNTQWDHICRQVYTRKEALKAGLDKTVSLQKDLS
FT                   EMHEWMTQAEEEYLERDFEYKTPDELQTAVEEMKRAKEEALQKETKVKLLTETVNSVIA
FT                   HAPPSAQEALKKELETLTTNYQWLCTRLNGKCKTLEEVWACWHELLSYLEKANKWLNEV
FT                   ELKLKTMENVPAGPEEITEVLESLENLMHHSEENPNQIRLLAQTLTDGGVMDELINEEL
FT                   ETFNSRWRELHEEAVRKQKLLEQSIQSAQEIEKSLHLIQESLEFIDKQLAAYITDKVDA
FT                   AQMPQEAQKIQSDLTSHEISLEEMKKHNQGKDANQRVLSQIDVAQKKLQDVSMKFRLFQ
FT                   KPANFEQRLEESKMILDEVKMHLPALETKSVEQEVIQSQLSHCVNLYKSLSEVKSEVEM
FT                   VIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEM
FT                   NVLTEWLAATDTELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKAHLKSVTELGESLK
FT                   MVLGKKETLVEDKLSLLNSNWIAVTSRVEEWLNLLLEYQKHMETFDQNIEQITKWIIHA
FT                   DELLDESEKKKPQQKEDILKRLKAEMNDMRPKVDSTRDQAAKLMANRGDHCRKVVEPQI
FT                   SELNRRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKEEDFNKDM
FT                   SEDNEGTVNELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDLRSQRRKKALEI
FT                   SHQWYQYKRQADDLLKCLDEIEKKLASLPEPRDERKLKEIDRELQKKKEELNAVRRQAE
FT                   GLSENGAAMAVEPTQIQLSKRWRQIESNFAQFRRLNFAQIHTLHEETMVVTTEDMPLDV
FT                   SYVPSTYLTEISHILQALSEVDHLLNTPELCANIKDNLQQISGRIDIIHKKKTAALQSA
FT                   TSMEKVKVQEAVAQMDFQGEKLHRMYKERQGRFDRSVEKWRHFHYDMKVFNQWLNEVEQ
FT                   FFKKTQNPENWEHAKYKWYLKELQDGIGQRQAVVRTLNATGEEIIQQSSKTDVNILQEK
FT                   LGSLSLRWHDICKELAERRKRIEEQKNVLSEFQRDLNEFVLWLEEADNIAITPLGDEQQ
FT                   LKEQLEQVKLLAEELPLRQGILKQLNETGGAVLVSAPIRPEEQDKLEKKLKQTNLQWIK
FT                   VSRALPEKQGELEVHLKDFRQLEEQLDHLLLWLSPIRNQLEIYNQPSQAGPFDIKEIEV
FT                   TVHGKQADVERLLSKGQHLYKEKPSTQPVKRKLEDLRSEWEAVNHLLRELRTKQPDRAP
FT                   GLSTTGASASQTVTLVTQSVVTKETVISKLEMPSSLLLEVPALADFNRAWTELTDWLSL
FT                   LDRVIKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQLEELITAAQNLKNKTSNQEAR
FT                   TIITDRIERIQIQWDEVQEQLQNRRQQLNEMLKDSTQWLEAKEEAEQVIGQVRGKLDSW
FT                   KEGPHTVDAIQKKITETKQLAKDLRQRQISVDVANDLALKLLRDYSADDTRKVHMITEN
FT                   INTSWGNIHKRVSEQEAALEETHRLLQQFPLDLEKFLSWITEAETTANVLQDASRKEKL
FT                   LEDSRGVRELMKPWQDLQGEIETHTDIYHNLDENGQKILRSLEGSDEAPLLQRRLDNMN
FT                   FKWSELQKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQAPIGGDFPAVQ
FT                   KQNDIHRNCLLKKELRMSLGSYESRLKRSTLNGTN"
FT   assembly_gap    7875591..7875672
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    7881976..7882022
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    7885856..7891508
FT                   /estimated_length=5653
FT                   /gap_type="unknown"
FT   assembly_gap    7894586..7894605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7899359..7900102
FT                   /estimated_length=744
FT                   /gap_type="unknown"
FT   assembly_gap    7901700..7901794
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    7908702..7908988
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    7911080..7912397
FT                   /estimated_length=1318
FT                   /gap_type="unknown"
FT   assembly_gap    7913160..7913860
FT                   /estimated_length=701
FT                   /gap_type="unknown"
FT   assembly_gap    7920096..7920258
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    7924510..7924529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7950305..7951047
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    7952632..7952779
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    8000891..8001437
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    8006026..8006133
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    8012595..8012614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8024719..8024738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8052651..8052670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8055497..8056280
FT                   /estimated_length=784
FT                   /gap_type="unknown"
FT   assembly_gap    8061908..8061977
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    8062738..8063051
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    8099232..8099251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8119209..8119228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8135637..8136707
FT                   /estimated_length=1071
FT                   /gap_type="unknown"
FT   assembly_gap    8139425..8139638
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    8152403..8152915
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    8178561..8178735
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    8181382..8181501
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    8183797..8183896
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    8203511..8203530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8204586..8205235
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    8223917..8224116
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    8244440..8245707
FT                   /estimated_length=1268
FT                   /gap_type="unknown"
FT   assembly_gap    8249940..8250038
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    8252394..8252688
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    8254561..8254792
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    8256150..8257221
FT                   /estimated_length=1072
FT                   /gap_type="unknown"
FT   assembly_gap    8259698..8259821
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    8268451..8268691
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    8280371..8280495
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    8286422..8286441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8306370..8306389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8308091..8309142
FT                   /estimated_length=1052
FT                   /gap_type="unknown"
FT   assembly_gap    8311338..8311782
FT                   /estimated_length=445
FT                   /gap_type="unknown"
FT   assembly_gap    8317652..8317671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8329723..8329742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8335065..8335084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8337237..8337256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8347876..8348135
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    8355314..8356400
FT                   /estimated_length=1087
FT                   /gap_type="unknown"
FT   assembly_gap    8358948..8358967
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8368856..8368948
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    8371803..8371921
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    8388445..8388464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8397045..8397064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8397065..8398245)
FT                   /gene="Tsga8"
FT                   /locus_tag="mCG_12163"
FT                   /note="gene_id=mCG12163.1"
FT   mRNA            complement(join(8397065..8397713,8397891..8398245))
FT                   /gene="Tsga8"
FT                   /locus_tag="mCG_12163"
FT                   /product="testis specific gene A8"
FT                   /note="gene_id=mCG12163.1 transcript_id=mCT15689.2 created
FT                   on 14-MAY-2002"
FT   CDS             complement(join(8397075..8397713,8397891..8397998))
FT                   /codon_start=1
FT                   /gene="Tsga8"
FT                   /locus_tag="mCG_12163"
FT                   /product="testis specific gene A8"
FT                   /note="gene_id=mCG12163.1 transcript_id=mCT15689.2
FT                   protein_id=mCP13081.2"
FT                   /protein_id="EDL29162.1"
FT                   /translation="MDVPTSSTDSQEVKPIMPIRTKAACKFYPPHILCGKGAKTNKRGK
FT                   RGGAQKASTKKDIGETTPPVAKKSKVAKEPTMLAAAAAPEAAASPESSAAAAAPEAAAS
FT                   PESSAAAAAPEAAASPESSAAAAAPEAAASPESSAAAAAPEAAASPESSAAAAAPEAAA
FT                   SLESSAAAAAPEAAASLESSAAAAAPEAAAAPEAAAAPEVAAAPATPAAPEAAAAPEVA
FT                   AAPATPAAPEATAAPAALRQQLHLLH"
FT   assembly_gap    8404390..8404409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8419502..8419606
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    8428730..8428749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8430699..8431539
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    8438349..8438451
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    8440655..8441648
FT                   /estimated_length=994
FT                   /gap_type="unknown"
FT   assembly_gap    8443715..8446504
FT                   /estimated_length=2790
FT                   /gap_type="unknown"
FT   assembly_gap    8456031..8456070
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    8465107..8465750
FT                   /estimated_length=644
FT                   /gap_type="unknown"
FT   assembly_gap    8483544..8483563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8486388..8487910
FT                   /estimated_length=1523
FT                   /gap_type="unknown"
FT   assembly_gap    8490161..8490207
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    8497942..8498104
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    8504025..8504044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8505509..8505528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8514578..8514744
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    8519744..8520452
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    8522738..8522891
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    8525165..8525428
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    8532735..8532754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8555745..8555825
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    8569809..8569828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8597185..8598099
FT                   /estimated_length=915
FT                   /gap_type="unknown"
FT   assembly_gap    8604552..8604571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8613458..8614984
FT                   /estimated_length=1527
FT                   /gap_type="unknown"
FT   assembly_gap    8620585..8620674
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    8632855..8632975
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    8641599..8641618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8653275..8653294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8668526..8668589
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    8673132..8673151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8680556..8681065
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   assembly_gap    8684234..8684515
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    8701580..8701599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8715840..8715914
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    8737480..8738380
FT                   /estimated_length=901
FT                   /gap_type="unknown"
FT   assembly_gap    8747715..8747734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8752145..8752437
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    8772665..8772684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8778284..8784858
FT                   /estimated_length=6575
FT                   /gap_type="unknown"
FT   assembly_gap    8802715..8802734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8823236..8939702)
FT                   /locus_tag="mCG_147985"
FT                   /note="gene_id=mCG147985.0"
FT   mRNA            complement(join(8823236..8824712,8883505..8883533,
FT                   8891147..8891185,8939652..8939702))
FT                   /locus_tag="mCG_147985"
FT                   /product="mCG147985"
FT                   /note="gene_id=mCG147985.0 transcript_id=mCT188248.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(8823681..8823860)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147985"
FT                   /product="mCG147985"
FT                   /note="gene_id=mCG147985.0 transcript_id=mCT188248.0
FT                   protein_id=mCP109536.0"
FT                   /protein_id="EDL29161.1"
FT                   /translation="MRDPMALTRIINSWHNSWIYFLGQGIKRGCSCLCSKHIRLSYLLS
FT                   FLKLHFKEFLQNKI"
FT   assembly_gap    8824715..8825288
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    8826820..8827205
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   assembly_gap    8833841..8833961
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    8835821..8835920
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    8837199..8837273
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    8840832..8841003
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    8845552..8845993
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    8851362..8852685
FT                   /estimated_length=1324
FT                   /gap_type="unknown"
FT   assembly_gap    8878973..8878992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8893729..8893808
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    8907744..8908190
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    8909245..8909447
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    8925917..8925986
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    8947021..8947055
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    8953416..8953464
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   gene            <8953562..8955162
FT                   /locus_tag="mCG_1035401"
FT                   /note="gene_id=mCG1035401.1"
FT   mRNA            <8953562..8955162
FT                   /locus_tag="mCG_1035401"
FT                   /product="mCG1035401"
FT                   /note="gene_id=mCG1035401.1 transcript_id=mCT153105.1
FT                   created on 17-MAY-2002"
FT   CDS             <8953564..8953998
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035401"
FT                   /product="mCG1035401"
FT                   /note="gene_id=mCG1035401.1 transcript_id=mCT153105.1
FT                   protein_id=mCP66603.1"
FT                   /protein_id="EDL29160.1"
FT                   /translation="VRYSSSSSSSSDSSSSSSDSEDEDKKQTKRRKKKKSLCYKSPETS
FT                   GSDSDSNSKDDLKKKKKSKDVTEREKDTKGLSKKRKMYEHKPLSSESLSESDCGEVQAK
FT                   RRKSGEERERTTDKAKKGRKHKKHSKKKKKKAASSSSDSP"
FT   assembly_gap    8961545..8961564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8966077..8967652
FT                   /estimated_length=1576
FT                   /gap_type="unknown"
FT   assembly_gap    8980293..8980312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8985967..8985986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9001761..9001780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9018175..9018532
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    9021263..9023216
FT                   /estimated_length=1954
FT                   /gap_type="unknown"
FT   assembly_gap    9031671..9031690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9039883..9046438
FT                   /estimated_length=6556
FT                   /gap_type="unknown"
FT   assembly_gap    9050505..9050599
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    9056047..9056737
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    9091679..9091702
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    9105943..9105962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9127371..9127390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9128401..9128897
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    9136577..9136925
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    9138582..9138756
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    9142840..9142981
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    9147293..9147312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9174485..9174571
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    9175188..9181689
FT                   /estimated_length=6502
FT                   /gap_type="unknown"
FT   assembly_gap    9189403..9189422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9210382..9210915)
FT                   /pseudo
FT                   /locus_tag="mCG_1035462"
FT                   /note="gene_id=mCG1035462.1"
FT   mRNA            complement(9210382..9210915)
FT                   /pseudo
FT                   /locus_tag="mCG_1035462"
FT                   /note="gene_id=mCG1035462.1 transcript_id=mCT153166.1
FT                   created on 14-MAY-2002"
FT   assembly_gap    9217539..9217558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9230778..9230944
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    9240710..9240729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9244522..9244541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9258156..9258175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9261722..9261741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9265711..9266205
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    9277230..9280576
FT                   /estimated_length=3347
FT                   /gap_type="unknown"
FT   assembly_gap    9282732..9283362
FT                   /estimated_length=631
FT                   /gap_type="unknown"
FT   assembly_gap    9286386..9286408
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    9288980..9289356
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    9290328..9292006
FT                   /estimated_length=1679
FT                   /gap_type="unknown"
FT   assembly_gap    9297494..9297513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9300254..9300816
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    9312971..9313275
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    9315658..9315967
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    9323490..9323650
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    9331946..9332027
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    9338349..9338368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9341414..9341433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9348366..9348411
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    9353314..9353377
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    9378982..9379167
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    9392615..9392678
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    9395584..9397923
FT                   /estimated_length=2340
FT                   /gap_type="unknown"
FT   assembly_gap    9402679..9402698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9411120..9411139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9424767..9424786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9426172..9426864
FT                   /estimated_length=693
FT                   /gap_type="unknown"
FT   assembly_gap    9443962..9444242
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    9446894..9447453
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    9456016..9456487
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    9460930..9460949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9488707..9493560
FT                   /estimated_length=4854
FT                   /gap_type="unknown"
FT   assembly_gap    9498208..9498227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9502833..9502868
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    9538233..9538252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9539338..9539386
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    9541020..9541039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9562247..9562266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9564603..9564622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9569353..9569372
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9580537..9580556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9583317..9583433
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    9596374..9596393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9612057..9612374
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    9645053..9645156
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    9650521..9650579
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    9662026..9662121
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    9663732..9663751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9679294..9679557
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    9681067..9681626
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    9685925..9685983
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    9687817..9693760
FT                   /estimated_length=5944
FT                   /gap_type="unknown"
FT   assembly_gap    9696689..9697056
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    9698401..9698420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9708580..9708599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9712508..9712640
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    9730593..9732283
FT                   /estimated_length=1691
FT                   /gap_type="unknown"
FT   assembly_gap    9735206..9735625
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    9754031..9754315
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    9763114..9763253
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    9768460..9768479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9774820..9774839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9776138..9776442
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    9780237..9780256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9781745..9782042
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    9798112..9798131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9808103..9808173
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    9813757..9813904
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    9828541..9828621
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    9835349..9835468
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    9843828..9843847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9847547..9847566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9850451..9850470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9869096..9870198
FT                   /estimated_length=1103
FT                   /gap_type="unknown"
FT   assembly_gap    9907719..9907749
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    9910325..9912545
FT                   /estimated_length=2221
FT                   /gap_type="unknown"
FT   assembly_gap    9930479..9930498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9939196..9939290
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    9941716..9942023
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    9947255..9949109
FT                   /estimated_length=1855
FT                   /gap_type="unknown"
FT   assembly_gap    9950142..9950935
FT                   /estimated_length=794
FT                   /gap_type="unknown"
FT   assembly_gap    9955946..9956304
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    9988982..9989001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9990623..9991457
FT                   /estimated_length=835
FT                   /gap_type="unknown"
FT   assembly_gap    9993341..9993360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10014484..10014726
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    10020413..10020432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10022543..10022650
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    10023751..10024115
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    10029308..10029431
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    10042030..10042049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10052830..10052849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10055030..10055160
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    10060937..10061018
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    10081516..10081543
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    10121083..10121226
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    10141030..10141049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10143492..10143546
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    10145668..10145687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10149814..10150551
FT                   /locus_tag="mCG_1035422"
FT                   /note="gene_id=mCG1035422.1"
FT   mRNA            10149814..10150551
FT                   /locus_tag="mCG_1035422"
FT                   /product="mCG1035422"
FT                   /note="gene_id=mCG1035422.1 transcript_id=mCT153126.1
FT                   created on 17-MAY-2002"
FT   CDS             10149873..10150421
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035422"
FT                   /product="mCG1035422"
FT                   /note="gene_id=mCG1035422.1 transcript_id=mCT153126.1
FT                   protein_id=mCP66740.0"
FT                   /db_xref="GOA:Q9DAX0"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="MGI:MGI:1919246"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAX0"
FT                   /protein_id="EDL29158.1"
FT                   /translation="MAASVPQLEQTYLSESNAALNSQIQLQLYGSYIYLSMASFCNKEE
FT                   VALGSFALFFLRQSQKWMERTEMLFSLLTERQGSLTLGRIANQDRQDWLDGLMAMECAF
FT                   HLEKTLNQSLLQLYGLANSKGDLYLCNFLKCHFLPQQVEILKEMGGYMTNLRRLGAPEN
FT                   QDAEKLFDQLTMADSIKKN"
FT   assembly_gap    10151186..10151426
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    10153610..10155461
FT                   /estimated_length=1852
FT                   /gap_type="unknown"
FT   assembly_gap    10165488..10165507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10171983..10172059
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    10182171..10182200
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    10186937..10187393
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    10189161..10189180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10218119..10218206
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    10231135..10231791
FT                   /estimated_length=657
FT                   /gap_type="unknown"
FT   assembly_gap    10233771..10234860
FT                   /estimated_length=1090
FT                   /gap_type="unknown"
FT   assembly_gap    10245329..10245348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10248120..10248890
FT                   /estimated_length=771
FT                   /gap_type="unknown"
FT   assembly_gap    10251008..10252027
FT                   /estimated_length=1020
FT                   /gap_type="unknown"
FT   assembly_gap    10253640..10253659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10264077..10264096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10286931..10286950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10288890..10288909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10295589..10295733
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    10309864..10310179
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   gene            10312350..10312685
FT                   /pseudo
FT                   /locus_tag="mCG_1035437"
FT                   /note="gene_id=mCG1035437.1"
FT   mRNA            10312350..10312685
FT                   /pseudo
FT                   /locus_tag="mCG_1035437"
FT                   /note="gene_id=mCG1035437.1 transcript_id=mCT153141.1
FT                   created on 17-MAY-2002"
FT   assembly_gap    10335665..10335974
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    10342240..10342259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10351403..10352484
FT                   /estimated_length=1082
FT                   /gap_type="unknown"
FT   assembly_gap    10360662..10360862
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    10361716..10362418
FT                   /estimated_length=703
FT                   /gap_type="unknown"
FT   assembly_gap    10365153..10365172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10371616..10371766
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    10388917..10390994
FT                   /estimated_length=2078
FT                   /gap_type="unknown"
FT   assembly_gap    10398771..10398790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10403456..10403475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10410068..10410139
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    10412155..10412178
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    10413975..10413994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10445810..10445829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10455483..10515818
FT                   /gene="Map3k7ip3"
FT                   /locus_tag="mCG_113458"
FT                   /note="gene_id=mCG113458.0"
FT   mRNA            join(10455483..10455499,10456884..10456944,
FT                   10474971..10475073,10490744..10490938,10495326..10496784,
FT                   10497729..10497889,10502910..10503003,10509525..10509617,
FT                   10511762..10515798)
FT                   /gene="Map3k7ip3"
FT                   /locus_tag="mCG_113458"
FT                   /product="mitogen-activated protein kinase kinase kinase 7
FT                   interacting protein 3, transcript variant mCT114542"
FT                   /note="gene_id=mCG113458.0 transcript_id=mCT114542.1
FT                   created on 17-MAY-2002"
FT   mRNA            join(10455484..10455656,10490744..10490938,
FT                   10495326..10496784,10497729..10497889,10502910..10503003,
FT                   10509525..10509617,10514432..10515818)
FT                   /gene="Map3k7ip3"
FT                   /locus_tag="mCG_113458"
FT                   /product="mitogen-activated protein kinase kinase kinase 7
FT                   interacting protein 3, transcript variant mCT169398"
FT                   /note="gene_id=mCG113458.0 transcript_id=mCT169398.0
FT                   created on 17-MAY-2002"
FT   assembly_gap    10470310..10470331
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    10473006..10473025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10484269..10484288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(10490837..10490938,10495326..10496784,
FT                   10497729..10497889,10502910..10503003,10509525..10509617,
FT                   10514432..10514580)
FT                   /codon_start=1
FT                   /gene="Map3k7ip3"
FT                   /locus_tag="mCG_113458"
FT                   /product="mitogen-activated protein kinase kinase kinase 7
FT                   interacting protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG113458.0 transcript_id=mCT169398.0
FT                   protein_id=mCP92171.0 isoform=CRA_b"
FT                   /protein_id="EDL29157.1"
FT                   /translation="MAQNSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRA
FT                   LSQESSKYLYMEYHSPEDNRMNRNRLLHINLGIHSPSSYHPGDGAHLNGGRTLVHSSSD
FT                   GHIDPQHTAGKQLICLVQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSM
FT                   QTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSN
FT                   LYGSPGSIFIRQTSQSSSGRQTPQNAPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYS
FT                   PKQQQIPQSVYHSPPPSQCPSPFSSPQHQVQPPQLGHPSSHVFMPPSPSTTPPHLYQQG
FT                   PPSYQKPGSHSVAYLPYTASSLPKGSMKKIEITVEPSQRPGTAITRSPSPISNQPSPRN
FT                   QHSLYTATTPPSSSPSRGISSQPKPPFSVNPVYITYTQPTGPSCAPSPSPRVIPNPTTV
FT                   FKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGNHKYQRSSSSGSDDYA
FT                   YTQALLLHQRARMERLAKQLKLEKEELERLKAEVNSMEHDLMQRRLRRVSCTTAIPTPE
FT                   EMTRLRSTNRQLQINVDCTLKEVDLLQSRDSCAIERKARRISVTSKAPVDIHDAQAAAA
FT                   DECSPAQIGIHKQVAYGGYYYGSCWILMWRCPCPLGQLVYAYVRVRGLLS"
FT   CDS             join(10490837..10490938,10495326..10496784,
FT                   10497729..10497889,10502910..10503003,10509525..10509617,
FT                   10511762..10511910)
FT                   /codon_start=1
FT                   /gene="Map3k7ip3"
FT                   /locus_tag="mCG_113458"
FT                   /product="mitogen-activated protein kinase kinase kinase 7
FT                   interacting protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG113458.0 transcript_id=mCT114542.1
FT                   protein_id=mCP66594.1 isoform=CRA_a"
FT                   /protein_id="EDL29156.1"
FT                   /translation="MAQNSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRA
FT                   LSQESSKYLYMEYHSPEDNRMNRNRLLHINLGIHSPSSYHPGDGAHLNGGRTLVHSSSD
FT                   GHIDPQHTAGKQLICLVQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSM
FT                   QTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSN
FT                   LYGSPGSIFIRQTSQSSSGRQTPQNAPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYS
FT                   PKQQQIPQSVYHSPPPSQCPSPFSSPQHQVQPPQLGHPSSHVFMPPSPSTTPPHLYQQG
FT                   PPSYQKPGSHSVAYLPYTASSLPKGSMKKIEITVEPSQRPGTAITRSPSPISNQPSPRN
FT                   QHSLYTATTPPSSSPSRGISSQPKPPFSVNPVYITYTQPTGPSCAPSPSPRVIPNPTTV
FT                   FKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGNHKYQRSSSSGSDDYA
FT                   YTQALLLHQRARMERLAKQLKLEKEELERLKAEVNSMEHDLMQRRLRRVSCTTAIPTPE
FT                   EMTRLRSTNRQLQINVDCTLKEVDLLQSRDSCAIERKARRISVTSKAPVDIHDAQAAAA
FT                   DEHLSICKQSARTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT"
FT   assembly_gap    10517157..10517308
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    10519197..10519407
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    10520902..10521015
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    10522466..10523019
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    10528426..10528445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10536561..10536580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10543456..10546759
FT                   /estimated_length=3304
FT                   /gap_type="unknown"
FT   assembly_gap    10552169..10552719
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    10555804..10555902
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    10575556..10575757
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    10579886..10580022
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    10581135..10581858
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    10583072..10583091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10583499..>10658868)
FT                   /gene="Gyk"
FT                   /locus_tag="mCG_113451"
FT                   /note="gene_id=mCG113451.2"
FT   mRNA            complement(join(10583499..10585955,10592611..10592691,
FT                   10593902..10594045,10594159..10594279,10594834..10594918,
FT                   10595902..10595998,10597225..10597303,10611783..10611863,
FT                   10612464..10612506,10618414..10618481,10618895..10618930,
FT                   10621925..10621991,10622697..10622806,10625344..10625481,
FT                   10627855..10627931,10635962..10636039,10642744..10642850,
FT                   10643503..10643576,10658656..10658854))
FT                   /gene="Gyk"
FT                   /locus_tag="mCG_113451"
FT                   /product="glycerol kinase, transcript variant mCT114536"
FT                   /note="gene_id=mCG113451.2 transcript_id=mCT114536.1
FT                   created on 14-MAY-2002"
FT   mRNA            complement(join(10584155..10585955,10587797..10587883,
FT                   10592611..10592691,10593902..10594045,10594159..10594279,
FT                   10594834..10594918,10595902..10595998,10597225..10597303,
FT                   10611783..10611863,10612464..10612506,10618414..10618481,
FT                   10618895..10618930,10621925..10621991,10622697..10622806,
FT                   10625344..10625481,10627855..10627931,10635962..10636039,
FT                   10642744..10642850,10643503..10643576,10658656..>10658868))
FT                   /gene="Gyk"
FT                   /locus_tag="mCG_113451"
FT                   /product="glycerol kinase, transcript variant mCT192592"
FT                   /note="gene_id=mCG113451.2 transcript_id=mCT192592.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(10585945..10585955,10587797..10587883,
FT                   10592611..10592691,10593902..10594045,10594159..10594279,
FT                   10594834..10594918,10595902..10595998,10597225..10597303,
FT                   10611783..10611863,10612464..10612506,10618414..10618481,
FT                   10618895..10618930,10621925..10621991,10622697..10622806,
FT                   10625344..10625481,10627855..10627931,10635962..10636039,
FT                   10642744..10642850,10643503..10643576,10658656..>10658742))
FT                   /codon_start=1
FT                   /gene="Gyk"
FT                   /locus_tag="mCG_113451"
FT                   /product="glycerol kinase, isoform CRA_a"
FT                   /note="gene_id=mCG113451.2 transcript_id=mCT192592.0
FT                   protein_id=mCP113546.0 isoform=CRA_a"
FT                   /protein_id="EDL29154.1"
FT                   /translation="LTSMAAAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVE
FT                   IKQEFPREGWVEQDPKEILQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWD
FT                   KVTGEPLYNAVVWLDLRTQSTVENLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDN
FT                   VKKVQEAVEENRALFGTIDSWLIWSLTGGIHGGVHCTDVTNASRTMLFNIHSLEWDKEL
FT                   CEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNT
FT                   YGTGCFLLCNTGHKCVFSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLG
FT                   IIKSSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAA
FT                   LEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETT
FT                   ALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSIGWV
FT                   TTQSPESGDPSIFCSLPLGFFIVSSMVMLIGARYISGIP"
FT   CDS             complement(join(10585945..10585955,10592611..10592691,
FT                   10593902..10594045,10594159..10594279,10594834..10594918,
FT                   10595902..10595998,10597225..10597303,10611783..10611863,
FT                   10612464..10612506,10618414..10618481,10618895..10618930,
FT                   10621925..10621991,10622697..10622806,10625344..10625481,
FT                   10627855..10627931,10635962..10636039,10642744..10642850,
FT                   10643503..10643576,10658656..10658733))
FT                   /codon_start=1
FT                   /gene="Gyk"
FT                   /locus_tag="mCG_113451"
FT                   /product="glycerol kinase, isoform CRA_b"
FT                   /note="gene_id=mCG113451.2 transcript_id=mCT114536.1
FT                   protein_id=mCP66699.1 isoform=CRA_b"
FT                   /protein_id="EDL29155.1"
FT                   /translation="MAAAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQ
FT                   EFPREGWVEQDPKEILQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKVT
FT                   GEPLYNAVVWLDLRTQSTVENLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVKK
FT                   VQEAVEENRALFGTIDSWLIWSLTGGIHGGVHCTDVTNASRTMLFNIHSLEWDKELCEF
FT                   FGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGT
FT                   GCFLLCNTGHKCVFSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIK
FT                   SSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEA
FT                   VCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALG
FT                   AAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSIGWVTTQ
FT                   SPESGIP"
FT   gene            10597981..10598585
FT                   /pseudo
FT                   /locus_tag="mCG_113457"
FT                   /note="gene_id=mCG113457.1"
FT   mRNA            10597981..10598585
FT                   /pseudo
FT                   /locus_tag="mCG_113457"
FT                   /note="gene_id=mCG113457.1 transcript_id=mCT114541.1
FT                   created on 17-MAY-2002"
FT   assembly_gap    10600148..10600314
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    10609694..10609713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10620807..10620826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10637325..10637777
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    10638789..10638999
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    10649010..10649038
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            10673136..10673483
FT                   /pseudo
FT                   /locus_tag="mCG_1035421"
FT                   /note="gene_id=mCG1035421.1"
FT   mRNA            10673136..10673483
FT                   /pseudo
FT                   /locus_tag="mCG_1035421"
FT                   /note="gene_id=mCG1035421.1 transcript_id=mCT153125.1
FT                   created on 17-MAY-2002"
FT   assembly_gap    10674468..10674668
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   gene            complement(10676109..10676543)
FT                   /pseudo
FT                   /locus_tag="mCG_18158"
FT                   /note="gene_id=mCG18158.2"
FT   mRNA            complement(10676109..10676543)
FT                   /pseudo
FT                   /locus_tag="mCG_18158"
FT                   /note="gene_id=mCG18158.2 transcript_id=mCT20124.2 created
FT                   on 14-MAY-2002"
FT   assembly_gap    10688492..10688511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10703960..10704571
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    10705470..10706020
FT                   /estimated_length=551
FT                   /gap_type="unknown"
FT   assembly_gap    10707418..10707548
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   gene            <10708546..10715918
FT                   /locus_tag="mCG_1035459"
FT                   /note="gene_id=mCG1035459.0"
FT   mRNA            join(<10708546..10708763,10715477..10715918)
FT                   /locus_tag="mCG_1035459"
FT                   /product="mCG1035459"
FT                   /note="gene_id=mCG1035459.0 transcript_id=mCT153163.0
FT                   created on 17-MAY-2002"
FT   CDS             <10708546..10708704
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035459"
FT                   /product="mCG1035459"
FT                   /note="gene_id=mCG1035459.0 transcript_id=mCT153163.0
FT                   protein_id=mCP66567.0"
FT                   /protein_id="EDL29153.1"
FT                   /translation="QQNFFFKGEYQSVAQDHTIQSFYWPENGALSVYLCCLLWWNRPSS
FT                   LPTLSLN"
FT   assembly_gap    10710698..10710717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10711846..10712209
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    10722705..10722817
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    10723842..10725013
FT                   /estimated_length=1172
FT                   /gap_type="unknown"
FT   assembly_gap    10726121..10726391
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    10729816..10730483
FT                   /estimated_length=668
FT                   /gap_type="unknown"
FT   assembly_gap    10732880..10733595
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    10737460..10737720
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    10744393..10744876
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   gene            10750843..10769740
FT                   /locus_tag="mCG_49136"
FT                   /note="gene_id=mCG49136.2"
FT   mRNA            join(10750843..10750971,10768318..10769740)
FT                   /locus_tag="mCG_49136"
FT                   /product="mCG49136"
FT                   /note="gene_id=mCG49136.2 transcript_id=mCT49319.2 created
FT                   on 17-MAY-2002"
FT   CDS             10768319..10769215
FT                   /codon_start=1
FT                   /locus_tag="mCG_49136"
FT                   /product="mCG49136"
FT                   /note="gene_id=mCG49136.2 transcript_id=mCT49319.2
FT                   protein_id=mCP25657.2"
FT                   /db_xref="GOA:Q08EG0"
FT                   /db_xref="InterPro:IPR027869"
FT                   /db_xref="MGI:MGI:1918648"
FT                   /db_xref="UniProtKB/TrEMBL:Q08EG0"
FT                   /protein_id="EDL29152.1"
FT                   /translation="MLSEGYLSGLTYWNDIHWNCASYNEPVAGDQGKETSSVAALSYSS
FT                   VDETQVQSLYVSCKSSGKFISSVHARASQHSRSQSRTVLQANSNPVFESPTLAAVGICR
FT                   DVIRETYLVPPSCKSICKNYNDLHIAGGQVMAINSVMANFPSESSFEDGPLLKSSEISL
FT                   SMEDSTSTQLTELPLKPIQRYSSYWRITSIKEKSSLQMQKPISNAVLNEYLEQKVVELY
FT                   KQYIMDTVFHDSSPTQILASEFIMTNVDQISLQVSKEKNLDTSKVKDIVISHLLQLVSS
FT                   EISTPSLHISQYSNITP"
FT   assembly_gap    10777803..10777822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10783124..10783171
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    10787580..10787618
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    10790082..10790481
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    10794340..10794359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10799875..10799894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10806266..10806539
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   gene            complement(10845945..10847372)
FT                   /locus_tag="mCG_1035458"
FT                   /note="gene_id=mCG1035458.1"
FT   mRNA            complement(join(10845945..10846422,10846442..10847372))
FT                   /locus_tag="mCG_1035458"
FT                   /product="mCG1035458"
FT                   /note="gene_id=mCG1035458.1 transcript_id=mCT153162.1
FT                   created on 14-MAY-2002"
FT   CDS             complement(join(10846037..10846422,10846442..10846490))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035458"
FT                   /product="mCG1035458"
FT                   /note="gene_id=mCG1035458.1 transcript_id=mCT153162.1
FT                   protein_id=mCP66688.1"
FT                   /protein_id="EDL29151.1"
FT                   /translation="MPEDVSFPRFSRPGSSPPTLACTQLARKNDAATGSFCTRLFSPVS
FT                   SCLYLPCLYLPCLYIALVFISPLFLYLPCFYISLVFISPPNPGPLTLLYSQFPSTHSRP
FT                   RHLTRHAASANQGSRGKSPPNWIHLNPGTPAQHSRCLCLI"
FT   assembly_gap    10870239..10870904
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    10876092..10876616
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   assembly_gap    10889941..10890555
FT                   /estimated_length=615
FT                   /gap_type="unknown"
FT   assembly_gap    10900833..10901790
FT                   /estimated_length=958
FT                   /gap_type="unknown"
FT   assembly_gap    10907436..10907625
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    10911178..10912294
FT                   /estimated_length=1117
FT                   /gap_type="unknown"
FT   gene            complement(10913273..10913591)
FT                   /pseudo
FT                   /locus_tag="mCG_1035419"
FT                   /note="gene_id=mCG1035419.1"
FT   mRNA            complement(10913273..10913591)
FT                   /pseudo
FT                   /locus_tag="mCG_1035419"
FT                   /note="gene_id=mCG1035419.1 transcript_id=mCT153123.1
FT                   created on 14-MAY-2002"
FT   assembly_gap    10921187..10921317
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   gene            <10924843..10928120
FT                   /locus_tag="mCG_17895"
FT                   /note="gene_id=mCG17895.1"
FT   mRNA            join(<10924843..10924972,10927340..10928120)
FT                   /locus_tag="mCG_17895"
FT                   /product="mCG17895"
FT                   /note="gene_id=mCG17895.1 transcript_id=mCT17042.2 created
FT                   on 17-MAY-2002"
FT   CDS             join(<10924956..10924972,10927340..10928012)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17895"
FT                   /product="mCG17895"
FT                   /note="gene_id=mCG17895.1 transcript_id=mCT17042.2
FT                   protein_id=mCP2615.2"
FT                   /protein_id="EDL29150.1"
FT                   /translation="DTEDQRFAVSKEYIFRLSGLICSLTAVVFEIILANSRCWRLWEFD
FT                   DKTVQFVFFGLWEAYYHQVFNISGSTTRTLVHSPINSTWTISPEFHYAQTLIVWAILLK
FT                   PVVLLFNAMAVKIDYTNDSFVKGQMLLYKISASLLCISSLCTFVSVSWNHVVDLYGQTT
FT                   LDFPPSFPVKKKDLKMKHYTAAFPIGVLTATMSLFGVIIFLFEMSSLDPQSEVEAQCAS
FT                   RLINQKT"
FT   assembly_gap    10924973..10925604
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   assembly_gap    10943314..10943333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10947365..10947384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10962627..10963403
FT                   /estimated_length=777
FT                   /gap_type="unknown"
FT   assembly_gap    10998007..10998740
FT                   /estimated_length=734
FT                   /gap_type="unknown"
FT   assembly_gap    11004178..11004332
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    11026696..11026715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11033435..11033608
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    11047673..11047813
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    11049242..11049261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11051566..11051585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11072020..11076179
FT                   /gene="Nr0b1"
FT                   /locus_tag="mCG_4825"
FT                   /note="gene_id=mCG4825.1"
FT   mRNA            join(11072020..11073209,11075589..11076179)
FT                   /gene="Nr0b1"
FT                   /locus_tag="mCG_4825"
FT                   /product="nuclear receptor subfamily 0, group B, member 1"
FT                   /note="gene_id=mCG4825.1 transcript_id=mCT4462.0 created on
FT                   17-MAY-2002"
FT   CDS             join(11072036..11073209,11075589..11075833)
FT                   /codon_start=1
FT                   /gene="Nr0b1"
FT                   /locus_tag="mCG_4825"
FT                   /product="nuclear receptor subfamily 0, group B, member 1"
FT                   /note="gene_id=mCG4825.1 transcript_id=mCT4462.0
FT                   protein_id=mCP9544.1"
FT                   /db_xref="GOA:Q53ZY9"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR025900"
FT                   /db_xref="MGI:MGI:1352460"
FT                   /db_xref="UniProtKB/TrEMBL:Q53ZY9"
FT                   /protein_id="EDL29149.1"
FT                   /translation="MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGA
FT                   QPVLGGERLSGGQARSLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAP
FT                   CWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSRE
FT                   APEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSA
FT                   DQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILP
FT                   LDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQA
FT                   TEQPQMVSAEAGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCV
FT                   KYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAV
FT                   SMDDMMLEMLCAKL"
FT   assembly_gap    11073807..11073826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11081805..11081926
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    11086234..11086335
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    11091245..11091419
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    11098641..11101983
FT                   /estimated_length=3343
FT                   /gap_type="unknown"
FT   assembly_gap    11107676..11115546
FT                   /estimated_length=7871
FT                   /gap_type="unknown"
FT   assembly_gap    11117678..11117697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11118248..11118267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11121653..11124536
FT                   /estimated_length=2884
FT                   /gap_type="unknown"
FT   assembly_gap    11125679..11129171
FT                   /estimated_length=3493
FT                   /gap_type="unknown"
FT   assembly_gap    11130779..11132048
FT                   /estimated_length=1270
FT                   /gap_type="unknown"
FT   assembly_gap    11144140..11145106
FT                   /estimated_length=967
FT                   /gap_type="unknown"
FT   gene            11146396..11198385
FT                   /pseudo
FT                   /locus_tag="mCG_113456"
FT                   /note="gene_id=mCG113456.1"
FT   mRNA            join(11146396..11147193,11196736..11198385)
FT                   /pseudo
FT                   /locus_tag="mCG_113456"
FT                   /note="gene_id=mCG113456.1 transcript_id=mCT114540.1
FT                   created on 17-MAY-2002"
FT   assembly_gap    11172191..11172334
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    11173682..11173701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<11182911..>11184581)
FT                   /locus_tag="mCG_1035418"
FT                   /note="gene_id=mCG1035418.0"
FT   mRNA            complement(<11182911..>11184581)
FT                   /locus_tag="mCG_1035418"
FT                   /product="mCG1035418"
FT                   /note="gene_id=mCG1035418.0 transcript_id=mCT153122.0
FT                   created on 14-MAY-2002"
FT   CDS             complement(11182911..11184581)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035418"
FT                   /product="mCG1035418"
FT                   /note="gene_id=mCG1035418.0 transcript_id=mCT153122.0
FT                   protein_id=mCP66729.0"
FT                   /db_xref="GOA:A2A9R3"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="InterPro:IPR021072"
FT                   /db_xref="MGI:MGI:2148568"
FT                   /db_xref="UniProtKB/TrEMBL:A2A9R3"
FT                   /protein_id="EDL29148.1"
FT                   /translation="MPRGQKSKARAREKRRLVQDEAQELQDAQAKAGEKGKSPSCSNQD
FT                   SGDAVASTSTAGFPQKSKSQGEAPTTTARKGGACRRSRKSTRGPREESTSCTRVPRFSE
FT                   NPQNDLLTRKTGMLMQYLLCKYKMKQPASKGEMLKVINRRFKEQLPEILKKASERIQLV
FT                   FGLEVKEIKPNGGYYTLVSKLDPSVGNALTTSLPFPQNGLLMPLLGVIFLNGNRASEAE
FT                   IWEFLNVLGIYDGKVHIIFGEPRKLITRDLVKEKYLVYQKEANSDPPSFEFLWGPRAYA
FT                   ETTKMKILEFLAEVNETVPQAFPTHYEEALRDQEERAQAEAVGSPGTSAKDKAEAKVTL
FT                   VDSSCKYQAESKVTLVDSSCKDQAESKVTLVDPSCKDNAKSKVTLGSSRKYKAKSKVPL
FT                   VDSSCKDQAESKVTLVDSCKDQAESKVTLVDSSCKDQAESKVTLVDSSCKDQAESKVTL
FT                   VDPSCKDKAKSKVTLGSSHKYKAKSKVTLVDSSCKDQAESKVTLVDSSCKDQAESKVTL
FT                   VDPSCKDNAKSKVTLGSSRKYKAKSKVPLVDSSGKDKAV"
FT   assembly_gap    11185076..11186240
FT                   /estimated_length=1165
FT                   /gap_type="unknown"
FT   assembly_gap    11192718..11193216
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    11194411..11194430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<11207828..>11208820)
FT                   /locus_tag="mCG_1035417"
FT                   /note="gene_id=mCG1035417.0"
FT   mRNA            complement(<11207828..>11208820)
FT                   /locus_tag="mCG_1035417"
FT                   /product="mCG1035417"
FT                   /note="gene_id=mCG1035417.0 transcript_id=mCT153121.0
FT                   created on 14-MAY-2002"
FT   CDS             complement(11207828..11208820)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035417"
FT                   /product="mCG1035417"
FT                   /note="gene_id=mCG1035417.0 transcript_id=mCT153121.0
FT                   protein_id=mCP66727.0"
FT                   /protein_id="EDL29147.1"
FT                   /translation="MPRGQKKRLNAGGKCHQARGETQDLQGAQAPAAEEKSHFPPSSPH
FT                   LGVTTHKESASKLQSTSKVPQRALSTAESMSDSLTRSYRGAKCKIKRKHSSFQASPSTV
FT                   KRPIKSLIGAVRLVVSYMMEMCRMKRDILKADVLKMINKKNREHFHEIFTRASFNLEVV
FT                   LGVDIKEVDSMKNSYTLVSKMNLPNDGVVTKGRGFPKTGLLMNLLGVIFLKGNRATEEK
FT                   IWEFLNRMKIYDGKKHFIFGEPRKLITQDLVKLKYLEYQPVPNSDPASYEFLWGPRSHA
FT                   ETSKMKILEFWAKINHTVPNVFQSRYDEALKDEEERAAAAVIETTTDAN"
FT   gene            complement(<11224718..>11225740)
FT                   /locus_tag="mCG_1035416"
FT                   /note="gene_id=mCG1035416.0"
FT   mRNA            complement(<11224718..>11225740)
FT                   /locus_tag="mCG_1035416"
FT                   /product="mCG1035416"
FT                   /note="gene_id=mCG1035416.0 transcript_id=mCT153120.0
FT                   created on 14-MAY-2002"
FT   CDS             complement(11224718..11225740)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035416"
FT                   /product="mCG1035416"
FT                   /note="gene_id=mCG1035416.0 transcript_id=mCT153120.0
FT                   protein_id=mCP66726.0"
FT                   /protein_id="EDL29146.1"
FT                   /translation="MPRGKKSKARAREKRRQVQDEAQGLTDAQAKAGEKGESPACSDHE
FT                   SGNAVASTSTAGFQKGRVSTTSAGKGMACKRSGKGANGQEEKNGSFCRAPLSSSGKRMD
FT                   LLSRKTGMLVEYMLYKYKIKEPARRGEMLQLVNKRFKEQFPEIFKKASYRLDMVFGIEL
FT                   KEVQPHGQTYALVSKLDFQDDGSESSEMGVPTRGILIPLLSVIYLNGYCAPEEEVWHFL
FT                   SKLGVYDGVPHLIFGDARKLITEDLVQENYLEYRQVPDSDPPCYQFLWGPKAYAEYSKR
FT                   RVMDFLCKIGETMPSAYSSRYEQDLIEEEEKAQAKAALKAGTKGKAKGHSKAKTGNSTG
FT                   "
FT   assembly_gap    11230146..11230165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<11251844..>11252875)
FT                   /locus_tag="mCG_1035415"
FT                   /note="gene_id=mCG1035415.0"
FT   mRNA            complement(<11251844..>11252875)
FT                   /locus_tag="mCG_1035415"
FT                   /product="mCG1035415"
FT                   /note="gene_id=mCG1035415.0 transcript_id=mCT153119.0
FT                   created on 14-MAY-2002"
FT   CDS             complement(11251844..11252875)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035415"
FT                   /product="mCG1035415"
FT                   /note="gene_id=mCG1035415.0 transcript_id=mCT153119.0
FT                   protein_id=mCP66723.0"
FT                   /protein_id="EDL29145.1"
FT                   /translation="MPRGQKSKARAREKRCKVQEEAQGLKDAQANSSEKGESPACSDQA
FT                   SEDARPSTSTAGFPQHSQSSVPSNTGSKVMTHRRLSKGDQSQGDENKSFSRAPLATGSP
FT                   QMDLLTRKTGMLMEYMLCKYKVKQPMRKGEMLKVINRRFKDHFPEILKKASYQLDVVFG
FT                   LELKEIQPHGQCYELVSKLGFQDDGSESSEMGVPTRGILIPLLSVIYLNGYCAPEEEVW
FT                   HFLSKLGVYDGVPHLIFGDARKLITEDLVREEYLQYSQVPNSDPPSYEFQWGPRAYAET
FT                   SQEKVMDFLAKVSETMPSAYSSRYEQDLIEEEEKAQAKAALKAGTKGKAKGHSKAKTGN
FT                   STG"
FT   assembly_gap    11272537..11272556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<11279066..>11280106)
FT                   /locus_tag="mCG_66188"
FT                   /note="gene_id=mCG66188.2"
FT   mRNA            complement(<11279066..>11280106)
FT                   /locus_tag="mCG_66188"
FT                   /product="mCG66188"
FT                   /note="gene_id=mCG66188.2 transcript_id=mCT66371.2 created
FT                   on 14-MAY-2002"
FT   CDS             complement(11279066..11280106)
FT                   /codon_start=1
FT                   /locus_tag="mCG_66188"
FT                   /product="mCG66188"
FT                   /note="gene_id=mCG66188.2 transcript_id=mCT66371.2
FT                   protein_id=mCP40129.2"
FT                   /protein_id="EDL29144.1"
FT                   /translation="MPRGQKSKVRAREKRRQSKTKFQNLEDTETMAPEEEEPCSSSALP
FT                   SGDAAASTSSETLAKLFQEMSGTTTFSICIACKSTDRGATSRRKKYVSSSAAQQSKKSP
FT                   QQDLLTRKTGMLMEYMLSKYKQKEPLLREEMLNVVTKSFKEQFPEILKKASNRVDLVFG
FT                   LEMKEVQPHGQTYILVSKLDFQDDGSESSELGLPTRGILIPLLSVIYLNGYCVPEEEVW
FT                   HFLSKLGVYDGVPHLIFGDARKLITEDLVQENYLEYRQVPDSDPPCYQFLWGPKAYAES
FT                   SRVKVMEFLGHINEPGSSTYLYNHEESLKEKARAQAGDEAQRSTKSKAKKRSKAKSSLP
FT                   THVSDV"
FT   assembly_gap    11286214..11290343
FT                   /estimated_length=4130
FT                   /gap_type="unknown"
FT   assembly_gap    11307821..11307840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11314320..11314339
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11324400..11324419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11333040..11333059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11336388..11337260
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   assembly_gap    11337693..11338574
FT                   /estimated_length=882
FT                   /gap_type="unknown"
FT   assembly_gap    11340144..11341280
FT                   /estimated_length=1137
FT                   /gap_type="unknown"
FT   assembly_gap    11346589..11347242
FT                   /estimated_length=654
FT                   /gap_type="unknown"
FT   assembly_gap    11357504..11357535
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    11362470..11362589
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    11365950..11365969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11372890..11373153
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    11376977..11377103
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    11387923..11388769
FT                   /estimated_length=847
FT                   /gap_type="unknown"
FT   assembly_gap    11402440..11402858
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    11405370..11405428
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    11416428..11416570
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    11437124..11437841
FT                   /estimated_length=718
FT                   /gap_type="unknown"
FT   assembly_gap    11442944..11442963
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11457459..11476949
FT                   /estimated_length=19491
FT                   /gap_type="unknown"
FT   assembly_gap    11478037..11478656
FT                   /estimated_length=620
FT                   /gap_type="unknown"
FT   assembly_gap    11482631..11482763
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    11485019..11485414
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    11492444..11492463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11494055..11494115
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    11495836..11495904
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    11523015..11523034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11537503..11537522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11549100..11549199
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    11550131..11550150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11552337..11552659
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    11561379..11561398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11563046..11563065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11567258..11567277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11569720..11570091
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    11572720..11573654
FT                   /estimated_length=935
FT                   /gap_type="unknown"
FT   assembly_gap    11582006..11582025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11586142..11586161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11612436..11612585
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            complement(11623292..>12287478)
FT                   /locus_tag="mCG_140394"
FT                   /note="gene_id=mCG140394.0"
FT   mRNA            complement(join(11623292..11624654,11625035..11625205,
FT                   11638715..11638858,11662344..11662489,11664767..11664899,
FT                   11916384..11916458,12169441..12169594,12173616..12173802,
FT                   12287199..>12287478))
FT                   /locus_tag="mCG_140394"
FT                   /product="mCG140394"
FT                   /note="gene_id=mCG140394.0 transcript_id=mCT169396.0
FT                   created on 10-MAY-2002"
FT   CDS             complement(join(11623936..11624654,11625035..11625205,
FT                   11638715..11638858,11662344..11662489,11664767..11664899,
FT                   11916384..11916458,12169441..12169594,12173616..12173802,
FT                   12287199..>12287476))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140394"
FT                   /product="mCG140394"
FT                   /note="gene_id=mCG140394.0 transcript_id=mCT169396.0
FT                   protein_id=mCP92176.0"
FT                   /protein_id="EDL29142.1"
FT                   /translation="DGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLS
FT                   LMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSIS
FT                   LTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKAWR
FT                   PSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES
FT                   KLTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEH
FT                   LGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVELAGGLGAIL
FT                   LLLICSVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWNQETGEEE
FT                   RFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPNYVVRRG
FT                   WSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWHGPKCN
FT                   KLNSKFWKRLQYEMPFKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTALATAH
FT                   PDLRSTFHNTYHSQMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQ
FT                   TKSNREPNPDEAHTNSAILPLLPRETSISSVIW"
FT   assembly_gap    11654836..11654855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11657556..11658486
FT                   /estimated_length=931
FT                   /gap_type="unknown"
FT   assembly_gap    11660078..11660193
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    11705915..11706101
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    11710405..11710424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11718229..11718248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11733851..11733870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11758480..11758581
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    11761843..11766560
FT                   /estimated_length=4718
FT                   /gap_type="unknown"
FT   assembly_gap    11779003..11779075
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    11792059..11792445
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    11807398..11809834
FT                   /estimated_length=2437
FT                   /gap_type="unknown"
FT   assembly_gap    11810692..11813371
FT                   /estimated_length=2680
FT                   /gap_type="unknown"
FT   assembly_gap    11824113..11824132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11825707..11826154
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    11838046..11838065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11840240..11840259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11844001..11844020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11849646..11849665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11881389..11881591
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    11893025..11893169
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    11912822..11913049
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    11922611..11922901
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    11931051..11931070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11939517..11940200
FT                   /estimated_length=684
FT                   /gap_type="unknown"
FT   assembly_gap    11941251..11941270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11943310..11943329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11947134..11952350
FT                   /estimated_length=5217
FT                   /gap_type="unknown"
FT   assembly_gap    11956395..11956571
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    11959114..11959211
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    11990128..11990147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11995287..11995317
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            <11998286..11998942
FT                   /locus_tag="mCG_1035413"
FT                   /note="gene_id=mCG1035413.1"
FT   mRNA            <11998286..11998942
FT                   /locus_tag="mCG_1035413"
FT                   /product="mCG1035413"
FT                   /note="gene_id=mCG1035413.1 transcript_id=mCT153117.1
FT                   created on 17-MAY-2002"
FT   CDS             <11998309..11998452
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035413"
FT                   /product="mCG1035413"
FT                   /note="gene_id=mCG1035413.1 transcript_id=mCT153117.1
FT                   protein_id=mCP66717.1"
FT                   /protein_id="EDL29143.1"
FT                   /translation="SFSSIKKLIKKCITLTVLCTCEISHLSLILFWLFMATYKTHNRMS
FT                   IY"
FT   assembly_gap    11998943..11999043
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    12000443..12000462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12006865..12006884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12009885..12010616
FT                   /estimated_length=732
FT                   /gap_type="unknown"
FT   assembly_gap    12011850..12012139
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    12014619..12014897
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    12017178..12017275
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    12025395..12025583
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    12037593..12037612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12051406..12051429
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    12055335..12055354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12059332..12059351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12061318..12061494
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    12063605..12063624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12068504..12068865
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    12089147..12090391
FT                   /estimated_length=1245
FT                   /gap_type="unknown"
FT   assembly_gap    12091657..12093178
FT                   /estimated_length=1522
FT                   /gap_type="unknown"
FT   assembly_gap    12098530..12098549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12103725..12103744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12104787..12104806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12107819..12107838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12116691..12116747
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    12120648..12120667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12122026..12122577
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   assembly_gap    12126936..12129528
FT                   /estimated_length=2593
FT                   /gap_type="unknown"
FT   assembly_gap    12139904..12139923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12148496..12148546
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    12155679..12155698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12181915..12182159
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    12201991..12202448
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   assembly_gap    12207113..12207132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12213844..12213863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12228323..12228342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12245636..12246006
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    12289077..12289138
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    12297251..12299675
FT                   /estimated_length=2425
FT                   /gap_type="unknown"
FT   assembly_gap    12312223..12312281
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    12318774..12318793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12328001..12333602
FT                   /estimated_length=5602
FT                   /gap_type="unknown"
FT   assembly_gap    12336594..12337221
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    12337855..12337939
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    12345043..12345062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12351790..12351809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12353845..12353885
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    12363147..12363288
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    12364757..12364776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
XX
CO   join(AAHY01212782.1:1..2883,gap(2941),complement(AAHY01212783.1:1..1223),
CO   gap(1135),complement(AAHY01212784.1:1..3734),gap(20),
CO   complement(AAHY01212785.1:1..2511),gap(279),AAHY01212786.1:1..5620,
CO   gap(15442),complement(AAHY01212787.1:1..3512),gap(291),
CO   complement(AAHY01212788.1:1..1954),gap(3737),
CO   complement(AAHY01212789.1:1..6592),gap(20),
CO   complement(AAHY01212790.1:1..3754),gap(647),
CO   complement(AAHY01212791.1:1..10575),gap(20),
CO   complement(AAHY01212792.1:1..9887),gap(20),AAHY01212793.1:1..2666,gap(20),
CO   complement(AAHY01212794.1:1..9195),gap(20),
CO   complement(AAHY01212795.1:1..4067),gap(20),
CO   complement(AAHY01212796.1:1..15638),gap(199),
CO   complement(AAHY01212797.1:1..4025),gap(20),
CO   complement(AAHY01212798.1:1..9182),gap(20),
CO   complement(AAHY01212799.1:1..2271),gap(20),
CO   complement(AAHY01212800.1:1..25555),gap(861),
CO   complement(AAHY01212801.1:1..5757),gap(164),
CO   complement(AAHY01212802.1:1..7088),gap(182),
CO   complement(AAHY01212803.1:1..6239),gap(20),
CO   complement(AAHY01212804.1:1..3024),gap(92),
CO   complement(AAHY01212805.1:1..2700),gap(52),
CO   complement(AAHY01212806.1:1..6354),gap(20),
CO   complement(AAHY01212807.1:1..6013),gap(20),AAHY01212808.1:1..6832,gap(20),
CO   AAHY01212809.1:1..8854,gap(46),complement(AAHY01212810.1:1..6250),gap(114),
CO   complement(AAHY01212811.1:1..2833),gap(48),
CO   complement(AAHY01212812.1:1..4097),gap(20),
CO   complement(AAHY01212813.1:1..7460),gap(20),
CO   complement(AAHY01212814.1:1..1397),gap(20),
CO   complement(AAHY01212815.1:1..5157),gap(20),
CO   complement(AAHY01212816.1:1..1140),gap(512),
CO   complement(AAHY01212817.1:1..4207),gap(20),
CO   complement(AAHY01212818.1:1..6074),gap(3273),AAHY01212819.1:1..2497,
CO   gap(581),complement(AAHY01212820.1:1..14068),gap(20),
CO   complement(AAHY01212821.1:1..2366),gap(20),
CO   complement(AAHY01212822.1:1..1903),gap(1951),
CO   complement(AAHY01212823.1:1..7062),gap(25),
CO   complement(AAHY01212824.1:1..6501),gap(873),
CO   complement(AAHY01212825.1:1..15954),gap(4818),AAHY01212826.1:1..4105,
CO   gap(627),AAHY01212827.1:1..1496,gap(20),complement(AAHY01212828.1:1..1847),
CO   gap(100),AAHY01212829.1:1..4792,gap(102),AAHY01212830.1:1..667,gap(112),
CO   AAHY01212831.1:1..5968,gap(423),complement(AAHY01212832.1:1..10281),
CO   gap(20),complement(AAHY01212833.1:1..3208),gap(319),
CO   complement(AAHY01212834.1:1..18081),gap(89),
CO   complement(AAHY01212835.1:1..12802),gap(20),
CO   complement(AAHY01212836.1:1..1234),gap(1007),
CO   complement(AAHY01212837.1:1..3799),gap(74),
CO   complement(AAHY01212838.1:1..4083),gap(573),
CO   complement(AAHY01212839.1:1..13447),gap(6681),
CO   complement(AAHY01212840.1:1..10987),gap(20),
CO   complement(AAHY01212841.1:1..4836),gap(450),
CO   complement(AAHY01212842.1:1..13970),gap(20),
CO   complement(AAHY01212843.1:1..15826),gap(591),
CO   complement(AAHY01212844.1:1..1026),gap(20),
CO   complement(AAHY01212845.1:1..4221),gap(1013),AAHY01212846.1:1..2799,
CO   gap(20),AAHY01212847.1:1..11088,gap(27),AAHY01212848.1:1..14459,gap(20),
CO   complement(AAHY01212849.1:1..1209),gap(20),
CO   complement(AAHY01212850.1:1..32837),gap(118),
CO   complement(AAHY01212851.1:1..3841),gap(254),
CO   complement(AAHY01212852.1:1..6394),gap(178),
CO   complement(AAHY01212853.1:1..1198),gap(163),
CO   complement(AAHY01212854.1:1..24417),gap(20),
CO   complement(AAHY01212855.1:1..1995),gap(274),
CO   complement(AAHY01212856.1:1..17617),gap(20),AAHY01212857.1:1..7462,
CO   gap(630),complement(AAHY01212858.1:1..14575),gap(54),
CO   complement(AAHY01212859.1:1..3284),gap(420),
CO   complement(AAHY01212860.1:1..20088),gap(20),
CO   complement(AAHY01212861.1:1..2841),gap(20),AAHY01212862.1:1..6473,gap(168),
CO   complement(AAHY01212863.1:1..17233),gap(1970),
CO   complement(AAHY01212864.1:1..565),gap(313),
CO   complement(AAHY01212865.1:1..20466),gap(4139),
CO   complement(AAHY01212866.1:1..3960),gap(81),
CO   complement(AAHY01212867.1:1..1079),gap(778),AAHY01212868.1:1..738,gap(356),
CO   complement(AAHY01212869.1:1..1211),gap(24),
CO   complement(AAHY01212870.1:1..26772),gap(20),
CO   complement(AAHY01212871.1:1..1409),gap(848),
CO   complement(AAHY01212872.1:1..2843),gap(1577),
CO   complement(AAHY01212873.1:1..6589),gap(86),
CO   complement(AAHY01212874.1:1..2321),gap(271),
CO   complement(AAHY01212875.1:1..8325),gap(2581),
CO   complement(AAHY01212876.1:1..1056),gap(1611),
CO   complement(AAHY01212877.1:1..4202),gap(7669),
CO   complement(AAHY01212878.1:1..2439),gap(1606),AAHY01212879.1:1..1886,
CO   gap(1457),complement(AAHY01212880.1:1..2596),gap(20),
CO   AAHY01212881.1:1..1750,gap(4171),complement(AAHY01212882.1:1..1344),
CO   gap(497),complement(AAHY01212883.1:1..14992),gap(20),
CO   complement(AAHY01212884.1:1..3208),gap(159),
CO   complement(AAHY01212885.1:1..32509),gap(20),
CO   complement(AAHY01212886.1:1..1983),gap(5247),AAHY01212887.1:1..1097,
CO   gap(21573),complement(AAHY01212888.1:1..10291),gap(289),
CO   AAHY01212889.1:1..17060,gap(414),AAHY01212890.1:1..39989,gap(280),
CO   complement(AAHY01212891.1:1..29177),gap(20),AAHY01212892.1:1..17190,
CO   gap(563),complement(AAHY01212893.1:1..34145),gap(344),
CO   complement(AAHY01212894.1:1..12544),gap(20),
CO   complement(AAHY01212895.1:1..2558),gap(950),
CO   complement(AAHY01212896.1:1..14020),gap(1537),
CO   complement(AAHY01212897.1:1..5597),gap(20),AAHY01212898.1:1..2200,
CO   gap(3187),complement(AAHY01212899.1:1..31833),gap(249),
CO   AAHY01212900.1:1..27719,gap(405),AAHY01212901.1:1..7264,gap(54),
CO   complement(AAHY01212902.1:1..8417),gap(111),AAHY01212903.1:1..2824,gap(53),
CO   complement(AAHY01212904.1:1..8486),gap(2093),
CO   complement(AAHY01212905.1:1..1229),gap(20),
CO   complement(AAHY01212906.1:1..1352),gap(450),AAHY01212907.1:1..4072,
CO   gap(118),complement(AAHY01212908.1:1..29123),gap(20),
CO   complement(AAHY01212909.1:1..714),gap(1505),
CO   complement(AAHY01212910.1:1..23576),gap(580),
CO   complement(AAHY01212911.1:1..6523),gap(20),
CO   complement(AAHY01212912.1:1..8319),gap(311),
CO   complement(AAHY01212913.1:1..4572),gap(332),
CO   complement(AAHY01212914.1:1..11276),gap(20),
CO   complement(AAHY01212915.1:1..4762),gap(404),
CO   complement(AAHY01212916.1:1..535),gap(3725),
CO   complement(AAHY01212917.1:1..12324),gap(1501),
CO   complement(AAHY01212918.1:1..5603),gap(20),AAHY01212919.1:1..11972,gap(20),
CO   AAHY01212920.1:1..22103,gap(20),AAHY01212921.1:1..6148,gap(123),
CO   AAHY01212922.1:1..4589,gap(251),AAHY01212923.1:1..2349,gap(231),
CO   complement(AAHY01212924.1:1..1094),gap(855),
CO   complement(AAHY01212925.1:1..12704),gap(798),
CO   complement(AAHY01212926.1:1..12380),gap(20),
CO   complement(AAHY01212927.1:1..1736),gap(1015),AAHY01212928.1:1..7963,
CO   gap(375),complement(AAHY01212929.1:1..18822),gap(232),
CO   AAHY01212930.1:1..1934,gap(109),AAHY01212931.1:1..8553,gap(20),
CO   complement(AAHY01212932.1:1..1159),gap(20),AAHY01212933.1:1..5271,gap(944),
CO   complement(AAHY01212934.1:1..11158),gap(92),AAHY01212935.1:1..10147,
CO   gap(20),complement(AAHY01212936.1:1..14232),gap(20),
CO   complement(AAHY01212937.1:1..6381),gap(20),AAHY01212938.1:1..10696,
CO   gap(1866),AAHY01212939.1:1..4641,gap(375),AAHY01212940.1:1..2339,gap(213),
CO   complement(AAHY01212941.1:1..1957),gap(78),
CO   complement(AAHY01212942.1:1..17682),gap(2538),
CO   complement(AAHY01212943.1:1..10769),gap(20),
CO   complement(AAHY01212944.1:1..8337),gap(20),AAHY01212945.1:1..25675,
CO   gap(208),AAHY01212946.1:1..1843,gap(30),complement(AAHY01212947.1:1..8861),
CO   gap(20),AAHY01212948.1:1..6355,gap(789),AAHY01212949.1:1..1432,gap(711),
CO   complement(AAHY01212950.1:1..55698),gap(20),
CO   complement(AAHY01212951.1:1..20188),gap(5252),
CO   complement(AAHY01212952.1:1..2852),gap(20),
CO   complement(AAHY01212953.1:1..1458),gap(9077),
CO   complement(AAHY01212954.1:1..24691),gap(10096),AAHY01212955.1:1..1994,
CO   gap(52),complement(AAHY01212956.1:1..5393),gap(536),
CO   AAHY01212957.1:1..21650,gap(20),complement(AAHY01212958.1:1..18927),
CO   gap(32),complement(AAHY01212959.1:1..762),gap(675),AAHY01212960.1:1..1140,
CO   gap(175),AAHY01212961.1:1..1900,gap(117),AAHY01212962.1:1..4751,gap(102),
CO   AAHY01212963.1:1..2797,gap(4481),AAHY01212964.1:1..2321,gap(20),
CO   complement(AAHY01212965.1:1..6702),gap(491),AAHY01212966.1:1..4958,
CO   gap(233),complement(AAHY01212967.1:1..3404),gap(1093),
CO   complement(AAHY01212968.1:1..2984),gap(178),
CO   complement(AAHY01212969.1:1..12263),gap(20),
CO   complement(AAHY01212970.1:1..2315),gap(20),
CO   complement(AAHY01212971.1:1..18421),gap(3193),AAHY01212972.1:1..1534,
CO   gap(120),complement(AAHY01212973.1:1..7300),gap(20),
CO   complement(AAHY01212974.1:1..1751),gap(1304),
CO   complement(AAHY01212975.1:1..2063),gap(1236),
CO   complement(AAHY01212976.1:1..26238),gap(20),
CO   complement(AAHY01212977.1:1..1495),gap(115),
CO   complement(AAHY01212978.1:1..1354),gap(20),AAHY01212979.1:1..10140,gap(77),
CO   AAHY01212980.1:1..1073,gap(134),complement(AAHY01212981.1:1..2450),
CO   gap(328),AAHY01212982.1:1..8943,gap(151),AAHY01212983.1:1..4102,gap(1126),
CO   complement(AAHY01212984.1:1..2686),gap(920),AAHY01212985.1:1..11933,
CO   gap(414),complement(AAHY01212986.1:1..1404),gap(739),
CO   AAHY01212987.1:1..6748,gap(129),complement(AAHY01212988.1:1..5286),gap(80),
CO   AAHY01212989.1:1..24903,gap(108),AAHY01212990.1:1..3640,gap(1425),
CO   complement(AAHY01212991.1:1..3233),gap(85),AAHY01212992.1:1..3125,gap(719),
CO   complement(AAHY01212993.1:1..4281),gap(6843),
CO   complement(AAHY01212994.1:1..11726),gap(20),
CO   complement(AAHY01212995.1:1..11973),gap(220),
CO   complement(AAHY01212996.1:1..13736),gap(7585),AAHY01212997.1:1..1704,
CO   gap(231),complement(AAHY01212998.1:1..5898),gap(20),
CO   complement(AAHY01212999.1:1..3799),gap(20),
CO   complement(AAHY01213000.1:1..2629),gap(20),
CO   complement(AAHY01213001.1:1..5374),gap(20),
CO   complement(AAHY01213002.1:1..7720),gap(194),AAHY01213003.1:1..5932,gap(20),
CO   AAHY01213004.1:1..6822,gap(3367),complement(AAHY01213005.1:1..4751),
CO   gap(20),complement(AAHY01213006.1:1..1466),gap(20),
CO   complement(AAHY01213007.1:1..5152),gap(520),AAHY01213008.1:1..938,gap(164),
CO   complement(AAHY01213009.1:1..23520),gap(501),AAHY01213010.1:1..2722,
CO   gap(481),complement(AAHY01213011.1:1..39164),gap(2201),
CO   complement(AAHY01213012.1:1..2964),gap(59),
CO   complement(AAHY01213013.1:1..7371),gap(20),
CO   complement(AAHY01213014.1:1..1504),gap(20),AAHY01213015.1:1..5248,gap(20),
CO   complement(AAHY01213016.1:1..5822),gap(20),AAHY01213017.1:1..4490,gap(215),
CO   AAHY01213018.1:1..12960,gap(346),AAHY01213019.1:1..1263,gap(20),
CO   AAHY01213020.1:1..5288,gap(20),AAHY01213021.1:1..6634,gap(20),
CO   complement(AAHY01213022.1:1..8845),gap(3850),
CO   complement(AAHY01213023.1:1..4334),gap(212),AAHY01213024.1:1..4268,
CO   gap(490),complement(AAHY01213025.1:1..831),gap(961),
CO   complement(AAHY01213026.1:1..8312),gap(20),
CO   complement(AAHY01213027.1:1..1907),gap(20),AAHY01213028.1:1..10531,gap(20),
CO   AAHY01213029.1:1..752,gap(88),AAHY01213030.1:1..3347,gap(9240),
CO   complement(AAHY01213031.1:1..2173),gap(20),AAHY01213032.1:1..4388,gap(20),
CO   complement(AAHY01213033.1:1..37465),gap(20),
CO   complement(AAHY01213034.1:1..4885),gap(244),
CO   complement(AAHY01213035.1:1..10770),gap(1848),
CO   complement(AAHY01213036.1:1..1351),gap(2293),
CO   complement(AAHY01213037.1:1..5267),gap(633),AAHY01213038.1:1..2195,
CO   gap(3375),complement(AAHY01213039.1:1..17964),gap(20),
CO   complement(AAHY01213040.1:1..3738),gap(105),AAHY01213041.1:1..2904,gap(20),
CO   AAHY01213042.1:1..5269,gap(114),AAHY01213043.1:1..1252,gap(20),
CO   AAHY01213044.1:1..9114,gap(20),AAHY01213045.1:1..5703,gap(20),
CO   complement(AAHY01213046.1:1..2495),gap(157),AAHY01213047.1:1..2343,
CO   gap(101),complement(AAHY01213048.1:1..4216),gap(1558),
CO   complement(AAHY01213049.1:1..3329),gap(1622),
CO   complement(AAHY01213050.1:1..1802),gap(1499),
CO   complement(AAHY01213051.1:1..2270),gap(316),
CO   complement(AAHY01213052.1:1..19163),gap(45),
CO   complement(AAHY01213053.1:1..1417),gap(20),
CO   complement(AAHY01213054.1:1..2021),gap(495),
CO   complement(AAHY01213055.1:1..3750),gap(299),AAHY01213056.1:1..1558,
CO   gap(123),AAHY01213057.1:1..2402,gap(20),complement(AAHY01213058.1:1..2292),
CO   gap(1242),complement(AAHY01213059.1:1..6225),gap(20),
CO   complement(AAHY01213060.1:1..9220),gap(5768),
CO   complement(AAHY01213061.1:1..9358),gap(232),AAHY01213062.1:1..3166,
CO   gap(409),complement(AAHY01213063.1:1..8601),gap(20),AAHY01213064.1:1..6833,
CO   gap(357),AAHY01213065.1:1..15967,gap(20),AAHY01213066.1:1..1384,gap(5204),
CO   AAHY01213067.1:1..1041,gap(20),complement(AAHY01213068.1:1..19500),
CO   gap(668),complement(AAHY01213069.1:1..16982),gap(158),
CO   complement(AAHY01213070.1:1..4747),gap(20),
CO   complement(AAHY01213071.1:1..27885),gap(548),AAHY01213072.1:1..4620,
CO   gap(20),complement(AAHY01213073.1:1..13432),gap(180),
CO   complement(AAHY01213074.1:1..22521),gap(116),
CO   complement(AAHY01213075.1:1..18643),gap(20),
CO   complement(AAHY01213076.1:1..10033),gap(32),
CO   complement(AAHY01213077.1:1..24662),gap(47),
CO   complement(AAHY01213078.1:1..939),gap(323),
CO   complement(AAHY01213079.1:1..15540),gap(1214),
CO   complement(AAHY01213080.1:1..33009),gap(218),
CO   complement(AAHY01213081.1:1..4020),gap(1469),AAHY01213082.1:1..1635,
CO   gap(57),complement(AAHY01213083.1:1..2704),gap(712),
CO   complement(AAHY01213084.1:1..32779),gap(5933),AAHY01213085.1:1..1980,
CO   gap(1289),complement(AAHY01213086.1:1..5741),gap(87),
CO   complement(AAHY01213087.1:1..1731),gap(726),
CO   complement(AAHY01213088.1:1..18301),gap(20),
CO   complement(AAHY01213089.1:1..4469),gap(71),
CO   complement(AAHY01213090.1:1..2610),gap(20),
CO   complement(AAHY01213091.1:1..15457),gap(20),AAHY01213092.1:1..4106,gap(20),
CO   complement(AAHY01213093.1:1..6608),gap(498),
CO   complement(AAHY01213094.1:1..4797),gap(763),
CO   complement(AAHY01213095.1:1..4735),gap(203),AAHY01213096.1:1..4615,
CO   gap(146),complement(AAHY01213097.1:1..7098),gap(957),
CO   AAHY01213098.1:1..1867,gap(113),complement(AAHY01213099.1:1..10783),
CO   gap(554),complement(AAHY01213100.1:1..6213),gap(125),
CO   AAHY01213101.1:1..6083,gap(267),AAHY01213102.1:1..4574,gap(55),
CO   AAHY01213103.1:1..1642,gap(502),AAHY01213104.1:1..1105,gap(20),
CO   complement(AAHY01213105.1:1..1873),gap(20),
CO   complement(AAHY01213106.1:1..1825),gap(133),
CO   complement(AAHY01213107.1:1..24950),gap(2127),
CO   complement(AAHY01213108.1:1..9577),gap(1297),
CO   complement(AAHY01213109.1:1..4424),gap(836),
CO   complement(AAHY01213110.1:1..9150),gap(13090),
CO   complement(AAHY01213111.1:1..8225),gap(82),
CO   complement(AAHY01213112.1:1..3593),gap(23616),
CO   complement(AAHY01213113.1:1..7751),gap(249),
CO   complement(AAHY01213114.1:1..8785),gap(20),
CO   complement(AAHY01213115.1:1..2523),gap(132),AAHY01213116.1:1..3882,
CO   gap(757),AAHY01213117.1:1..4409,gap(20),complement(AAHY01213118.1:1..7066),
CO   gap(23968),AAHY01213119.1:1..9573,gap(172),AAHY01213120.1:1..3951,gap(20),
CO   complement(AAHY01213121.1:1..16152),gap(5221),
CO   complement(AAHY01213122.1:1..7018),gap(303),
CO   complement(AAHY01213123.1:1..2122),gap(160),AAHY01213124.1:1..22677,
CO   gap(115),AAHY01213125.1:1..4694,gap(165),
CO   complement(AAHY01213126.1:1..9642),gap(6099),
CO   complement(AAHY01213127.1:1..3653),gap(20),
CO   complement(AAHY01213128.1:1..7819),gap(2965),
CO   complement(AAHY01213129.1:1..8665),gap(154),
CO   complement(AAHY01213130.1:1..28934),gap(20),
CO   complement(AAHY01213131.1:1..4473),gap(2904),AAHY01213132.1:1..1560,
CO   gap(2431),AAHY01213133.1:1..6895,gap(20),
CO   complement(AAHY01213134.1:1..11847),gap(120),
CO   complement(AAHY01213135.1:1..4499),gap(295),
CO   complement(AAHY01213136.1:1..2851),gap(1564),AAHY01213137.1:1..1384,
CO   gap(20),AAHY01213138.1:1..3856,gap(226),complement(AAHY01213139.1:1..2542),
CO   gap(20),AAHY01213140.1:1..6094,gap(20),complement(AAHY01213141.1:1..1013),
CO   gap(20),complement(AAHY01213142.1:1..6708),gap(20),
CO   complement(AAHY01213143.1:1..10332),gap(2267),
CO   complement(AAHY01213144.1:1..6350),gap(20),
CO   complement(AAHY01213145.1:1..14460),gap(20),
CO   complement(AAHY01213146.1:1..2530),gap(5421),
CO   complement(AAHY01213147.1:1..3094),gap(1194),
CO   complement(AAHY01213148.1:1..1035),gap(3858),
CO   complement(AAHY01213149.1:1..8955),gap(20),AAHY01213150.1:1..10666,gap(20),
CO   complement(AAHY01213151.1:1..2335),gap(20),
CO   complement(AAHY01213152.1:1..19273),gap(284),AAHY01213153.1:1..910,
CO   gap(2519),complement(AAHY01213154.1:1..2474),gap(246),
CO   complement(AAHY01213155.1:1..21542),gap(20),AAHY01213156.1:1..14496,
CO   gap(5899),complement(AAHY01213157.1:1..2251),gap(20),
CO   complement(AAHY01213158.1:1..4202),gap(20),
CO   complement(AAHY01213159.1:1..2390),gap(20),
CO   complement(AAHY01213160.1:1..1764),gap(20),AAHY01213161.1:1..1992,
CO   gap(1171),complement(AAHY01213162.1:1..1317),gap(20),
CO   complement(AAHY01213163.1:1..3205),gap(20),AAHY01213164.1:1..15083,
CO   gap(284),complement(AAHY01213165.1:1..2877),gap(20),
CO   complement(AAHY01213166.1:1..3823),gap(20),
CO   complement(AAHY01213167.1:1..4274),gap(20),
CO   complement(AAHY01213168.1:1..7856),gap(20),
CO   complement(AAHY01213169.1:1..4742),gap(459),
CO   complement(AAHY01213170.1:1..9870),gap(179),
CO   complement(AAHY01213171.1:1..20726),gap(835),
CO   complement(AAHY01213172.1:1..6459),gap(20),
CO   complement(AAHY01213173.1:1..26455),gap(551),
CO   complement(AAHY01213174.1:1..25012),gap(20),
CO   complement(AAHY01213175.1:1..2755),gap(455),
CO   complement(AAHY01213176.1:1..15414),gap(51),
CO   complement(AAHY01213177.1:1..6202),gap(256),
CO   complement(AAHY01213178.1:1..7454),gap(26),
CO   complement(AAHY01213179.1:1..21187),gap(57),AAHY01213180.1:1..6234,gap(20),
CO   complement(AAHY01213181.1:1..3085),gap(20),
CO   complement(AAHY01213182.1:1..25379),gap(20),AAHY01213183.1:1..2057,gap(20),
CO   complement(AAHY01213184.1:1..1396),gap(20),
CO   complement(AAHY01213185.1:1..12678),gap(20),
CO   complement(AAHY01213186.1:1..18487),gap(66),
CO   complement(AAHY01213187.1:1..1721),gap(59),
CO   complement(AAHY01213188.1:1..27091),gap(20),AAHY01213189.1:1..1305,
CO   gap(298),AAHY01213190.1:1..7624,gap(21),AAHY01213191.1:1..1045,gap(20),
CO   complement(AAHY01213192.1:1..5004),gap(233),
CO   complement(AAHY01213193.1:1..4000),gap(726),
CO   complement(AAHY01213194.1:1..5210),gap(977),
CO   complement(AAHY01213195.1:1..8956),gap(20),
CO   complement(AAHY01213196.1:1..5269),gap(20),
CO   complement(AAHY01213197.1:1..18920),gap(5078),
CO   complement(AAHY01213198.1:1..31902),gap(20),AAHY01213199.1:1..33180,
CO   gap(20),AAHY01213200.1:1..6324,gap(20),AAHY01213201.1:1..5275,gap(253),
CO   complement(AAHY01213202.1:1..1024),gap(99),
CO   complement(AAHY01213203.1:1..22780),gap(133),
CO   complement(AAHY01213204.1:1..9894),gap(20),AAHY01213205.1:1..12174,
CO   gap(542),complement(AAHY01213206.1:1..22963),gap(980),
CO   complement(AAHY01213207.1:1..27430),gap(20),
CO   complement(AAHY01213208.1:1..1337),gap(2748),
CO   complement(AAHY01213209.1:1..11541),gap(188),
CO   complement(AAHY01213210.1:1..27714),gap(164),
CO   complement(AAHY01213211.1:1..6655),gap(20),AAHY01213212.1:1..17183,gap(75),
CO   complement(AAHY01213213.1:1..6002),gap(874),AAHY01213214.1:1..5446,
CO   gap(1538),complement(AAHY01213215.1:1..3286),gap(424),
CO   AAHY01213216.1:1..1879,gap(101),AAHY01213217.1:1..19330,gap(20),
CO   AAHY01213218.1:1..7277,gap(20),complement(AAHY01213219.1:1..17725),
CO   gap(2486),AAHY01213220.1:1..741,gap(826),AAHY01213221.1:1..12256,gap(20),
CO   complement(AAHY01213222.1:1..3206),gap(333),
CO   complement(AAHY01213223.1:1..15923),gap(4991),
CO   complement(AAHY01213224.1:1..23749),gap(327),AAHY01213225.1:1..13160,
CO   gap(20),complement(AAHY01213226.1:1..7503),gap(20),
CO   complement(AAHY01213227.1:1..1009),gap(20),AAHY01213228.1:1..9972,gap(572),
CO   complement(AAHY01213229.1:1..2025),gap(401),
CO   complement(AAHY01213230.1:1..4731),gap(374),
CO   complement(AAHY01213231.1:1..6608),gap(1875),AAHY01213232.1:1..883,
CO   gap(1159),AAHY01213233.1:1..1890,gap(20),AAHY01213234.1:1..21811,gap(101),
CO   complement(AAHY01213235.1:1..7320),gap(20),AAHY01213236.1:1..12646,gap(20),
CO   complement(AAHY01213237.1:1..4127),gap(20),
CO   complement(AAHY01213238.1:1..15546),gap(20),
CO   complement(AAHY01213239.1:1..1933),gap(1023),AAHY01213240.1:1..7251,
CO   gap(20),AAHY01213241.1:1..10599,gap(920),AAHY01213242.1:1..1005,gap(1344),
CO   complement(AAHY01213243.1:1..6326),gap(150),AAHY01213244.1:1..1394,gap(20),
CO   complement(AAHY01213245.1:1..3407),gap(20),
CO   complement(AAHY01213246.1:1..5373),gap(496),
CO   complement(AAHY01213247.1:1..16617),gap(426),AAHY01213248.1:1..13507,
CO   gap(1903),AAHY01213249.1:1..1329,gap(726),
CO   complement(AAHY01213250.1:1..8707),gap(1280),
CO   complement(AAHY01213251.1:1..1048),gap(1006),AAHY01213252.1:1..32687,
CO   gap(167),complement(AAHY01213253.1:1..22560),gap(71),
CO   AAHY01213254.1:1..29866,gap(55),AAHY01213255.1:1..11535,gap(20),
CO   AAHY01213256.1:1..1549,gap(1225),AAHY01213257.1:1..9898,gap(34),
CO   AAHY01213258.1:1..5793,gap(20),AAHY01213259.1:1..16012,gap(463),
CO   complement(AAHY01213260.1:1..21539),gap(20),AAHY01213261.1:1..6199,gap(20),
CO   AAHY01213262.1:1..18759,gap(20),AAHY01213263.1:1..19636,gap(20),
CO   AAHY01213264.1:1..5671,gap(203),AAHY01213265.1:1..3114,gap(25),
CO   AAHY01213266.1:1..3714,gap(314),complement(AAHY01213267.1:1..8743),
CO   gap(346),AAHY01213268.1:1..10993,gap(582),
CO   complement(AAHY01213269.1:1..4658),gap(2333),AAHY01213270.1:1..1285,
CO   gap(2833),complement(AAHY01213271.1:1..18971),gap(2368),
CO   complement(AAHY01213272.1:1..1601),gap(20),
CO   complement(AAHY01213273.1:1..10256),gap(643),AAHY01213274.1:1..1033,
CO   gap(20),complement(AAHY01213275.1:1..10598),gap(20),
CO   complement(AAHY01213276.1:1..1821),gap(20),
CO   complement(AAHY01213277.1:1..8992),gap(20),
CO   complement(AAHY01213278.1:1..8740),gap(1847),
CO   complement(AAHY01213279.1:1..8197),gap(916),
CO   complement(AAHY01213280.1:1..1787),gap(58),
CO   complement(AAHY01213281.1:1..4567),gap(20),AAHY01213282.1:1..39778,
CO   gap(116),complement(AAHY01213283.1:1..1694),gap(77),AAHY01213284.1:1..3943,
CO   gap(270),AAHY01213285.1:1..4418,gap(200),AAHY01213286.1:1..6814,gap(20),
CO   complement(AAHY01213287.1:1..3864),gap(1274),
CO   complement(AAHY01213288.1:1..699),gap(84),
CO   complement(AAHY01213289.1:1..1701),gap(20),
CO   complement(AAHY01213290.1:1..1297),gap(1702),AAHY01213291.1:1..2312,
CO   gap(528),complement(AAHY01213292.1:1..5830),gap(4375),
CO   complement(AAHY01213293.1:1..13480),gap(140),
CO   complement(AAHY01213294.1:1..6911),gap(1274),
CO   complement(AAHY01213295.1:1..7866),gap(44),
CO   complement(AAHY01213296.1:1..13807),gap(20),AAHY01213297.1:1..13678,
CO   gap(20),complement(AAHY01213298.1:1..2260),gap(249),
CO   complement(AAHY01213299.1:1..3592),gap(6782),
CO   complement(AAHY01213300.1:1..5183),gap(20),
CO   complement(AAHY01213301.1:1..11745),gap(1909),
CO   complement(AAHY01213302.1:1..1368),gap(519),
CO   complement(AAHY01213303.1:1..5224),gap(7723),
CO   complement(AAHY01213304.1:1..4816),gap(648),AAHY01213305.1:1..3442,
CO   gap(782),AAHY01213306.1:1..4724,gap(20),
CO   complement(AAHY01213307.1:1..11785),gap(20),
CO   complement(AAHY01213308.1:1..2158),gap(1772),
CO   complement(AAHY01213309.1:1..22266),gap(20),
CO   complement(AAHY01213310.1:1..2952),gap(458),
CO   complement(AAHY01213311.1:1..15737),gap(20),
CO   complement(AAHY01213312.1:1..3004),gap(20),AAHY01213313.1:1..7896,gap(20),
CO   AAHY01213314.1:1..4500,gap(20),complement(AAHY01213315.1:1..8379),
CO   gap(3171),complement(AAHY01213316.1:1..6195),gap(760),
CO   AAHY01213317.1:1..10098,gap(32),AAHY01213318.1:1..26088,gap(20),
CO   AAHY01213319.1:1..3335,gap(20),complement(AAHY01213320.1:1..2109),gap(120),
CO   AAHY01213321.1:1..12878,gap(208),complement(AAHY01213322.1:1..5664),
CO   gap(438),AAHY01213323.1:1..5788,gap(20),AAHY01213324.1:1..4427,gap(20),
CO   complement(AAHY01213325.1:1..21112),gap(35),AAHY01213326.1:1..2492,gap(20),
CO   AAHY01213327.1:1..13041,gap(20),AAHY01213328.1:1..26210,gap(307),
CO   complement(AAHY01213329.1:1..11563),gap(20),
CO   complement(AAHY01213330.1:1..13500),gap(1732),
CO   complement(AAHY01213331.1:1..4688),gap(93),AAHY01213332.1:1..2526,
CO   gap(3920),complement(AAHY01213333.1:1..19477),gap(318),
CO   complement(AAHY01213334.1:1..4808),gap(468),
CO   complement(AAHY01213335.1:1..8643),gap(6582),AAHY01213336.1:1..6620,
CO   gap(20),complement(AAHY01213337.1:1..1128),gap(1161),
CO   AAHY01213338.1:1..1405,gap(20),complement(AAHY01213339.1:1..10064),gap(20),
CO   AAHY01213340.1:1..2583,gap(20),complement(AAHY01213341.1:1..4393),gap(172),
CO   complement(AAHY01213342.1:1..2848),gap(20),AAHY01213343.1:1..7052,gap(20),
CO   complement(AAHY01213344.1:1..1218),gap(20),
CO   complement(AAHY01213345.1:1..12569),gap(20),
CO   complement(AAHY01213346.1:1..6364),gap(64),
CO   complement(AAHY01213347.1:1..3285),gap(20),
CO   complement(AAHY01213348.1:1..3991),gap(475),
CO   complement(AAHY01213349.1:1..8576),gap(197),AAHY01213350.1:1..5200,
CO   gap(127),complement(AAHY01213351.1:1..12202),gap(20),
CO   complement(AAHY01213352.1:1..5261),gap(159),
CO   complement(AAHY01213353.1:1..1990),gap(78),
CO   complement(AAHY01213354.1:1..4431),gap(20),AAHY01213355.1:1..1766,
CO   gap(5193),AAHY01213356.1:1..5867,gap(20),AAHY01213357.1:1..1009,gap(20),
CO   complement(AAHY01213358.1:1..4696),gap(20),
CO   complement(AAHY01213359.1:1..4155),gap(20),
CO   complement(AAHY01213360.1:1..14584),gap(176),
CO   complement(AAHY01213361.1:1..13972),gap(20),AAHY01213362.1:1..17454,
CO   gap(254),AAHY01213363.1:1..3594,gap(20),complement(AAHY01213364.1:1..8867),
CO   gap(162),complement(AAHY01213365.1:1..15970),gap(20),
CO   complement(AAHY01213366.1:1..23687),gap(948),
CO   complement(AAHY01213367.1:1..2239),gap(2624),
CO   complement(AAHY01213368.1:1..2611),gap(20),AAHY01213369.1:1..2746,
CO   gap(8375),complement(AAHY01213370.1:1..1364),gap(604),
CO   complement(AAHY01213371.1:1..5037),gap(20),
CO   complement(AAHY01213372.1:1..24110),gap(371),
CO   complement(AAHY01213373.1:1..10880),gap(20),
CO   complement(AAHY01213374.1:1..4366),gap(20),AAHY01213375.1:1..15226,
CO   gap(240),complement(AAHY01213376.1:1..1635),gap(842),
CO   complement(AAHY01213377.1:1..2615),gap(481),
CO   complement(AAHY01213378.1:1..3430),gap(263),
CO   complement(AAHY01213379.1:1..3682),gap(3611),
CO   complement(AAHY01213380.1:1..6885),gap(119),AAHY01213381.1:1..4082,gap(20),
CO   complement(AAHY01213382.1:1..16786),gap(91),
CO   complement(AAHY01213383.1:1..1327),gap(13583),
CO   complement(AAHY01213384.1:1..5236),gap(20),
CO   complement(AAHY01213385.1:1..8493),gap(27),AAHY01213386.1:1..5416,gap(905),
CO   AAHY01213387.1:1..6872,gap(3796),complement(AAHY01213388.1:1..1840),
CO   gap(6935),complement(AAHY01213389.1:1..1063),gap(20),
CO   complement(AAHY01213390.1:1..11760),gap(4962),
CO   complement(AAHY01213391.1:1..14724),gap(20),
CO   complement(AAHY01213392.1:1..4936),gap(20),
CO   complement(AAHY01213393.1:1..8424),gap(20),AAHY01213394.1:1..1496,gap(128),
CO   complement(AAHY01213395.1:1..5220),gap(229),
CO   complement(AAHY01213396.1:1..2834),gap(104),AAHY01213397.1:1..9826,gap(20),
CO   complement(AAHY01213398.1:1..11607),gap(20),
CO   complement(AAHY01213399.1:1..10948),gap(20),AAHY01213400.1:1..11194,
CO   gap(208),AAHY01213401.1:1..5892,gap(107),AAHY01213402.1:1..1932,gap(20),
CO   complement(AAHY01213403.1:1..25323),gap(87),AAHY01213404.1:1..10424,
CO   gap(20),complement(AAHY01213405.1:1..7458),gap(3155),
CO   complement(AAHY01213406.1:1..3293),gap(20),
CO   complement(AAHY01213407.1:1..3569),gap(147),
CO   complement(AAHY01213408.1:1..1593),gap(3560),AAHY01213409.1:1..9587,
CO   gap(1295),complement(AAHY01213410.1:1..1196),gap(1428),
CO   complement(AAHY01213411.1:1..4522),gap(587),
CO   complement(AAHY01213412.1:1..19353),gap(143),
CO   complement(AAHY01213413.1:1..25466),gap(3568),
CO   complement(AAHY01213414.1:1..1575),gap(6865),AAHY01213415.1:1..2196,
CO   gap(133),complement(AAHY01213416.1:1..2771),gap(100),
CO   complement(AAHY01213417.1:1..8117),gap(20),
CO   complement(AAHY01213418.1:1..3874),gap(522),
CO   complement(AAHY01213419.1:1..12017),gap(188),
CO   complement(AAHY01213420.1:1..8434),gap(222),
CO   complement(AAHY01213421.1:1..13258),gap(95),
CO   complement(AAHY01213422.1:1..10494),gap(3634),
CO   complement(AAHY01213423.1:1..1660),gap(120),
CO   complement(AAHY01213424.1:1..3943),gap(1819),
CO   complement(AAHY01213425.1:1..15236),gap(193),AAHY01213426.1:1..3270,
CO   gap(780),AAHY01213427.1:1..1296,gap(20),
CO   complement(AAHY01213428.1:1..16085),gap(20),
CO   complement(AAHY01213429.1:1..15814),gap(310),
CO   complement(AAHY01213430.1:1..3171),gap(644),
CO   complement(AAHY01213431.1:1..3782),gap(20),
CO   complement(AAHY01213432.1:1..1854),gap(2989),AAHY01213433.1:1..2298,
CO   gap(168),AAHY01213434.1:1..5939,gap(28),complement(AAHY01213435.1:1..1564),
CO   gap(4525),complement(AAHY01213436.1:1..5251),gap(20),
CO   AAHY01213437.1:1..3198,gap(84),AAHY01213438.1:1..33690,gap(54),
CO   AAHY01213439.1:1..17677,gap(23),AAHY01213440.1:1..4737,gap(20),
CO   complement(AAHY01213441.1:1..12685),gap(20),
CO   complement(AAHY01213442.1:1..1795),gap(20),
CO   complement(AAHY01213443.1:1..12187),gap(20),
CO   complement(AAHY01213444.1:1..6213),gap(173),
CO   complement(AAHY01213445.1:1..26472),gap(20),
CO   complement(AAHY01213446.1:1..4385),gap(20),
CO   complement(AAHY01213447.1:1..3965),gap(20),
CO   complement(AAHY01213448.1:1..18381),gap(20),AAHY01213449.1:1..6742,
CO   gap(815),complement(AAHY01213450.1:1..804),gap(1291),
CO   complement(AAHY01213451.1:1..2542),gap(20),AAHY01213452.1:1..1352,
CO   gap(56318),AAHY01213453.1:1..2400,gap(1977),AAHY01213454.1:1..1346,
CO   gap(1535),complement(AAHY01213455.1:1..1284),gap(329),
CO   complement(AAHY01213456.1:1..3023),gap(1110),
CO   complement(AAHY01213457.1:1..5165),gap(20),AAHY01213458.1:1..5260,gap(80),
CO   complement(AAHY01213459.1:1..2321),gap(8362),
CO   complement(AAHY01213460.1:1..17193),gap(20),
CO   complement(AAHY01213461.1:1..11927),gap(69),
CO   complement(AAHY01213462.1:1..24733),gap(20),
CO   complement(AAHY01213463.1:1..9078),gap(345),
CO   complement(AAHY01213464.1:1..18391),gap(114),AAHY01213465.1:1..2434,
CO   gap(20),AAHY01213466.1:1..1352,gap(20),AAHY01213467.1:1..2291,gap(613),
CO   AAHY01213468.1:1..3136,gap(123),complement(AAHY01213469.1:1..21918),
CO   gap(90),complement(AAHY01213470.1:1..8103),gap(907),
CO   complement(AAHY01213471.1:1..4997),gap(36),
CO   complement(AAHY01213472.1:1..10035),gap(20),
CO   complement(AAHY01213473.1:1..14340),gap(77),
CO   complement(AAHY01213474.1:1..14629),gap(3575),
CO   complement(AAHY01213475.1:1..4814),gap(97),
CO   complement(AAHY01213476.1:1..9950),gap(20),
CO   complement(AAHY01213477.1:1..1695),gap(277),
CO   complement(AAHY01213478.1:1..3736),gap(2911),AAHY01213479.1:1..2009,
CO   gap(123),complement(AAHY01213480.1:1..3631),gap(180),
CO   complement(AAHY01213481.1:1..17243),gap(69),
CO   complement(AAHY01213482.1:1..6386),gap(368),
CO   complement(AAHY01213483.1:1..3658),gap(20),
CO   complement(AAHY01213484.1:1..26181),gap(71),
CO   complement(AAHY01213485.1:1..4760),gap(20),AAHY01213486.1:1..14449,
CO   gap(591),AAHY01213487.1:1..1493,gap(308),AAHY01213488.1:1..1091,gap(239),
CO   complement(AAHY01213489.1:1..3432),gap(20),
CO   complement(AAHY01213490.1:1..12091),gap(20),AAHY01213491.1:1..5736,gap(20),
CO   AAHY01213492.1:1..5663,gap(20),complement(AAHY01213493.1:1..1546),gap(31),
CO   AAHY01213494.1:1..5121,gap(20),complement(AAHY01213495.1:1..4465),
CO   gap(3635),complement(AAHY01213496.1:1..9118),gap(81),
CO   complement(AAHY01213497.1:1..13065),gap(135),AAHY01213498.1:1..34266,
CO   gap(20),AAHY01213499.1:1..2078,gap(1116),
CO   complement(AAHY01213500.1:1..9072),gap(178),
CO   complement(AAHY01213501.1:1..5696),gap(873),
CO   complement(AAHY01213502.1:1..21426),gap(20),
CO   complement(AAHY01213503.1:1..3089),gap(8424),
CO   complement(AAHY01213504.1:1..30811),gap(21),
CO   complement(AAHY01213505.1:1..17621),gap(20),AAHY01213506.1:1..1775,gap(20),
CO   AAHY01213507.1:1..6209,gap(429),AAHY01213508.1:1..14192,gap(20),
CO   complement(AAHY01213509.1:1..36319),gap(20),AAHY01213510.1:1..3104,gap(20),
CO   complement(AAHY01213511.1:1..2580),gap(280),AAHY01213512.1:1..1311,gap(20),
CO   complement(AAHY01213513.1:1..5522),gap(77),
CO   complement(AAHY01213514.1:1..2024),gap(195),
CO   complement(AAHY01213515.1:1..5943),gap(20),
CO   complement(AAHY01213516.1:1..11822),gap(46),
CO   complement(AAHY01213517.1:1..9653),gap(4111),
CO   complement(AAHY01213518.1:1..21100),gap(20),
CO   complement(AAHY01213519.1:1..10278),gap(277),AAHY01213520.1:1..1660,
CO   gap(20),complement(AAHY01213521.1:1..7667),gap(93),
CO   complement(AAHY01213522.1:1..639),gap(505),
CO   complement(AAHY01213523.1:1..1554),gap(20),AAHY01213524.1:1..981,gap(115),
CO   complement(AAHY01213525.1:1..10452),gap(40),
CO   complement(AAHY01213526.1:1..30627),gap(665),AAHY01213527.1:1..2301,
CO   gap(20),AAHY01213528.1:1..7268,gap(102),
CO   complement(AAHY01213529.1:1..23262),gap(20),
CO   complement(AAHY01213530.1:1..4665),gap(87),
CO   complement(AAHY01213531.1:1..14353),gap(8061),
CO   complement(AAHY01213532.1:1..8079),gap(1735),
CO   complement(AAHY01213533.1:1..29168),gap(20),
CO   complement(AAHY01213534.1:1..3116),gap(8840),
CO   complement(AAHY01213535.1:1..3426),gap(251),
CO   complement(AAHY01213536.1:1..10241),gap(20),
CO   complement(AAHY01213537.1:1..28292),gap(4758),
CO   complement(AAHY01213538.1:1..10597),gap(20),
CO   complement(AAHY01213539.1:1..10637),gap(250),
CO   complement(AAHY01213540.1:1..3215),gap(286),
CO   complement(AAHY01213541.1:1..13415),gap(20),AAHY01213542.1:1..3619,gap(20),
CO   AAHY01213543.1:1..3678,gap(80),complement(AAHY01213544.1:1..39905),gap(45),
CO   AAHY01213545.1:1..3276,gap(20),AAHY01213546.1:1..16059,gap(134),
CO   complement(AAHY01213547.1:1..7690),gap(4987),
CO   complement(AAHY01213548.1:1..5488),gap(2364),AAHY01213549.1:1..717,gap(20),
CO   AAHY01213550.1:1..4461,gap(283),AAHY01213551.1:1..2164,gap(557),
CO   AAHY01213552.1:1..2931,gap(120),AAHY01213553.1:1..5744,gap(145),
CO   complement(AAHY01213554.1:1..2904),gap(1256),
CO   complement(AAHY01213555.1:1..3285),gap(20),AAHY01213556.1:1..2473,gap(20),
CO   complement(AAHY01213557.1:1..2672),gap(20),AAHY01213558.1:1..12760,
CO   gap(4915),complement(AAHY01213559.1:1..22859),gap(721),
CO   complement(AAHY01213560.1:1..1188),gap(1048),
CO   complement(AAHY01213561.1:1..26750),gap(94),AAHY01213562.1:1..46969,
CO   gap(33),complement(AAHY01213563.1:1..2910),gap(20),
CO   complement(AAHY01213564.1:1..3213),gap(1619),AAHY01213565.1:1..3464,
CO   gap(20),AAHY01213566.1:1..3785,gap(20),complement(AAHY01213567.1:1..4142),
CO   gap(4198),complement(AAHY01213568.1:1..23022),gap(65),
CO   complement(AAHY01213569.1:1..7230),gap(371),
CO   complement(AAHY01213570.1:1..2795),gap(740),AAHY01213571.1:1..2712,
CO   gap(14361),AAHY01213572.1:1..1671,gap(20),AAHY01213573.1:1..2850,gap(1521),
CO   complement(AAHY01213574.1:1..3161),gap(2149),
CO   complement(AAHY01213575.1:1..3162),gap(20),AAHY01213576.1:1..9891,gap(121),
CO   complement(AAHY01213577.1:1..3129),gap(145),AAHY01213578.1:1..570,gap(715),
CO   AAHY01213579.1:1..1317,gap(5965),complement(AAHY01213580.1:1..5082),
CO   gap(20),complement(AAHY01213581.1:1..8992),gap(20),
CO   complement(AAHY01213582.1:1..32367),gap(20),
CO   complement(AAHY01213583.1:1..5048),gap(1069),
CO   complement(AAHY01213584.1:1..2437),gap(710),
CO   complement(AAHY01213585.1:1..16098),gap(385),
CO   complement(AAHY01213586.1:1..5459),gap(20),
CO   complement(AAHY01213587.1:1..6954),gap(20),
CO   complement(AAHY01213588.1:1..36266),gap(3464),AAHY01213589.1:1..738,
CO   gap(1818),complement(AAHY01213590.1:1..2696),gap(185),
CO   AAHY01213591.1:1..4167,gap(20),AAHY01213592.1:1..4923,gap(20),
CO   complement(AAHY01213593.1:1..6800),gap(20),AAHY01213594.1:1..20545,gap(20),
CO   complement(AAHY01213595.1:1..2918),gap(3729),
CO   complement(AAHY01213596.1:1..1970),gap(7648),AAHY01213597.1:1..4194,
CO   gap(26),complement(AAHY01213598.1:1..7184),gap(20),
CO   complement(AAHY01213599.1:1..22781),gap(20),
CO   complement(AAHY01213600.1:1..48852),gap(351),
CO   complement(AAHY01213601.1:1..13434),gap(55),
CO   complement(AAHY01213602.1:1..5600),gap(96),AAHY01213603.1:1..1949,gap(20),
CO   complement(AAHY01213604.1:1..13506),gap(20),
CO   complement(AAHY01213605.1:1..9817),gap(477),
CO   complement(AAHY01213606.1:1..36469),gap(20),AAHY01213607.1:1..5354,
CO   gap(263),complement(AAHY01213608.1:1..5834),gap(96),
CO   AAHY01213609.1:1..10133,gap(163),complement(AAHY01213610.1:1..3567),
CO   gap(85),complement(AAHY01213611.1:1..13258),gap(20),
CO   complement(AAHY01213612.1:1..5412),gap(980),
CO   complement(AAHY01213613.1:1..4900),gap(20),
CO   complement(AAHY01213614.1:1..6813),gap(20),AAHY01213615.1:1..2479,gap(211),
CO   complement(AAHY01213616.1:1..1776),gap(1118),AAHY01213617.1:1..1499,
CO   gap(223),complement(AAHY01213618.1:1..2755),gap(120),
CO   complement(AAHY01213619.1:1..15058),gap(20),
CO   complement(AAHY01213620.1:1..14375),gap(20),
CO   complement(AAHY01213621.1:1..7224),gap(20),
CO   complement(AAHY01213622.1:1..4508),gap(3911),
CO   complement(AAHY01213623.1:1..19600),gap(82),
CO   complement(AAHY01213624.1:1..6303),gap(47),
CO   complement(AAHY01213625.1:1..3833),gap(5653),
CO   complement(AAHY01213626.1:1..3077),gap(20),AAHY01213627.1:1..4753,gap(744),
CO   complement(AAHY01213628.1:1..1597),gap(95),
CO   complement(AAHY01213629.1:1..6907),gap(287),
CO   complement(AAHY01213630.1:1..2091),gap(1318),
CO   complement(AAHY01213631.1:1..762),gap(701),AAHY01213632.1:1..6235,gap(163),
CO   complement(AAHY01213633.1:1..4251),gap(20),AAHY01213634.1:1..25775,
CO   gap(743),complement(AAHY01213635.1:1..1584),gap(148),
CO   complement(AAHY01213636.1:1..48111),gap(547),AAHY01213637.1:1..4588,
CO   gap(108),AAHY01213638.1:1..6461,gap(20),AAHY01213639.1:1..12104,gap(20),
CO   AAHY01213640.1:1..27912,gap(20),complement(AAHY01213641.1:1..2826),
CO   gap(784),complement(AAHY01213642.1:1..5627),gap(70),AAHY01213643.1:1..760,
CO   gap(314),AAHY01213644.1:1..36180,gap(20),AAHY01213645.1:1..19957,gap(20),
CO   complement(AAHY01213646.1:1..16408),gap(1071),AAHY01213647.1:1..2717,
CO   gap(214),complement(AAHY01213648.1:1..12764),gap(513),
CO   complement(AAHY01213649.1:1..25645),gap(175),AAHY01213650.1:1..2646,
CO   gap(120),complement(AAHY01213651.1:1..2295),gap(100),
CO   complement(AAHY01213652.1:1..19614),gap(20),
CO   complement(AAHY01213653.1:1..1055),gap(650),AAHY01213654.1:1..18681,
CO   gap(200),complement(AAHY01213655.1:1..20323),gap(1268),
CO   complement(AAHY01213656.1:1..4232),gap(99),AAHY01213657.1:1..2355,gap(295),
CO   complement(AAHY01213658.1:1..1872),gap(232),
CO   complement(AAHY01213659.1:1..1357),gap(1072),
CO   complement(AAHY01213660.1:1..2476),gap(124),AAHY01213661.1:1..8629,
CO   gap(241),AAHY01213662.1:1..11679,gap(125),
CO   complement(AAHY01213663.1:1..5926),gap(20),AAHY01213664.1:1..19928,gap(20),
CO   AAHY01213665.1:1..1701,gap(1052),AAHY01213666.1:1..2195,gap(445),
CO   AAHY01213667.1:1..5869,gap(20),complement(AAHY01213668.1:1..12051),gap(20),
CO   AAHY01213669.1:1..5322,gap(20),AAHY01213670.1:1..2152,gap(20),
CO   complement(AAHY01213671.1:1..10619),gap(260),AAHY01213672.1:1..7178,
CO   gap(1087),AAHY01213673.1:1..2547,gap(20),AAHY01213674.1:1..9888,gap(93),
CO   AAHY01213675.1:1..2854,gap(119),complement(AAHY01213676.1:1..16523),
CO   gap(20),AAHY01213677.1:1..8580,gap(20),complement(AAHY01213678.1:1..7325),
CO   gap(20),complement(AAHY01213679.1:1..15092),gap(105),
CO   complement(AAHY01213680.1:1..9123),gap(20),AAHY01213681.1:1..1949,gap(841),
CO   complement(AAHY01213682.1:1..6809),gap(103),
CO   complement(AAHY01213683.1:1..2203),gap(994),
CO   complement(AAHY01213684.1:1..2066),gap(2790),
CO   complement(AAHY01213685.1:1..9526),gap(40),AAHY01213686.1:1..9036,gap(644),
CO   AAHY01213687.1:1..17793,gap(20),AAHY01213688.1:1..2824,gap(1523),
CO   AAHY01213689.1:1..2250,gap(47),complement(AAHY01213690.1:1..7734),gap(163),
CO   complement(AAHY01213691.1:1..5920),gap(20),AAHY01213692.1:1..1464,gap(20),
CO   complement(AAHY01213693.1:1..9049),gap(167),AAHY01213694.1:1..4999,
CO   gap(709),complement(AAHY01213695.1:1..2285),gap(154),
CO   AAHY01213696.1:1..2273,gap(264),complement(AAHY01213697.1:1..7306),gap(20),
CO   complement(AAHY01213698.1:1..22990),gap(81),
CO   complement(AAHY01213699.1:1..13983),gap(20),
CO   complement(AAHY01213700.1:1..27356),gap(915),
CO   complement(AAHY01213701.1:1..6452),gap(20),
CO   complement(AAHY01213702.1:1..8886),gap(1527),
CO   complement(AAHY01213703.1:1..5600),gap(90),
CO   complement(AAHY01213704.1:1..12180),gap(121),
CO   complement(AAHY01213705.1:1..8623),gap(20),
CO   complement(AAHY01213706.1:1..11656),gap(20),
CO   complement(AAHY01213707.1:1..15231),gap(64),AAHY01213708.1:1..4542,gap(20),
CO   AAHY01213709.1:1..7404,gap(510),AAHY01213710.1:1..3168,gap(282),
CO   complement(AAHY01213711.1:1..17064),gap(20),
CO   complement(AAHY01213712.1:1..14240),gap(75),
CO   complement(AAHY01213713.1:1..21565),gap(901),
CO   complement(AAHY01213714.1:1..9334),gap(20),
CO   complement(AAHY01213715.1:1..4410),gap(293),
CO   complement(AAHY01213716.1:1..20227),gap(20),
CO   complement(AAHY01213717.1:1..5599),gap(6575),
CO   complement(AAHY01213718.1:1..17856),gap(20),AAHY01213719.1:1..21980,
CO   gap(574),AAHY01213720.1:1..1531,gap(386),
CO   complement(AAHY01213721.1:1..6635),gap(121),AAHY01213722.1:1..1859,
CO   gap(100),AAHY01213723.1:1..1278,gap(75),complement(AAHY01213724.1:1..3558),
CO   gap(172),complement(AAHY01213725.1:1..4548),gap(442),
CO   AAHY01213726.1:1..5368,gap(1324),complement(AAHY01213727.1:1..26287),
CO   gap(20),complement(AAHY01213728.1:1..14736),gap(80),
CO   complement(AAHY01213729.1:1..13935),gap(447),AAHY01213730.1:1..1054,
CO   gap(203),complement(AAHY01213731.1:1..16469),gap(70),
CO   complement(AAHY01213732.1:1..21034),gap(35),
CO   complement(AAHY01213733.1:1..6360),gap(49),
CO   complement(AAHY01213734.1:1..8080),gap(20),
CO   complement(AAHY01213735.1:1..4512),gap(1576),AAHY01213736.1:1..12640,
CO   gap(20),complement(AAHY01213737.1:1..5654),gap(20),
CO   complement(AAHY01213738.1:1..15774),gap(20),
CO   complement(AAHY01213739.1:1..16394),gap(358),
CO   complement(AAHY01213740.1:1..2730),gap(1954),
CO   complement(AAHY01213741.1:1..8454),gap(20),
CO   complement(AAHY01213742.1:1..8192),gap(6556),AAHY01213743.1:1..4066,
CO   gap(95),complement(AAHY01213744.1:1..5447),gap(691),
CO   complement(AAHY01213745.1:1..34941),gap(24),
CO   complement(AAHY01213746.1:1..14240),gap(20),
CO   complement(AAHY01213747.1:1..21408),gap(20),AAHY01213748.1:1..1010,
CO   gap(497),complement(AAHY01213749.1:1..7679),gap(349),
CO   AAHY01213750.1:1..1656,gap(175),complement(AAHY01213751.1:1..4083),
CO   gap(142),complement(AAHY01213752.1:1..4311),gap(20),
CO   complement(AAHY01213753.1:1..27172),gap(87),AAHY01213754.1:1..616,
CO   gap(6502),complement(AAHY01213755.1:1..7713),gap(20),
CO   complement(AAHY01213756.1:1..28116),gap(20),
CO   complement(AAHY01213757.1:1..13219),gap(167),AAHY01213758.1:1..9765,
CO   gap(20),complement(AAHY01213759.1:1..3792),gap(20),
CO   complement(AAHY01213760.1:1..13614),gap(20),AAHY01213761.1:1..3546,gap(20),
CO   complement(AAHY01213762.1:1..3969),gap(495),
CO   complement(AAHY01213763.1:1..11024),gap(3347),
CO   complement(AAHY01213764.1:1..2155),gap(631),
CO   complement(AAHY01213765.1:1..3023),gap(23),AAHY01213766.1:1..2571,gap(377),
CO   complement(AAHY01213767.1:1..971),gap(1679),
CO   complement(AAHY01213768.1:1..5487),gap(20),
CO   complement(AAHY01213769.1:1..2740),gap(563),
CO   complement(AAHY01213770.1:1..12154),gap(305),
CO   complement(AAHY01213771.1:1..2382),gap(310),AAHY01213772.1:1..7522,
CO   gap(161),complement(AAHY01213773.1:1..8295),gap(82),
CO   complement(AAHY01213774.1:1..6321),gap(20),
CO   complement(AAHY01213775.1:1..3045),gap(20),
CO   complement(AAHY01213776.1:1..6932),gap(46),AAHY01213777.1:1..4902,gap(64),
CO   complement(AAHY01213778.1:1..25604),gap(186),
CO   complement(AAHY01213779.1:1..13447),gap(64),
CO   complement(AAHY01213780.1:1..2905),gap(2340),
CO   complement(AAHY01213781.1:1..4755),gap(20),
CO   complement(AAHY01213782.1:1..8421),gap(20),
CO   complement(AAHY01213783.1:1..13627),gap(20),AAHY01213784.1:1..1385,
CO   gap(693),complement(AAHY01213785.1:1..17097),gap(281),
CO   AAHY01213786.1:1..2651,gap(560),complement(AAHY01213787.1:1..8562),
CO   gap(472),complement(AAHY01213788.1:1..4442),gap(20),
CO   complement(AAHY01213789.1:1..27757),gap(4854),AAHY01213790.1:1..4647,
CO   gap(20),AAHY01213791.1:1..4605,gap(36),complement(AAHY01213792.1:1..35364),
CO   gap(20),AAHY01213793.1:1..1085,gap(49),AAHY01213794.1:1..1633,gap(20),
CO   complement(AAHY01213795.1:1..21207),gap(20),
CO   complement(AAHY01213796.1:1..2336),gap(20),
CO   complement(AAHY01213797.1:1..4730),gap(20),AAHY01213798.1:1..11164,gap(20),
CO   AAHY01213799.1:1..2760,gap(117),AAHY01213800.1:1..12940,gap(20),
CO   AAHY01213801.1:1..15663,gap(318),complement(AAHY01213802.1:1..32678),
CO   gap(104),complement(AAHY01213803.1:1..5364),gap(59),
CO   AAHY01213804.1:1..11446,gap(96),AAHY01213805.1:1..1610,gap(20),
CO   AAHY01213806.1:1..15542,gap(264),complement(AAHY01213807.1:1..1509),
CO   gap(560),AAHY01213808.1:1..4298,gap(59),complement(AAHY01213809.1:1..1833),
CO   gap(5944),complement(AAHY01213810.1:1..2928),gap(368),
CO   complement(AAHY01213811.1:1..1344),gap(20),AAHY01213812.1:1..10159,gap(20),
CO   AAHY01213813.1:1..3908,gap(133),complement(AAHY01213814.1:1..17952),
CO   gap(1691),complement(AAHY01213815.1:1..2922),gap(420),
CO   AAHY01213816.1:1..18405,gap(285),AAHY01213817.1:1..8798,gap(140),
CO   AAHY01213818.1:1..5206,gap(20),complement(AAHY01213819.1:1..6340),gap(20),
CO   AAHY01213820.1:1..1298,gap(305),AAHY01213821.1:1..3794,gap(20),
CO   AAHY01213822.1:1..1488,gap(298),AAHY01213823.1:1..16069,gap(20),
CO   AAHY01213824.1:1..9971,gap(71),complement(AAHY01213825.1:1..5583),gap(148),
CO   AAHY01213826.1:1..14636,gap(81),AAHY01213827.1:1..6727,gap(120),
CO   AAHY01213828.1:1..8359,gap(20),AAHY01213829.1:1..3699,gap(20),
CO   AAHY01213830.1:1..2884,gap(20),complement(AAHY01213831.1:1..18625),
CO   gap(1103),complement(AAHY01213832.1:1..37520),gap(31),
CO   AAHY01213833.1:1..2575,gap(2221),complement(AAHY01213834.1:1..17933),
CO   gap(20),complement(AAHY01213835.1:1..8697),gap(95),AAHY01213836.1:1..2425,
CO   gap(308),AAHY01213837.1:1..5231,gap(1855),AAHY01213838.1:1..1032,gap(794),
CO   AAHY01213839.1:1..5010,gap(359),AAHY01213840.1:1..32677,gap(20),
CO   complement(AAHY01213841.1:1..1621),gap(835),
CO   complement(AAHY01213842.1:1..1883),gap(20),AAHY01213843.1:1..21123,
CO   gap(243),AAHY01213844.1:1..5686,gap(20),AAHY01213845.1:1..2110,gap(108),
CO   AAHY01213846.1:1..1100,gap(365),complement(AAHY01213847.1:1..5192),
CO   gap(124),AAHY01213848.1:1..12598,gap(20),
CO   complement(AAHY01213849.1:1..10780),gap(20),AAHY01213850.1:1..2180,
CO   gap(131),AAHY01213851.1:1..5776,gap(82),AAHY01213852.1:1..20497,gap(28),
CO   complement(AAHY01213853.1:1..39539),gap(144),AAHY01213854.1:1..19803,
CO   gap(20),AAHY01213855.1:1..2442,gap(55),AAHY01213856.1:1..2121,gap(20),
CO   AAHY01213857.1:1..5498,gap(241),complement(AAHY01213858.1:1..2183),
CO   gap(1852),AAHY01213859.1:1..10026,gap(20),AAHY01213860.1:1..6475,gap(77),
CO   complement(AAHY01213861.1:1..10111),gap(30),AAHY01213862.1:1..4736,
CO   gap(457),complement(AAHY01213863.1:1..1767),gap(20),
CO   AAHY01213864.1:1..28938,gap(88),complement(AAHY01213865.1:1..12928),
CO   gap(657),AAHY01213866.1:1..1979,gap(1090),
CO   complement(AAHY01213867.1:1..10468),gap(20),
CO   complement(AAHY01213868.1:1..2771),gap(771),
CO   complement(AAHY01213869.1:1..2117),gap(1020),
CO   complement(AAHY01213870.1:1..1612),gap(20),
CO   complement(AAHY01213871.1:1..10417),gap(20),
CO   complement(AAHY01213872.1:1..22834),gap(20),
CO   complement(AAHY01213873.1:1..1939),gap(20),AAHY01213874.1:1..6679,gap(145),
CO   AAHY01213875.1:1..14130,gap(316),complement(AAHY01213876.1:1..25485),
CO   gap(310),AAHY01213877.1:1..6265,gap(20),complement(AAHY01213878.1:1..9143),
CO   gap(1082),complement(AAHY01213879.1:1..8177),gap(201),
CO   complement(AAHY01213880.1:1..853),gap(703),AAHY01213881.1:1..2734,gap(20),
CO   complement(AAHY01213882.1:1..6443),gap(151),
CO   complement(AAHY01213883.1:1..17150),gap(2078),
CO   complement(AAHY01213884.1:1..7776),gap(20),
CO   complement(AAHY01213885.1:1..4665),gap(20),
CO   complement(AAHY01213886.1:1..6592),gap(72),
CO   complement(AAHY01213887.1:1..2015),gap(24),
CO   complement(AAHY01213888.1:1..1796),gap(20),
CO   complement(AAHY01213889.1:1..31815),gap(20),
CO   complement(AAHY01213890.1:1..24480),gap(22),
CO   complement(AAHY01213891.1:1..2674),gap(20),
CO   complement(AAHY01213892.1:1..11243),gap(20),
CO   complement(AAHY01213893.1:1..32868),gap(152),
CO   complement(AAHY01213894.1:1..1888),gap(211),
CO   complement(AAHY01213895.1:1..1494),gap(114),
CO   complement(AAHY01213896.1:1..1450),gap(554),
CO   complement(AAHY01213897.1:1..5406),gap(20),
CO   complement(AAHY01213898.1:1..8115),gap(20),
CO   complement(AAHY01213899.1:1..6875),gap(3304),
CO   complement(AAHY01213900.1:1..5409),gap(551),
CO   complement(AAHY01213901.1:1..3084),gap(99),
CO   complement(AAHY01213902.1:1..19653),gap(202),
CO   complement(AAHY01213903.1:1..4128),gap(137),AAHY01213904.1:1..1112,
CO   gap(724),complement(AAHY01213905.1:1..1213),gap(20),
CO   complement(AAHY01213906.1:1..17056),gap(167),
CO   complement(AAHY01213907.1:1..9379),gap(20),
CO   complement(AAHY01213908.1:1..11093),gap(20),
CO   complement(AAHY01213909.1:1..16498),gap(453),
CO   complement(AAHY01213910.1:1..1011),gap(211),
CO   complement(AAHY01213911.1:1..10010),gap(29),
CO   complement(AAHY01213912.1:1..25429),gap(201),
CO   complement(AAHY01213913.1:1..13823),gap(20),
CO   complement(AAHY01213914.1:1..15448),gap(612),
CO   complement(AAHY01213915.1:1..898),gap(551),
CO   complement(AAHY01213916.1:1..1397),gap(131),
CO   complement(AAHY01213917.1:1..3149),gap(20),AAHY01213918.1:1..1128,gap(364),
CO   complement(AAHY01213919.1:1..10495),gap(113),
CO   complement(AAHY01213920.1:1..1024),gap(1172),AAHY01213921.1:1..1107,
CO   gap(271),AAHY01213922.1:1..3424,gap(668),
CO   complement(AAHY01213923.1:1..2396),gap(716),
CO   complement(AAHY01213924.1:1..3864),gap(261),
CO   complement(AAHY01213925.1:1..6672),gap(484),
CO   complement(AAHY01213926.1:1..32926),gap(20),AAHY01213927.1:1..5301,gap(48),
CO   complement(AAHY01213928.1:1..4408),gap(39),AAHY01213929.1:1..2463,gap(400),
CO   complement(AAHY01213930.1:1..3858),gap(20),
CO   complement(AAHY01213931.1:1..5515),gap(20),
CO   complement(AAHY01213932.1:1..6371),gap(274),
CO   complement(AAHY01213933.1:1..63699),gap(666),AAHY01213934.1:1..5187,
CO   gap(525),complement(AAHY01213935.1:1..13324),gap(615),
CO   complement(AAHY01213936.1:1..10277),gap(958),
CO   complement(AAHY01213937.1:1..5645),gap(190),
CO   complement(AAHY01213938.1:1..3552),gap(1117),
CO   complement(AAHY01213939.1:1..8892),gap(131),
CO   complement(AAHY01213940.1:1..3655),gap(632),AAHY01213941.1:1..17709,
CO   gap(20),AAHY01213942.1:1..4031,gap(20),complement(AAHY01213943.1:1..15242),
CO   gap(777),complement(AAHY01213944.1:1..34603),gap(734),
CO   complement(AAHY01213945.1:1..5437),gap(155),
CO   complement(AAHY01213946.1:1..22363),gap(20),
CO   complement(AAHY01213947.1:1..6719),gap(174),
CO   complement(AAHY01213948.1:1..14064),gap(141),
CO   complement(AAHY01213949.1:1..1428),gap(20),AAHY01213950.1:1..2304,gap(20),
CO   complement(AAHY01213951.1:1..22221),gap(20),
CO   complement(AAHY01213952.1:1..7978),gap(122),
CO   complement(AAHY01213953.1:1..4307),gap(102),AAHY01213954.1:1..4909,
CO   gap(175),complement(AAHY01213955.1:1..7221),gap(3343),
CO   complement(AAHY01213956.1:1..5692),gap(7871),
CO   complement(AAHY01213957.1:1..2131),gap(20),AAHY01213958.1:1..550,gap(20),
CO   complement(AAHY01213959.1:1..3385),gap(2884),
CO   complement(AAHY01213960.1:1..1142),gap(3493),
CO   complement(AAHY01213961.1:1..1607),gap(1270),
CO   complement(AAHY01213962.1:1..12091),gap(967),
CO   complement(AAHY01213963.1:1..27084),gap(144),
CO   complement(AAHY01213964.1:1..1347),gap(20),
CO   complement(AAHY01213965.1:1..11374),gap(1165),
CO   complement(AAHY01213966.1:1..6477),gap(499),AAHY01213967.1:1..1194,gap(20),
CO   complement(AAHY01213968.1:1..35715),gap(20),
CO   complement(AAHY01213969.1:1..42371),gap(20),
CO   complement(AAHY01213970.1:1..13657),gap(4130),
CO   complement(AAHY01213971.1:1..17477),gap(20),AAHY01213972.1:1..6479,gap(20),
CO   complement(AAHY01213973.1:1..10060),gap(20),
CO   complement(AAHY01213974.1:1..8620),gap(20),
CO   complement(AAHY01213975.1:1..3328),gap(873),
CO   complement(AAHY01213976.1:1..432),gap(882),
CO   complement(AAHY01213977.1:1..1569),gap(1137),
CO   complement(AAHY01213978.1:1..5308),gap(654),
CO   complement(AAHY01213979.1:1..10261),gap(32),
CO   complement(AAHY01213980.1:1..4934),gap(120),AAHY01213981.1:1..3360,gap(20),
CO   complement(AAHY01213982.1:1..6920),gap(264),
CO   complement(AAHY01213983.1:1..3823),gap(127),
CO   complement(AAHY01213984.1:1..10819),gap(847),
CO   complement(AAHY01213985.1:1..13670),gap(419),
CO   complement(AAHY01213986.1:1..2511),gap(59),
CO   complement(AAHY01213987.1:1..10999),gap(143),
CO   complement(AAHY01213988.1:1..20553),gap(718),
CO   complement(AAHY01213989.1:1..5102),gap(20),
CO   complement(AAHY01213990.1:1..14495),gap(19491),AAHY01213991.1:1..1087,
CO   gap(620),complement(AAHY01213992.1:1..3974),gap(133),
CO   complement(AAHY01213993.1:1..2255),gap(396),AAHY01213994.1:1..7029,gap(20),
CO   AAHY01213995.1:1..1591,gap(61),complement(AAHY01213996.1:1..1720),gap(69),
CO   complement(AAHY01213997.1:1..27110),gap(20),
CO   complement(AAHY01213998.1:1..14468),gap(20),
CO   complement(AAHY01213999.1:1..11577),gap(100),
CO   complement(AAHY01214000.1:1..931),gap(20),AAHY01214001.1:1..2186,gap(323),
CO   complement(AAHY01214002.1:1..8719),gap(20),AAHY01214003.1:1..1647,gap(20),
CO   AAHY01214004.1:1..4192,gap(20),complement(AAHY01214005.1:1..2442),gap(372),
CO   AAHY01214006.1:1..2628,gap(935),complement(AAHY01214007.1:1..8351),gap(20),
CO   complement(AAHY01214008.1:1..4116),gap(20),
CO   complement(AAHY01214009.1:1..26274),gap(150),
CO   complement(AAHY01214010.1:1..42250),gap(20),
CO   complement(AAHY01214011.1:1..2700),gap(931),
CO   complement(AAHY01214012.1:1..1591),gap(116),
CO   complement(AAHY01214013.1:1..45721),gap(187),
CO   complement(AAHY01214014.1:1..4303),gap(20),
CO   complement(AAHY01214015.1:1..7804),gap(20),
CO   complement(AAHY01214016.1:1..15602),gap(20),
CO   complement(AAHY01214017.1:1..24609),gap(102),AAHY01214018.1:1..3261,
CO   gap(4718),complement(AAHY01214019.1:1..12442),gap(73),
CO   complement(AAHY01214020.1:1..12983),gap(387),
CO   complement(AAHY01214021.1:1..14952),gap(2437),
CO   complement(AAHY01214022.1:1..857),gap(2680),
CO   complement(AAHY01214023.1:1..10741),gap(20),
CO   complement(AAHY01214024.1:1..1574),gap(448),
CO   complement(AAHY01214025.1:1..11891),gap(20),
CO   complement(AAHY01214026.1:1..2174),gap(20),
CO   complement(AAHY01214027.1:1..3741),gap(20),
CO   complement(AAHY01214028.1:1..5625),gap(20),
CO   complement(AAHY01214029.1:1..31723),gap(203),
CO   complement(AAHY01214030.1:1..11433),gap(145),
CO   complement(AAHY01214031.1:1..19652),gap(228),
CO   complement(AAHY01214032.1:1..9561),gap(291),
CO   complement(AAHY01214033.1:1..8149),gap(20),AAHY01214034.1:1..8446,gap(684),
CO   AAHY01214035.1:1..1050,gap(20),complement(AAHY01214036.1:1..2039),gap(20),
CO   complement(AAHY01214037.1:1..3804),gap(5217),
CO   complement(AAHY01214038.1:1..4044),gap(177),
CO   complement(AAHY01214039.1:1..2542),gap(98),
CO   complement(AAHY01214040.1:1..30916),gap(20),
CO   complement(AAHY01214041.1:1..5139),gap(31),
CO   complement(AAHY01214042.1:1..3625),gap(101),
CO   complement(AAHY01214043.1:1..1399),gap(20),AAHY01214044.1:1..6402,gap(20),
CO   AAHY01214045.1:1..3000,gap(732),complement(AAHY01214046.1:1..1233),
CO   gap(290),complement(AAHY01214047.1:1..2479),gap(279),
CO   complement(AAHY01214048.1:1..2280),gap(98),
CO   complement(AAHY01214049.1:1..8119),gap(189),
CO   complement(AAHY01214050.1:1..12009),gap(20),
CO   complement(AAHY01214051.1:1..13793),gap(24),
CO   complement(AAHY01214052.1:1..3905),gap(20),
CO   complement(AAHY01214053.1:1..3977),gap(20),
CO   complement(AAHY01214054.1:1..1966),gap(177),AAHY01214055.1:1..2110,gap(20),
CO   complement(AAHY01214056.1:1..4879),gap(362),
CO   complement(AAHY01214057.1:1..20281),gap(1245),
CO   complement(AAHY01214058.1:1..1265),gap(1522),AAHY01214059.1:1..5351,
CO   gap(20),complement(AAHY01214060.1:1..5175),gap(20),AAHY01214061.1:1..1042,
CO   gap(20),complement(AAHY01214062.1:1..3012),gap(20),
CO   complement(AAHY01214063.1:1..8852),gap(57),
CO   complement(AAHY01214064.1:1..3900),gap(20),
CO   complement(AAHY01214065.1:1..1358),gap(552),
CO   complement(AAHY01214066.1:1..4358),gap(2593),
CO   complement(AAHY01214067.1:1..10375),gap(20),AAHY01214068.1:1..8572,gap(51),
CO   complement(AAHY01214069.1:1..7132),gap(20),
CO   complement(AAHY01214070.1:1..26216),gap(245),
CO   complement(AAHY01214071.1:1..19831),gap(458),
CO   complement(AAHY01214072.1:1..4664),gap(20),AAHY01214073.1:1..6711,gap(20),
CO   complement(AAHY01214074.1:1..14459),gap(20),
CO   complement(AAHY01214075.1:1..17293),gap(371),
CO   complement(AAHY01214076.1:1..43070),gap(62),AAHY01214077.1:1..8112,
CO   gap(2425),complement(AAHY01214078.1:1..12547),gap(59),
CO   complement(AAHY01214079.1:1..6492),gap(20),AAHY01214080.1:1..9207,
CO   gap(5602),complement(AAHY01214081.1:1..2991),gap(628),
CO   AAHY01214082.1:1..633,gap(85),complement(AAHY01214083.1:1..7103),gap(20),
CO   complement(AAHY01214084.1:1..6727),gap(20),
CO   complement(AAHY01214085.1:1..2035),gap(41),
CO   complement(AAHY01214086.1:1..9261),gap(142),AAHY01214087.1:1..1468,gap(20),
CO   complement(AAHY01214088.1:1..13364))
//


spacer
spacer