
ID   CH466575; SV 2; linear; genomic DNA; CON; MUS; 12454175 BP.
AC   CH466575;
PR   Project:PRJNA11785;
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
DE   Mus musculus 232000009821448 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
RN   [1]
RP   1-12454175
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-12454175
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
RN   [3]
RP   1-12454175
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; 2065e3abd1f86ac5932c371b50e93225.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000219.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000594; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001053; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004296; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006169; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007777; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007850; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000011254; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000011256; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018238; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018395; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018899; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018900; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018906; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018914; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018916; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020261; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020346; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020354; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020358; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020361; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020364; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020366; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020368; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020372; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020377; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020385; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020386; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020388; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020390; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020405; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020411; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036117; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036275; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036309; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040283; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040328; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040350; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040365; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040405; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040413; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044170; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044296; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044847; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045421; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046974; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047702; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048378; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048852; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049491; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050343; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050541; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050763; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055333; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057098; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058600; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059397; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059729; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059864; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060170; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060918; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061952; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062204; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063386; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063652; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063827; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064010; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078920; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078921; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078922; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095187; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000101750; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000101874; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107444; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107573; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107645; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000108167; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007921; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009039; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000011400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018755; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019044; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019050; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019060; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020499; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020628; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020630; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020637; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020657; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020672; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020679; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036952; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043873; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046745; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048605; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050937; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056759; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057330; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059930; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060398; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062719; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068853; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071807; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071905; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072152; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074543; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074669; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076006; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076493; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076514; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077143; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078264; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079735; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081794; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093114; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093132; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101293; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108864; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109072; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109086; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109194; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109202; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109223; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109225; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109227; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109261; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155478; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167574; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179282; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179865; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187509; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189851; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203810; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204518; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204706; mus_musculus.
CC   On Sep 6, 2005 this sequence version replaced gi:70978295.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..12454175
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    5069..9925
FT                   /estimated_length=4857
FT                   /gap_type="unknown"
FT   assembly_gap    18849..19544
FT                   /estimated_length=696
FT                   /gap_type="unknown"
FT   assembly_gap    20809..44204
FT                   /estimated_length=23396
FT                   /gap_type="unknown"
FT   assembly_gap    56861..56880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    68548..69042
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    85832..85851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    122192..122211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    127681..127700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    129630..129993
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   assembly_gap    140049..140068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    141742..141761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    142577..143471
FT                   /estimated_length=895
FT                   /gap_type="unknown"
FT   assembly_gap    144594..146641
FT                   /estimated_length=2048
FT                   /gap_type="unknown"
FT   assembly_gap    150838..150857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    151951..151970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    153235..153285
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    164692..164711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    165915..168594
FT                   /estimated_length=2680
FT                   /gap_type="unknown"
FT   assembly_gap    169806..169825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <180547..>180909
FT                   /locus_tag="mCG_1037803"
FT                   /note="gene_id=mCG1037803.1"
FT   mRNA            join(<180547..180738,180774..>180909)
FT                   /locus_tag="mCG_1037803"
FT                   /product="mCG1037803"
FT                   /note="gene_id=mCG1037803.1 transcript_id=mCT155507.1
FT                   created on 08-JUL-2002"
FT   CDS             join(<180564..180738,180774..>180909)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037803"
FT                   /product="mCG1037803"
FT                   /note="gene_id=mCG1037803.1 transcript_id=mCT155507.1
FT                   protein_id=mCP81021.1"
FT                   /protein_id="EDL33871.1"
FT                   "
FT   assembly_gap    183710..184025
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    193961..194077
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    211906..212361
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    230939..231096
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            235997..245571
FT                   /locus_tag="mCG_52056"
FT                   /note="gene_id=mCG52056.3"
FT   mRNA            join(235997..236072,237702..237999,239309..239503,
FT                   240357..242363,244689..245134,245191..245571)
FT                   /locus_tag="mCG_52056"
FT                   /product="mCG52056"
FT                   /note="gene_id=mCG52056.3 transcript_id=mCT52239.3 created
FT                   on 12-JUN-2003"
FT   CDS             join(237725..237999,239309..239503,240357..240426)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52056"
FT                   /product="mCG52056"
FT                   /note="gene_id=mCG52056.3 transcript_id=mCT52239.3
FT                   protein_id=mCP30774.3"
FT                   /protein_id="EDL33870.1"
FT                   ALIFPCPLLQSFLSLQ"
FT   gene            241572..>343482
FT                   /locus_tag="mCG_21806"
FT                   /note="gene_id=mCG21806.2"
FT   mRNA            join(241572..242363,258878..259082,275677..275762,
FT                   280401..280507,283199..283330,287610..287984,
FT                   289728..289770,298201..298521,301978..302345,
FT                   304487..304596,307686..307812,311012..311196,
FT                   319815..319891,321105..321230,328996..329196,
FT                   331043..331123,332477..332581,337753..337940,
FT                   342990..343482)
FT                   /locus_tag="mCG_21806"
FT                   /product="mCG21806, transcript variant mCT21324"
FT                   /note="gene_id=mCG21806.2 transcript_id=mCT21324.2 created
FT                   on 08-JUL-2002"
FT   mRNA            join(241572..242363,258878..259082,275677..275762,
FT                   280401..280507,283199..283330,287610..287984,
FT                   301869..302345,304529..304596,307686..307812,
FT                   311012..311196,315971..316226,319815..319891,
FT                   321105..321230,328996..329196,331043..331123,
FT                   332477..332581,337753..337940,342990..>343482)
FT                   /locus_tag="mCG_21806"
FT                   /product="mCG21806, transcript variant mCT170630"
FT                   /note="gene_id=mCG21806.2 transcript_id=mCT170630.0 created
FT                   on 08-JUL-2002"
FT   CDS             join(241978..242363,258878..259082,275677..275762,
FT                   280401..280507,283199..283330,287610..287984,
FT                   301869..302345,304529..304596,307686..307812,
FT                   311012..311196,315971..316226,319815..319891,
FT                   321105..321230,328996..329196,331043..331123,
FT                   332477..332581,337753..337940,342990..343482)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21806"
FT                   /product="mCG21806, isoform CRA_a"
FT                   /note="gene_id=mCG21806.2 transcript_id=mCT170630.0
FT                   protein_id=mCP93548.0 isoform=CRA_a"
FT                   /protein_id="EDL33868.1"
FT   CDS             join(241978..242363,258878..259082,275677..275762,
FT                   280401..280507,283199..283330,287610..287984,
FT                   289728..289770,298201..298213)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21806"
FT                   /product="mCG21806, isoform CRA_b"
FT                   /note="gene_id=mCG21806.2 transcript_id=mCT21324.2
FT                   protein_id=mCP8431.2 isoform=CRA_b"
FT                   /protein_id="EDL33869.1"
FT   assembly_gap    245135..245189
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    281450..281883
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    318704..318723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    370233..370252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    379712..379904
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    381478..381497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    391479..392655
FT                   /estimated_length=1177
FT                   /gap_type="unknown"
FT   assembly_gap    413964..413983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    417701..417720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    429447..429469
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    464192..464211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    479834..480072
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    488171..488616
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    495334..495424
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    496470..496582
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    499353..499440
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            complement(500140..502309)
FT                   /locus_tag="mCG_1051083"
FT                   /note="gene_id=mCG1051083.0"
FT   mRNA            complement(join(500140..500469,501644..501886,
FT                   502077..502309))
FT                   /locus_tag="mCG_1051083"
FT                   /product="mCG1051083"
FT                   /note="gene_id=mCG1051083.0 transcript_id=mCT194872.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(500306..500469,501644..501830))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051083"
FT                   /product="mCG1051083"
FT                   /note="gene_id=mCG1051083.0 transcript_id=mCT194872.0
FT                   protein_id=mCP115901.0"
FT                   /protein_id="EDL33867.1"
FT                   KQRQPSHLFSFL"
FT   gene            complement(505734..511756)
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /note="gene_id=mCG21800.2"
FT   mRNA            complement(join(505734..506758,508386..508479,
FT                   510220..510398,511084..511182,511702..511756))
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, transcript
FT                   variant mCT21224"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT21224.2 created
FT                   on 08-JUL-2002"
FT   mRNA            complement(join(505734..506758,508386..508479,
FT                   510220..510398,511084..511482))
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, transcript
FT                   variant mCT170625"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT170625.0 created
FT                   on 08-JUL-2002"
FT   mRNA            complement(join(505758..505901,506600..506758,
FT                   508386..508479,510220..510398,511084..511182,
FT                   511702..511728))
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, transcript
FT                   variant mCT170627"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT170627.0 created
FT                   on 08-JUL-2002"
FT   mRNA            complement(join(505763..505901,506600..506758,
FT                   508386..508479,510220..510398,511084..511482))
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, transcript
FT                   variant mCT170626"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT170626.0 created
FT                   on 08-JUL-2002"
FT   mRNA            complement(join(505771..505901,506600..506750,
FT                   508386..508479,510220..510398,511084..>511482))
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, transcript
FT                   variant mCT193123"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT193123.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(505822..505901,506600..506758,
FT                   508386..508479,510220..510398,511084..511171))
FT                   /codon_start=1
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, isoform CRA_b"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT170626.0
FT                   protein_id=mCP93544.0 isoform=CRA_b"
FT                   /protein_id="EDL33863.1"
FT   CDS             complement(join(505822..505901,506600..506758,
FT                   508386..508479,510220..510398,511084..511171))
FT                   /codon_start=1
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, isoform CRA_b"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT170627.0
FT                   protein_id=mCP93545.0 isoform=CRA_b"
FT                   /protein_id="EDL33864.1"
FT   CDS             complement(join(506553..506758,508386..508479,
FT                   510220..510398,511084..511171))
FT                   /codon_start=1
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, isoform CRA_a"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT170625.0
FT                   protein_id=mCP93543.0 isoform=CRA_a"
FT                   /protein_id="EDL33862.1"
FT   CDS             complement(join(506553..506758,508386..508479,
FT                   510220..510398,511084..511171))
FT                   /codon_start=1
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, isoform CRA_a"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT21224.2
FT                   protein_id=mCP8410.2 isoform=CRA_a"
FT                   /protein_id="EDL33866.1"
FT   CDS             complement(join(506743..506750,508386..508479,
FT                   510220..510398,511084..>511177))
FT                   /codon_start=1
FT                   /gene="Pttg1"
FT                   /locus_tag="mCG_21800"
FT                   /product="pituitary tumor-transforming 1, isoform CRA_c"
FT                   /note="gene_id=mCG21800.2 transcript_id=mCT193123.0
FT                   protein_id=mCP114099.0 isoform=CRA_c"
FT                   /protein_id="EDL33865.1"
FT   assembly_gap    518980..518999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <519233..533482
FT                   /gene="D11Ertd730e"
FT                   /locus_tag="mCG_21798"
FT                   /note="gene_id=mCG21798.3"
FT   mRNA            join(<519233..519321,522846..523031,523624..523777,
FT                   524305..524385,524654..524818,526112..526180,
FT                   526722..526769,526947..527078,527324..527421,
FT                   527532..527599,528041..528180,528775..528936,
FT                   530227..530331,530685..530756,530860..530973,
FT                   531513..533482)
FT                   /gene="D11Ertd730e"
FT                   /locus_tag="mCG_21798"
FT                   /product="DNA segment, Chr 11, ERATO Doi 730, expressed,
FT                   transcript variant mCT193111"
FT                   /note="gene_id=mCG21798.3 transcript_id=mCT193111.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(519243..519321,521855..521933,522846..523031,
FT                   523624..523777,524305..524385,524654..524818,
FT                   526112..526180,526722..526769,526947..527078,
FT                   527324..527421,527532..527599,528041..528180,
FT                   528775..528936,530227..530331,530685..530756,
FT                   530860..530973,531513..533461)
FT                   /gene="D11Ertd730e"
FT                   /locus_tag="mCG_21798"
FT                   /product="DNA segment, Chr 11, ERATO Doi 730, expressed,
FT                   transcript variant mCT21223"
FT                   /note="gene_id=mCG21798.3 transcript_id=mCT21223.2 created
FT                   on 08-JUL-2002"
FT   mRNA            join(519302..519321,520555..520712,522846..523031,
FT                   523624..523777,524305..524385,524654..524818,
FT                   526112..526180,526722..526769,526947..527078,
FT                   527324..527421,527532..527599,528041..528180,
FT                   528775..528936,530227..530331,530685..530756,
FT                   530860..530973,531513..533461)
FT                   /gene="D11Ertd730e"
FT                   /locus_tag="mCG_21798"
FT                   /product="DNA segment, Chr 11, ERATO Doi 730, expressed,
FT                   transcript variant mCT170624"
FT                   /note="gene_id=mCG21798.3 transcript_id=mCT170624.0 created
FT                   on 08-JUL-2002"
FT   CDS             join(<519302..519321,522846..523031,523624..523777,
FT                   524305..524385,524654..524818,526112..526180,
FT                   526722..526769,526947..527078,527324..527421,
FT                   527532..527599,528041..528180,528775..528936,
FT                   530227..530331,530685..530756,530860..530973,
FT                   531513..531692)
FT                   /codon_start=1
FT                   /gene="D11Ertd730e"
FT                   /locus_tag="mCG_21798"
FT                   /product="DNA segment, Chr 11, ERATO Doi 730, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21798.3 transcript_id=mCT193111.0
FT                   protein_id=mCP114098.0 isoform=CRA_b"
FT                   /protein_id="EDL33860.1"
FT   CDS             join(522862..523031,523624..523777,524305..524385,
FT                   524654..524818,526112..526180,526722..526769,
FT                   526947..527078,527324..527421,527532..527599,
FT                   528041..528180,528775..528936,530227..530331,
FT                   530685..530756,530860..530973,531513..531692)
FT                   /codon_start=1
FT                   /gene="D11Ertd730e"
FT                   /locus_tag="mCG_21798"
FT                   /product="DNA segment, Chr 11, ERATO Doi 730, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21798.3 transcript_id=mCT170624.0
FT                   protein_id=mCP93542.0 isoform=CRA_a"
FT                   /protein_id="EDL33859.1"
FT                   DPMASFLGQ"
FT   CDS             join(522862..523031,523624..523777,524305..524385,
FT                   524654..524818,526112..526180,526722..526769,
FT                   526947..527078,527324..527421,527532..527599,
FT                   528041..528180,528775..528936,530227..530331,
FT                   530685..530756,530860..530973,531513..531692)
FT                   /codon_start=1
FT                   /gene="D11Ertd730e"
FT                   /locus_tag="mCG_21798"
FT                   /product="DNA segment, Chr 11, ERATO Doi 730, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21798.3 transcript_id=mCT21223.2
FT                   protein_id=mCP8445.2 isoform=CRA_a"
FT                   /protein_id="EDL33861.1"
FT                   DPMASFLGQ"
FT   assembly_gap    537237..539871
FT                   /estimated_length=2635
FT                   /gap_type="unknown"
FT   gene            complement(541298..541590)
FT                   /pseudo
FT                   /locus_tag="mCG_1037720"
FT                   /note="gene_id=mCG1037720.1"
FT   mRNA            complement(541298..541590)
FT                   /pseudo
FT                   /locus_tag="mCG_1037720"
FT                   /note="gene_id=mCG1037720.1 transcript_id=mCT155424.1
FT                   created on 08-JUL-2002"
FT   assembly_gap    542047..542066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            543701..>567173
FT                   /gene="C1qtnf2"
FT                   /locus_tag="mCG_21805"
FT                   /note="gene_id=mCG21805.2"
FT   mRNA            join(543701..543722,561917..561990,566919..>567173)
FT                   /gene="C1qtnf2"
FT                   /locus_tag="mCG_21805"
FT                   /product="C1q and tumor necrosis factor related protein 2,
FT                   transcript variant mCT170629"
FT                   /note="gene_id=mCG21805.2 transcript_id=mCT170629.0 created
FT                   on 08-JUL-2002"
FT   assembly_gap    544902..544921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    547178..547640
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    554433..554546
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   mRNA            join(555331..555414,561917..561990,566919..>567173)
FT                   /gene="C1qtnf2"
FT                   /locus_tag="mCG_21805"
FT                   /product="C1q and tumor necrosis factor related protein 2,
FT                   transcript variant mCT21229"
FT                   /note="gene_id=mCG21805.2 transcript_id=mCT21229.2 created
FT                   on 08-JUL-2002"
FT   CDS             join(561973..561990,566919..>567173)
FT                   /codon_start=1
FT                   /gene="C1qtnf2"
FT                   /locus_tag="mCG_21805"
FT                   /product="C1q and tumor necrosis factor related protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21805.2 transcript_id=mCT170629.0
FT                   protein_id=mCP93547.0 isoform=CRA_a"
FT                   /protein_id="EDL33857.1"
FT   CDS             join(561973..561990,566919..>567173)
FT                   /codon_start=1
FT                   /gene="C1qtnf2"
FT                   /locus_tag="mCG_21805"
FT                   /product="C1q and tumor necrosis factor related protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21805.2 transcript_id=mCT21229.2
FT                   protein_id=mCP8428.2 isoform=CRA_a"
FT                   /protein_id="EDL33858.1"
FT   assembly_gap    562304..562520
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    563130..563477
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    566744..566797
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    569726..569791
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    571076..571490
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    605800..605897
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    615271..615325
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    621132..621499
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    622332..623543
FT                   /estimated_length=1212
FT                   /gap_type="unknown"
FT   gene            <635813..666093
FT                   /locus_tag="mCG_21801"
FT                   /note="gene_id=mCG21801.2"
FT   mRNA            join(<635813..635996,658790..659092,662273..662432,
FT                   664386..666093)
FT                   /locus_tag="mCG_21801"
FT                   /product="mCG21801"
FT                   /note="gene_id=mCG21801.2 transcript_id=mCT21225.2 created
FT                   on 08-JUL-2002"
FT   CDS             join(<635813..635996,658790..659092,662273..662432,
FT                   664386..664809)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21801"
FT                   /product="mCG21801"
FT                   /note="gene_id=mCG21801.2 transcript_id=mCT21225.2
FT                   protein_id=mCP8420.2"
FT                   /protein_id="EDL33856.1"
FT                   SYFSGSHMFPAGCFDS"
FT   assembly_gap    655902..656511
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    659916..660073
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   gene            complement(675150..680620)
FT                   /gene="Fabp6"
FT                   /locus_tag="mCG_21802"
FT                   /note="gene_id=mCG21802.2"
FT   mRNA            complement(join(675150..675260,676554..676643,
FT                   677639..677814,680507..680620))
FT                   /gene="Fabp6"
FT                   /locus_tag="mCG_21802"
FT                   /product="fatty acid binding protein 6, ileal
FT                   (gastrotropin)"
FT                   /note="gene_id=mCG21802.2 transcript_id=mCT21226.2 created
FT                   on 08-JUL-2002"
FT   CDS             complement(join(675207..675260,676554..676643,
FT                   677639..677814,680507..680573))
FT                   /codon_start=1
FT                   /gene="Fabp6"
FT                   /locus_tag="mCG_21802"
FT                   /product="fatty acid binding protein 6, ileal
FT                   (gastrotropin)"
FT                   /note="gene_id=mCG21802.2 transcript_id=mCT21226.2
FT                   protein_id=mCP8419.2"
FT                   /db_xref="GOA:P51162"
FT                   /db_xref="InterPro:IPR000463"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR031257"
FT                   /db_xref="InterPro:IPR031259"
FT                   /db_xref="MGI:MGI:96565"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51162"
FT                   /protein_id="EDL33855.1"
FT   assembly_gap    690665..691018
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    702147..702671
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   assembly_gap    712338..712357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    714203..714222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    715714..715733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    732744..732833
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    740138..740176
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            753916..754644
FT                   /pseudo
FT                   /locus_tag="mCG_1037719"
FT                   /note="gene_id=mCG1037719.1"
FT   mRNA            753916..754644
FT                   /pseudo
FT                   /locus_tag="mCG_1037719"
FT                   /note="gene_id=mCG1037719.1 transcript_id=mCT155423.1
FT                   created on 08-JUL-2002"
FT   assembly_gap    765250..765373
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            <765477..805670
FT                   /locus_tag="mCG_51512"
FT                   /note="gene_id=mCG51512.2"
FT   mRNA            join(<765477..765655,787576..788519,803286..805670)
FT                   /locus_tag="mCG_51512"
FT                   /product="mCG51512, transcript variant mCT51695"
FT                   /note="gene_id=mCG51512.2 transcript_id=mCT51695.2 created
FT                   on 08-JUL-2002"
FT   CDS             join(<765477..765655,787576..788519,803286..803299)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51512"
FT                   /product="mCG51512, isoform CRA_b"
FT                   /note="gene_id=mCG51512.2 transcript_id=mCT51695.2
FT                   protein_id=mCP30795.2 isoform=CRA_b"
FT                   /protein_id="EDL33854.1"
FT   mRNA            join(<767183..767263,787576..788519,803286..805670)
FT                   /locus_tag="mCG_51512"
FT                   /product="mCG51512, transcript variant mCT170631"
FT                   /note="gene_id=mCG51512.2 transcript_id=mCT170631.0 created
FT                   on 08-JUL-2002"
FT   CDS             join(<767232..767263,787576..788519,803286..803299)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51512"
FT                   /product="mCG51512, isoform CRA_a"
FT                   /note="gene_id=mCG51512.2 transcript_id=mCT170631.0
FT                   protein_id=mCP93549.0 isoform=CRA_a"
FT                   /protein_id="EDL33853.1"
FT   gene            complement(780969..781293)
FT                   /pseudo
FT                   /locus_tag="mCG_55780"
FT                   /note="gene_id=mCG55780.1"
FT   mRNA            complement(780969..781293)
FT                   /pseudo
FT                   /locus_tag="mCG_55780"
FT                   /note="gene_id=mCG55780.1 transcript_id=mCT55963.1 created
FT                   on 08-JUL-2002"
FT   assembly_gap    789550..789610
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    806286..806469
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   gene            complement(813232..831235)
FT                   /gene="Ttc1"
FT                   /locus_tag="mCG_21799"
FT                   /note="gene_id=mCG21799.2"
FT   mRNA            complement(join(813232..813832,819644..819698,
FT                   821092..821240,822022..822058,822942..823054,
FT                   824986..825046,828311..828673,831148..831235))
FT                   /gene="Ttc1"
FT                   /locus_tag="mCG_21799"
FT                   /product="tetratricopeptide repeat domain 1"
FT                   /note="gene_id=mCG21799.2 transcript_id=mCT21221.2 created
FT                   on 08-JUL-2002"
FT   CDS             complement(join(813699..813832,819644..819698,
FT                   821092..821240,822022..822058,822942..823054,
FT                   824986..825046,828311..828640))
FT                   /codon_start=1
FT                   /gene="Ttc1"
FT                   /locus_tag="mCG_21799"
FT                   /product="tetratricopeptide repeat domain 1"
FT                   /note="gene_id=mCG21799.2 transcript_id=mCT21221.2
FT                   protein_id=mCP8403.2"
FT                   /protein_id="EDL33852.1"
FT                   INFVQNPNNNR"
FT   assembly_gap    839638..840510
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   assembly_gap    843877..843896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(859161..986443)
FT                   /gene="Adra1b"
FT                   /locus_tag="mCG_21804"
FT                   /note="gene_id=mCG21804.2"
FT   mRNA            complement(join(859161..860310,919715..920856,
FT                   921368..921435,986331..986443))
FT                   /gene="Adra1b"
FT                   /locus_tag="mCG_21804"
FT                   /product="adrenergic receptor, alpha 1b, transcript variant
FT                   mCT170628"
FT                   /note="gene_id=mCG21804.2 transcript_id=mCT170628.0 created
FT                   on 08-JUL-2002"
FT   mRNA            complement(join(859161..860310,919715..920856,
FT                   921368..921435,928982..929131,986331..986443))
FT                   /gene="Adra1b"
FT                   /locus_tag="mCG_21804"
FT                   /product="adrenergic receptor, alpha 1b, transcript variant
FT                   mCT21228"
FT                   /note="gene_id=mCG21804.2 transcript_id=mCT21228.2 created
FT                   on 08-JUL-2002"
FT   CDS             complement(join(859712..860310,919715..920663))
FT                   /codon_start=1
FT                   /gene="Adra1b"
FT                   /locus_tag="mCG_21804"
FT                   /product="adrenergic receptor, alpha 1b, isoform CRA_a"
FT                   /note="gene_id=mCG21804.2 transcript_id=mCT170628.0
FT                   protein_id=mCP93546.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DBL0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001115"
FT                   /db_xref="InterPro:IPR002233"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104774"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DBL0"
FT                   /protein_id="EDL33850.1"
FT   CDS             complement(join(859712..860310,919715..920663))
FT                   /codon_start=1
FT                   /gene="Adra1b"
FT                   /locus_tag="mCG_21804"
FT                   /product="adrenergic receptor, alpha 1b, isoform CRA_a"
FT                   /note="gene_id=mCG21804.2 transcript_id=mCT21228.2
FT                   protein_id=mCP8422.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DBL0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001115"
FT                   /db_xref="InterPro:IPR002233"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104774"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DBL0"
FT                   /protein_id="EDL33851.1"
FT   assembly_gap    875391..875519
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    896140..896752
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    904280..904711
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    910367..910386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    914454..914692
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    916619..916638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    922107..922281
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    932710..932744
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    976248..976435
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    987069..987198
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    997054..997073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1012714..1012809
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    1019682..1020463
FT                   /estimated_length=782
FT                   /gap_type="unknown"
FT   assembly_gap    1023150..1023303
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   gene            <1044870..1226436
FT                   /locus_tag="mCG_145517"
FT                   /note="gene_id=mCG145517.0"
FT   mRNA            join(<1044870..1045107,1092113..1092313,1093081..1093274,
FT                   1117115..1117202,1117758..1117966,1215681..1215796,
FT                   1224974..1226436)
FT                   /locus_tag="mCG_145517"
FT                   /product="mCG145517"
FT                   /note="gene_id=mCG145517.0 transcript_id=mCT184941.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    1048001..1048125
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    1054814..1055306
FT                   /estimated_length=493
FT                   /gap_type="unknown"
FT   assembly_gap    1056362..1056381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1064951..1064970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1084539..1084684
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    1086539..1086558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1087856..1087972
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    1088981..1089000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<1093166..1093274,1117115..1117202,1117758..1117941)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145517"
FT                   /product="mCG145517"
FT                   /note="gene_id=mCG145517.0 transcript_id=mCT184941.0
FT                   protein_id=mCP105977.0"
FT                   /protein_id="EDL33849.1"
FT   assembly_gap    1105450..1105469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1106663..1106682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1110166..1110185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1161618..1161637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1175996..1176015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1177498..1177517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1198828..1198847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1216350..1216369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1227864..1228458
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    1229558..1230928
FT                   /estimated_length=1371
FT                   /gap_type="unknown"
FT   assembly_gap    1237953..1237972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1256926..1257219
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    1263519..1272854
FT                   /estimated_length=9336
FT                   /gap_type="unknown"
FT   assembly_gap    1278315..1278914
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    1300289..1300308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1314999..1315526
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    1346212..1346271
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    1358687..1358735
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    1360258..1360698
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   assembly_gap    1371820..1372052
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    1398320..1403937
FT                   /estimated_length=5618
FT                   /gap_type="unknown"
FT   assembly_gap    1431086..1431105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1437743..1437769
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    1444718..1445202
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    1451854..1454191
FT                   /estimated_length=2338
FT                   /gap_type="unknown"
FT   gene            1489452..1503402
FT                   /gene="Il12b"
FT                   /locus_tag="mCG_20097"
FT                   /note="gene_id=mCG20097.2"
FT   mRNA            join(1489452..1489613,1493426..1493513,1497197..1497463,
FT                   1497850..1497967,1499518..1499735,1500337..1500515,
FT                   1501900..1502024,1502606..1503399)
FT                   /gene="Il12b"
FT                   /locus_tag="mCG_20097"
FT                   /product="interleukin 12b, transcript variant mCT18879"
FT                   /note="gene_id=mCG20097.2 transcript_id=mCT18879.2 created
FT                   on 08-JUL-2002"
FT   mRNA            join(1489474..1489507,1493426..1493513,1497197..1497463,
FT                   1497850..1497967,1499518..1499735,1500337..1500515,
FT                   1501900..1502024,1502606..1503402)
FT                   /gene="Il12b"
FT                   /locus_tag="mCG_20097"
FT                   /product="interleukin 12b, transcript variant mCT170620"
FT                   /note="gene_id=mCG20097.2 transcript_id=mCT170620.0 created
FT                   on 08-JUL-2002"
FT   CDS             join(1493426..1493513,1497197..1497463,1497850..1497967,
FT                   1499518..1499735,1500337..1500515,1501900..1502024,
FT                   1502606..1502618)
FT                   /codon_start=1
FT                   /gene="Il12b"
FT                   /locus_tag="mCG_20097"
FT                   /product="interleukin 12b, isoform CRA_a"
FT                   /note="gene_id=mCG20097.2 transcript_id=mCT170620.0
FT                   protein_id=mCP93538.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3ZAX5"
FT                   /db_xref="InterPro:IPR003530"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015528"
FT                   /db_xref="InterPro:IPR019482"
FT                   /db_xref="MGI:MGI:96540"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAX5"
FT                   /protein_id="EDL33847.1"
FT   CDS             join(1493426..1493513,1497197..1497463,1497850..1497967,
FT                   1499518..1499735,1500337..1500515,1501900..1502024,
FT                   1502606..1502618)
FT                   /codon_start=1
FT                   /gene="Il12b"
FT                   /locus_tag="mCG_20097"
FT                   /product="interleukin 12b, isoform CRA_a"
FT                   /note="gene_id=mCG20097.2 transcript_id=mCT18879.2
FT                   protein_id=mCP8427.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3ZAX5"
FT                   /db_xref="InterPro:IPR003530"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015528"
FT                   /db_xref="InterPro:IPR019482"
FT                   /db_xref="MGI:MGI:96540"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ZAX5"
FT                   /protein_id="EDL33848.1"
FT   assembly_gap    1526895..1526914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1528469..1528488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1533954..1538313
FT                   /estimated_length=4360
FT                   /gap_type="unknown"
FT   gene            1539728..1540410
FT                   /locus_tag="mCG_1037693"
FT                   /note="gene_id=mCG1037693.1"
FT   mRNA            1539728..1540410
FT                   /locus_tag="mCG_1037693"
FT                   /product="mCG1037693"
FT                   /note="gene_id=mCG1037693.1 transcript_id=mCT155397.1
FT                   created on 08-JUL-2002"
FT   CDS             1539737..1540333
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037693"
FT                   /product="mCG1037693"
FT                   /note="gene_id=mCG1037693.1 transcript_id=mCT155397.1
FT                   protein_id=mCP81038.0"
FT                   /protein_id="EDL33846.1"
FT   assembly_gap    1542876..1546434
FT                   /estimated_length=3559
FT                   /gap_type="unknown"
FT   gene            complement(1546435..1560690)
FT                   /locus_tag="mCG_20094"
FT                   /note="gene_id=mCG20094.2"
FT   mRNA            complement(join(1546435..1546690,1548403..1548519,
FT                   1550918..1551016,1551516..1551553,1553849..1553947,
FT                   1555562..1555677,1555755..1555840,1556193..1556284,
FT                   1557012..1557208,1560619..1560690))
FT                   /locus_tag="mCG_20094"
FT                   /product="mCG20094"
FT                   /note="gene_id=mCG20094.2 transcript_id=mCT18876.2 created
FT                   on 08-JUL-2002"
FT   CDS             complement(join(1546559..1546690,1548403..1548519,
FT                   1550918..1551016,1551516..1551553,1553849..1553947,
FT                   1555562..1555677,1555755..1555840,1556193..1556284,
FT                   1557012..1557165))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20094"
FT                   /product="mCG20094"
FT                   /note="gene_id=mCG20094.2 transcript_id=mCT18876.2
FT                   protein_id=mCP8438.2"
FT                   /protein_id="EDL33845.1"
FT   assembly_gap    1592564..1594787
FT                   /estimated_length=2224
FT                   /gap_type="unknown"
FT   assembly_gap    1599301..1599320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1611941..1658745
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /note="gene_id=mCG20098.2"
FT   mRNA            join(1611941..1612121,1618168..1618383,1624515..1624623,
FT                   1635880..1635971,1641999..1642234,1644879..1645054,
FT                   1648374..1648514,1650476..1650658,1653198..1653345,
FT                   1654691..1655047,1657146..1658745)
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /product="RIKEN cDNA 3732413I11, transcript variant
FT                   mCT19079"
FT                   /note="gene_id=mCG20098.2 transcript_id=mCT19079.2 created
FT                   on 08-JUL-2002"
FT   mRNA            join(1612224..1612521,1618168..1618383,1624515..1624623,
FT                   1635880..1635971,1641999..1642234,1644879..1645054,
FT                   1648374..1648514,1650476..1650658,1653198..1653345,
FT                   1654691..1655047,1657146..1658745)
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /product="RIKEN cDNA 3732413I11, transcript variant
FT                   mCT170621"
FT                   /note="gene_id=mCG20098.2 transcript_id=mCT170621.0 created
FT                   on 08-JUL-2002"
FT   mRNA            join(1612623..1612915,1618168..1618383,1624515..1624623,
FT                   1635880..1635971,1641999..1642234,1644879..1645054,
FT                   1648374..1648514,1650476..1650658,1653198..1653345,
FT                   1654691..1655047,1657146..1658745)
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /product="RIKEN cDNA 3732413I11, transcript variant
FT                   mCT170622"
FT                   /note="gene_id=mCG20098.2 transcript_id=mCT170622.0 created
FT                   on 08-JUL-2002"
FT   mRNA            join(1613570..1613745,1618168..1618383,1624515..1624623,
FT                   1635880..1635971,1641999..1642234,1644879..1645054,
FT                   1648374..1648514,1650476..1650658,1653198..1653345,
FT                   1654691..1655047,1657146..1658745)
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /product="RIKEN cDNA 3732413I11, transcript variant
FT                   mCT170623"
FT                   /note="gene_id=mCG20098.2 transcript_id=mCT170623.0 created
FT                   on 08-JUL-2002"
FT   CDS             join(1618200..1618383,1624515..1624623,1635880..1635971,
FT                   1641999..1642234,1644879..1645054,1648374..1648514,
FT                   1650476..1650658,1653198..1653345,1654691..1655047,
FT                   1657146..1657511)
FT                   /codon_start=1
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /product="RIKEN cDNA 3732413I11, isoform CRA_a"
FT                   /note="gene_id=mCG20098.2 transcript_id=mCT170621.0
FT                   protein_id=mCP93540.0 isoform=CRA_a"
FT                   /protein_id="EDL33841.1"
FT   CDS             join(1618200..1618383,1624515..1624623,1635880..1635971,
FT                   1641999..1642234,1644879..1645054,1648374..1648514,
FT                   1650476..1650658,1653198..1653345,1654691..1655047,
FT                   1657146..1657511)
FT                   /codon_start=1
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /product="RIKEN cDNA 3732413I11, isoform CRA_a"
FT                   /note="gene_id=mCG20098.2 transcript_id=mCT170622.0
FT                   protein_id=mCP93539.0 isoform=CRA_a"
FT                   /protein_id="EDL33842.1"
FT   CDS             join(1618200..1618383,1624515..1624623,1635880..1635971,
FT                   1641999..1642234,1644879..1645054,1648374..1648514,
FT                   1650476..1650658,1653198..1653345,1654691..1655047,
FT                   1657146..1657511)
FT                   /codon_start=1
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /product="RIKEN cDNA 3732413I11, isoform CRA_a"
FT                   /note="gene_id=mCG20098.2 transcript_id=mCT170623.0
FT                   protein_id=mCP93541.0 isoform=CRA_a"
FT                   /protein_id="EDL33843.1"
FT   CDS             join(1618200..1618383,1624515..1624623,1635880..1635971,
FT                   1641999..1642234,1644879..1645054,1648374..1648514,
FT                   1650476..1650658,1653198..1653345,1654691..1655047,
FT                   1657146..1657511)
FT                   /codon_start=1
FT                   /gene="3732413I11Rik"
FT                   /locus_tag="mCG_20098"
FT                   /product="RIKEN cDNA 3732413I11, isoform CRA_a"
FT                   /note="gene_id=mCG20098.2 transcript_id=mCT19079.2
FT                   protein_id=mCP8409.2 isoform=CRA_a"
FT                   /protein_id="EDL33844.1"
FT   gene            1678359..1683250
FT                   /locus_tag="mCG_148145"
FT                   /note="gene_id=mCG148145.0"
FT   mRNA            join(1678359..1678393,1679345..1679524,1681862..1682092,
FT                   1683000..1683250)
FT                   /locus_tag="mCG_148145"
FT                   /product="mCG148145"
FT                   /note="gene_id=mCG148145.0 transcript_id=mCT188408.0
FT                   created on 13-JAN-2004"
FT   CDS             join(1682020..1682092,1683000..1683214)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148145"
FT                   /product="mCG148145"
FT                   /note="gene_id=mCG148145.0 transcript_id=mCT188408.0
FT                   protein_id=mCP108590.0"
FT                   /protein_id="EDL33840.1"
FT   assembly_gap    1692173..1692192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1706361..1706679
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   gene            <1710137..2093395
FT                   /gene="Ebf1"
FT                   /locus_tag="mCG_140647"
FT                   /note="gene_id=mCG140647.1"
FT   mRNA            join(<1710137..1710320,1712438..1712594,1713185..1713248,
FT                   1713939..1713994,1724784..1724857,1735523..1735591,
FT                   1957090..1957171,1971768..1971909,1995957..1996090,
FT                   2012437..2012563,2060978..2061066,2078632..2078697,
FT                   2079529..2079706,2080429..2080608,2084121..2084315,
FT                   2092583..2093395)
FT                   /gene="Ebf1"
FT                   /locus_tag="mCG_140647"
FT                   /product="early B-cell factor 1, transcript variant
FT                   mCT193131"
FT                   /note="gene_id=mCG140647.1 transcript_id=mCT193131.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(1710137..1710320,1712438..1712594,1713185..1713367,
FT                   1713939..1713994,1724784..1724857,1735523..1735591,
FT                   1957090..1957171,1971768..1971909,1995960..1996090,
FT                   2012437..2012563,2060978..2061066,2078632..2078697,
FT                   2079529..2079706,2080429..2080608,2084121..2084315,
FT                   2092583..2093041)
FT                   /gene="Ebf1"
FT                   /locus_tag="mCG_140647"
FT                   /product="early B-cell factor 1, transcript variant
FT                   mCT170502"
FT                   /note="gene_id=mCG140647.1 transcript_id=mCT170502.0
FT                   created on 05-JUL-2002"
FT   mRNA            join(1710137..1710320,1712438..1712594,1713185..1713248,
FT                   1713939..1713994,1724784..1724857,1735523..1735591,
FT                   1957090..1957171,1971768..1971909,1995960..1996090,
FT                   2012437..2012563,2060978..2061066,2078632..2078697,
FT                   2079529..2079706,2080429..2080608,2084121..2084315,
FT                   2092583..2093041)
FT                   /gene="Ebf1"
FT                   /locus_tag="mCG_140647"
FT                   /product="early B-cell factor 1, transcript variant
FT                   mCT170501"
FT                   /note="gene_id=mCG140647.1 transcript_id=mCT170501.0
FT                   created on 05-JUL-2002"
FT   CDS             join(<1710139..1710320,1712438..1712594,1713185..1713248,
FT                   1713939..1713994,1724784..1724857,1735523..1735591,
FT                   1957090..1957171,1971768..1971909,1995957..1996090,
FT                   2012437..2012563,2060978..2061066,2078632..2078697,
FT                   2079529..2079706,2080429..2080608,2084121..2084315,
FT                   2092583..2092614)
FT                   /codon_start=1
FT                   /gene="Ebf1"
FT                   /locus_tag="mCG_140647"
FT                   /product="early B-cell factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG140647.1 transcript_id=mCT193131.0
FT                   protein_id=mCP114086.0 isoform=CRA_c"
FT                   /protein_id="EDL33839.1"
FT   CDS             join(1710187..1710320,1712438..1712594,1713185..1713248,
FT                   1713939..1713994,1724784..1724857,1735523..1735591,
FT                   1957090..1957171,1971768..1971909,1995960..1996090,
FT                   2012437..2012563,2060978..2061066,2078632..2078697,
FT                   2079529..2079706,2080429..2080608,2084121..2084315,
FT                   2092583..2092614)
FT                   /codon_start=1
FT                   /gene="Ebf1"
FT                   /locus_tag="mCG_140647"
FT                   /product="early B-cell factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG140647.1 transcript_id=mCT170501.0
FT                   protein_id=mCP93420.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SWK5"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003523"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR018350"
FT                   /db_xref="InterPro:IPR032200"
FT                   /db_xref="InterPro:IPR032201"
FT                   /db_xref="MGI:MGI:95275"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SWK5"
FT                   /protein_id="EDL33837.1"
FT                   GNSLQAISGMIVPPM"
FT   CDS             join(1713983..1713994,1724784..1724857,1735523..1735591,
FT                   1957090..1957171,1971768..1971909,1995960..1996090,
FT                   2012437..2012563,2060978..2061066,2078632..2078697,
FT                   2079529..2079706,2080429..2080608,2084121..2084315,
FT                   2092583..2092614)
FT                   /codon_start=1
FT                   /gene="Ebf1"
FT                   /locus_tag="mCG_140647"
FT                   /product="early B-cell factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG140647.1 transcript_id=mCT170502.0
FT                   protein_id=mCP93419.0 isoform=CRA_b"
FT                   /protein_id="EDL33838.1"
FT                   "
FT   assembly_gap    1747378..1752007
FT                   /estimated_length=4630
FT                   /gap_type="unknown"
FT   assembly_gap    1755745..1755764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1760069..1760088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1798634..1798653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1933822..1933841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1978741..1978760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2000678..2000873
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    2002392..2002809
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    2023982..2024292
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    2025320..2025549
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    2086295..2086314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2089012..2089031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2095138..2095157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2100863..2101008
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    2126344..2126725
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    2157167..2157186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2184130..>2184847)
FT                   /locus_tag="mCG_1037788"
FT                   /note="gene_id=mCG1037788.0"
FT   mRNA            complement(join(2184130..2184634,2184814..>2184847))
FT                   /locus_tag="mCG_1037788"
FT                   /product="mCG1037788"
FT                   /note="gene_id=mCG1037788.0 transcript_id=mCT155492.0
FT                   created on 05-JUL-2002"
FT   CDS             complement(2184364..>2184597)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037788"
FT                   /product="mCG1037788"
FT                   /note="gene_id=mCG1037788.0 transcript_id=mCT155492.0
FT                   protein_id=mCP80856.0"
FT                   /protein_id="EDL33836.1"
FT   assembly_gap    2184650..2184801
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    2188605..2188624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2261068..2261418
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    2270904..2271049
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    2378953..2379846
FT                   /estimated_length=894
FT                   /gap_type="unknown"
FT   assembly_gap    2429393..2429602
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    2440303..2440436
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    2443354..2443373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2487487..2487506
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2515510..2515529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2548274..2548293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2557770..2557789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2576618..2576637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2583776..2584160
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    2631349..2631368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2639564..2639752
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    2644788..2645536
FT                   /estimated_length=749
FT                   /gap_type="unknown"
FT   assembly_gap    2651375..2651664
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    2653147..2653166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2655536..2655786
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    2661456..2661968
FT                   /estimated_length=513
FT                   /gap_type="unknown"
FT   assembly_gap    2666889..2666908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2668447..2668466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2692395..2692414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2700771..2701453)
FT                   /pseudo
FT                   /locus_tag="mCG_1037785"
FT                   /note="gene_id=mCG1037785.1"
FT   mRNA            complement(join(2700771..2700943,2701297..2701453))
FT                   /pseudo
FT                   /locus_tag="mCG_1037785"
FT                   /note="gene_id=mCG1037785.1 transcript_id=mCT155489.1
FT                   created on 05-JUL-2002"
FT   assembly_gap    2724426..2724445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2733984..2734003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2735105..2737492
FT                   /estimated_length=2388
FT                   /gap_type="unknown"
FT   assembly_gap    2769622..2772116
FT                   /estimated_length=2495
FT                   /gap_type="unknown"
FT   assembly_gap    2773242..2777849
FT                   /estimated_length=4608
FT                   /gap_type="unknown"
FT   assembly_gap    2778939..2843145
FT                   /estimated_length=64207
FT                   /gap_type="unknown"
FT   gene            2867747..2868132
FT                   /pseudo
FT                   /locus_tag="mCG_1037717"
FT                   /note="gene_id=mCG1037717.0"
FT   mRNA            join(2867747..2867858,2867871..2868132)
FT                   /pseudo
FT                   /locus_tag="mCG_1037717"
FT                   /note="gene_id=mCG1037717.0 transcript_id=mCT155421.1
FT                   created on 05-JUL-2002"
FT   assembly_gap    2871910..2875306
FT                   /estimated_length=3397
FT                   /gap_type="unknown"
FT   gene            <2875307..2875796
FT                   /locus_tag="mCG_118431"
FT                   /note="gene_id=mCG118431.1"
FT   mRNA            <2875307..2875796
FT                   /locus_tag="mCG_118431"
FT                   /product="mCG118431"
FT                   /note="gene_id=mCG118431.1 transcript_id=mCT119587.1
FT                   created on 05-JUL-2002"
FT   CDS             <2875349..2875624
FT                   /codon_start=1
FT                   /locus_tag="mCG_118431"
FT                   /product="mCG118431"
FT                   /note="gene_id=mCG118431.1 transcript_id=mCT119587.1
FT                   protein_id=mCP80926.0"
FT                   /protein_id="EDL33835.1"
FT   gene            2897695..2956203
FT                   /locus_tag="mCG_22297"
FT                   /note="gene_id=mCG22297.2"
FT   mRNA            join(2897695..2897809,2929294..2929398,2929916..2930012,
FT                   2932015..2932123,2932970..2933134,2936207..2936384,
FT                   2939456..2939702,2940645..2940714,2947795..2947869,
FT                   2951765..2952051,2953478..2953628,2954525..2956201)
FT                   /locus_tag="mCG_22297"
FT                   /product="mCG22297, transcript variant mCT170505"
FT                   /note="gene_id=mCG22297.2 transcript_id=mCT170505.0 created
FT                   on 05-JUL-2002"
FT   mRNA            join(2897696..2897946,2929294..2929398,2929916..2930012,
FT                   2932015..2932123,2932970..2933134,2936207..2936384,
FT                   2939456..2939702,2940645..2940714,2947795..2947869,
FT                   2951765..2952051,2953424..2953628,2954525..2956203)
FT                   /locus_tag="mCG_22297"
FT                   /product="mCG22297, transcript variant mCT21118"
FT                   /note="gene_id=mCG22297.2 transcript_id=mCT21118.2 created
FT                   on 05-JUL-2002"
FT   CDS             join(2897906..2897946,2929294..2929398,2929916..2930012,
FT                   2932015..2932123,2932970..2933134,2936207..2936384,
FT                   2939456..2939702,2940645..2940714,2947795..2947869,
FT                   2951765..2952051,2953424..2953628,2954525..2954871)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22297"
FT                   /product="mCG22297, isoform CRA_b"
FT                   /note="gene_id=mCG22297.2 transcript_id=mCT21118.2
FT                   protein_id=mCP8414.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SUH6"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="InterPro:IPR030544"
FT                   /db_xref="MGI:MGI:2144243"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUH6"
FT                   /protein_id="EDL33834.1"
FT                   FANFSK"
FT   assembly_gap    2902841..2910838
FT                   /estimated_length=7998
FT                   /gap_type="unknown"
FT   assembly_gap    2913077..2913096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(2929307..2929398,2929916..2930012,2932015..2932123,
FT                   2932970..2933134,2936207..2936384,2939456..2939702,
FT                   2940645..2940714,2947795..2947869,2951765..2952051,
FT                   2953478..2953628,2954525..2954871)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22297"
FT                   /product="mCG22297, isoform CRA_a"
FT                   /note="gene_id=mCG22297.2 transcript_id=mCT170505.0
FT                   protein_id=mCP93423.0 isoform=CRA_a"
FT                   /protein_id="EDL33833.1"
FT   assembly_gap    2960616..2960635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2965096..2965555
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   gene            complement(2974268..2990587)
FT                   /gene="Lsm11"
FT                   /locus_tag="mCG_22299"
FT                   /note="gene_id=mCG22299.3"
FT   mRNA            complement(join(2974268..2977516,2979033..2979674,
FT                   2980072..2980155,2983010..2983149,2990113..2990587))
FT                   /gene="Lsm11"
FT                   /locus_tag="mCG_22299"
FT                   /product="U7 snRNP-specific Sm-like protein LSM11"
FT                   /note="gene_id=mCG22299.3 transcript_id=mCT21120.3 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(2979264..2979674,2980072..2980155,
FT                   2983010..2983149,2990113..2990563))
FT                   /codon_start=1
FT                   /gene="Lsm11"
FT                   /locus_tag="mCG_22299"
FT                   /product="U7 snRNP-specific Sm-like protein LSM11"
FT                   /note="gene_id=mCG22299.3 transcript_id=mCT21120.3
FT                   protein_id=mCP8426.2"
FT                   /db_xref="GOA:Q5SUH5"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="MGI:MGI:1919540"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUH5"
FT                   /protein_id="EDL33832.1"
FT   gene            complement(2992498..3001135)
FT                   /locus_tag="mCG_22296"
FT                   /note="gene_id=mCG22296.2"
FT   mRNA            complement(join(2992498..2993981,2995843..2995950,
FT                   2997190..2997278,2998383..2998552,2999704..2999880,
FT                   3000926..3001135))
FT                   /locus_tag="mCG_22296"
FT                   /product="mCG22296, transcript variant mCT21117"
FT                   /note="gene_id=mCG22296.2 transcript_id=mCT21117.2 created
FT                   on 05-JUL-2002"
FT   mRNA            complement(join(2992498..2993981,2995843..2995950,
FT                   2997190..2997278,2998383..2998552,2999704..2999880,
FT                   3000042..3000144,3000771..3000840))
FT                   /locus_tag="mCG_22296"
FT                   /product="mCG22296, transcript variant mCT170504"
FT                   /note="gene_id=mCG22296.2 transcript_id=mCT170504.0 created
FT                   on 05-JUL-2002"
FT   CDS             complement(join(2993820..2993981,2995843..2995950,
FT                   2997190..2997278,2998383..2998552,2999704..2999880,
FT                   3000926..3001116))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22296"
FT                   /product="mCG22296, isoform CRA_c"
FT                   /note="gene_id=mCG22296.2 transcript_id=mCT21117.2
FT                   protein_id=mCP8406.2 isoform=CRA_c"
FT                   /protein_id="EDL33831.1"
FT                   IGDAFWKEHPEILAEEN"
FT   CDS             complement(join(2993820..2993981,2995843..2995950,
FT                   2997190..2997278,2998383..2998552,2999704..2999880,
FT                   3000042..3000052))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22296"
FT                   /product="mCG22296, isoform CRA_b"
FT                   /note="gene_id=mCG22296.2 transcript_id=mCT170504.0
FT                   protein_id=mCP93421.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CQT0"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR024956"
FT                   /db_xref="InterPro:IPR025845"
FT                   /db_xref="MGI:MGI:1913878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CQT0"
FT                   /protein_id="EDL33830.1"
FT                   GDAFWKEHPEILAEEN"
FT   mRNA            complement(join(2996825..2997278,2998383..2998552,
FT                   2999704..2999880,3000042..3000144,3000259..3000327,
FT                   3000771..3000808))
FT                   /locus_tag="mCG_22296"
FT                   /product="mCG22296, transcript variant mCT170503"
FT                   /note="gene_id=mCG22296.2 transcript_id=mCT170503.0 created
FT                   on 05-JUL-2002"
FT   CDS             complement(join(2997184..2997278,2998383..2998552,
FT                   2999704..2999880,3000042..3000052))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22296"
FT                   /product="mCG22296, isoform CRA_a"
FT                   /note="gene_id=mCG22296.2 transcript_id=mCT170503.0
FT                   protein_id=mCP93422.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D999"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR024956"
FT                   /db_xref="InterPro:IPR025845"
FT                   /db_xref="MGI:MGI:1913878"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D999"
FT                   /protein_id="EDL33829.1"
FT   assembly_gap    3011209..3011264
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    3025939..3026166
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   gene            <3026234..>3037977
FT                   /gene="Sox30"
FT                   /locus_tag="mCG_12685"
FT                   /note="gene_id=mCG12685.2"
FT   mRNA            join(<3026234..3027239,3029184..3029423,3030582..3030761,
FT                   3037485..>3037977)
FT                   /gene="Sox30"
FT                   /locus_tag="mCG_12685"
FT                   /product="SRY-box containing gene 30"
FT                   /note="gene_id=mCG12685.2 transcript_id=mCT13446.2 created
FT                   on 05-JUL-2002"
FT   CDS             join(<3026234..3027239,3029184..3029423,3030582..3030761,
FT                   3037485..>3037977)
FT                   /codon_start=1
FT                   /gene="Sox30"
FT                   /locus_tag="mCG_12685"
FT                   /product="SRY-box containing gene 30"
FT                   /note="gene_id=mCG12685.2 transcript_id=mCT13446.2
FT                   protein_id=mCP8424.2"
FT                   /protein_id="EDL33828.1"
FT                   YFPS"
FT   assembly_gap    3053389..3073929
FT                   /estimated_length=20541
FT                   /gap_type="unknown"
FT   assembly_gap    3076340..3076359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3083660..3084950
FT                   /estimated_length=1291
FT                   /gap_type="unknown"
FT   assembly_gap    3088340..3091283
FT                   /estimated_length=2944
FT                   /gap_type="unknown"
FT   assembly_gap    3094071..3094090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3096419..3096564
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   gene            3099932..3191304
FT                   /gene="Adam19"
FT                   /locus_tag="mCG_12689"
FT                   /note="gene_id=mCG12689.2"
FT   mRNA            join(3099932..3100149,3105048..3105133,3109161..3109231,
FT                   3138073..3138151,3145963..3146039,3158867..3159059,
FT                   3159733..3159798,3164533..3164604,3167533..3167699,
FT                   3169206..3169290,3171132..3171271,3173370..3173547,
FT                   3174910..3174999,3177747..3177942,3180557..3180665,
FT                   3182375..3182588,3183495..3183572,3183671..3183779,
FT                   3184968..3185106,3185824..3185908,3186137..3186361,
FT                   3189050..3189202,3189923..3191304)
FT                   /gene="Adam19"
FT                   /locus_tag="mCG_12689"
FT                   /product="a disintegrin and metallopeptidase domain 19
FT                   (meltrin beta)"
FT                   /note="gene_id=mCG12689.2 transcript_id=mCT13450.2 created
FT                   on 18-NOV-2002"
FT   CDS             join(3100053..3100149,3105048..3105133,3109161..3109231,
FT                   3138073..3138151,3145963..3146039,3158867..3159059,
FT                   3159733..3159798,3164533..3164604,3167533..3167699,
FT                   3169206..3169290,3171132..3171271,3173370..3173547,
FT                   3174910..3174999,3177747..3177942,3180557..3180665,
FT                   3182375..3182588,3183495..3183572,3183671..3183779,
FT                   3184968..3185106,3185824..3185908,3186137..3186361,
FT                   3189050..3189202,3189923..3189976)
FT                   /codon_start=1
FT                   /gene="Adam19"
FT                   /locus_tag="mCG_12689"
FT                   /product="a disintegrin and metallopeptidase domain 19
FT                   (meltrin beta)"
FT                   /note="gene_id=mCG12689.2 transcript_id=mCT13450.2
FT                   protein_id=mCP8400.1"
FT                   /db_xref="GOA:Q3UHT3"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:105377"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UHT3"
FT                   /protein_id="EDL33827.1"
FT   assembly_gap    3108321..3108340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3112247..3112552
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    3116548..3116567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3119017..3119511
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    3121658..3121712
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    3143031..3143167
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    3191305..3191490
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            complement(<3196272..3213123)
FT                   /gene="9530066K23Rik"
FT                   /locus_tag="mCG_12683"
FT                   /note="gene_id=mCG12683.2"
FT   mRNA            complement(join(<3196272..3196900,3197387..3197547,
FT                   3200730..3200820,3202892..3202948,3208526..3208765,
FT                   3212996..3213123))
FT                   /gene="9530066K23Rik"
FT                   /locus_tag="mCG_12683"
FT                   /product="RIKEN cDNA 9530066K23"
FT                   /note="gene_id=mCG12683.2 transcript_id=mCT13443.2 created
FT                   on 05-JUL-2002"
FT   CDS             complement(join(3196272..3196900,3197387..3197547,
FT                   3200730..3200820,3202892..3202948,3208526..3208765,
FT                   3212996..3213038))
FT                   /codon_start=1
FT                   /gene="9530066K23Rik"
FT                   /locus_tag="mCG_12683"
FT                   /product="RIKEN cDNA 9530066K23"
FT                   /note="gene_id=mCG12683.2 transcript_id=mCT13443.2
FT                   protein_id=mCP8415.2"
FT                   /db_xref="GOA:Q8BZF2"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="MGI:MGI:2444671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BZF2"
FT                   /protein_id="EDL33826.1"
FT                   KVFMTDS"
FT   assembly_gap    3203288..3203307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3207262..3207857
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    3212476..3212495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3224617..3224636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3227755..3228285
FT                   /estimated_length=531
FT                   /gap_type="unknown"
FT   assembly_gap    3229336..3229355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3230915..3231333
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   gene            complement(3236489..3355194)
FT                   /gene="Cyfip2"
FT                   /locus_tag="mCG_12686"
FT                   /note="gene_id=mCG12686.2"
FT   mRNA            complement(join(3236489..3239100,3241637..3241784,
FT                   3243292..3243530,3250028..3250122,3250929..3251001,
FT                   3263995..3264125,3265269..3265359,3266722..3266865,
FT                   3282668..3282755,3285102..3285302,3290373..3290492,
FT                   3292544..3292652,3295418..3295494,3296761..3296857,
FT                   3297324..3297480,3300367..3300520,3303619..3303766,
FT                   3304256..3304422,3308729..3308854,3309535..3309654,
FT                   3313101..3313218,3315283..3315374,3317312..3317416,
FT                   3319692..3319820,3320972..3321068,3322865..3323046,
FT                   3327073..3327174,3328983..3329060,3332548..3332637,
FT                   3334429..3334568,3355128..3355194))
FT                   /gene="Cyfip2"
FT                   /locus_tag="mCG_12686"
FT                   /product="cytoplasmic FMR1 interacting protein 2"
FT                   /note="gene_id=mCG12686.2 transcript_id=mCT13447.2 created
FT                   on 06-FEB-2003"
FT   gene            <3278192..3281117
FT                   /locus_tag="mCG_51652"
FT                   /note="gene_id=mCG51652.2"
FT   mRNA            join(<3278192..3278258,3280321..3281117)
FT                   /locus_tag="mCG_51652"
FT                   /product="mCG51652"
FT                   /note="gene_id=mCG51652.2 transcript_id=mCT51835.2 created
FT                   on 05-JUL-2002"
FT   CDS             join(<3278193..3278258,3280321..3281001)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51652"
FT                   /product="mCG51652"
FT                   /note="gene_id=mCG51652.2 transcript_id=mCT51835.2
FT                   protein_id=mCP30760.2"
FT                   /protein_id="EDL33825.1"
FT   assembly_gap    3284663..3284872
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   CDS             complement(join(3285198..3285302,3290373..3290492,
FT                   3292544..3292652,3295418..3295494,3296761..3296857,
FT                   3297324..3297480,3300367..3300520,3303619..3303766,
FT                   3304256..3304422,3308729..3308854,3309535..3309654,
FT                   3313101..3313218,3315283..3315374,3317312..3317416,
FT                   3319692..3319820,3320972..3321068,3322865..3323046,
FT                   3327073..3327174,3328983..3329060,3332548..3332637,
FT                   3334429..3334545))
FT                   /codon_start=1
FT                   /gene="Cyfip2"
FT                   /locus_tag="mCG_12686"
FT                   /product="cytoplasmic FMR1 interacting protein 2"
FT                   /note="gene_id=mCG12686.2 transcript_id=mCT13447.2
FT                   protein_id=mCP8429.3"
FT                   /protein_id="EDL33823.1"
FT                   KHMTLDSFRCHVPRSQS"
FT   gene            complement(<3286386..>3287009)
FT                   /locus_tag="mCG_140646"
FT                   /note="gene_id=mCG140646.0"
FT   mRNA            complement(<3286386..>3287009)
FT                   /locus_tag="mCG_140646"
FT                   /product="mCG140646"
FT                   /note="gene_id=mCG140646.0 transcript_id=mCT170496.0
FT                   created on 03-JUL-2002"
FT   CDS             complement(3286386..3287009)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140646"
FT                   /product="mCG140646"
FT                   /note="gene_id=mCG140646.0 transcript_id=mCT170496.0
FT                   protein_id=mCP93414.0"
FT                   /protein_id="EDL33824.1"
FT   assembly_gap    3300319..3300338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3311579..3311598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3313664..3313865
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    3314969..3315253
FT                   /estimated_length=285
FT                   /gap_type="unknown"
FT   assembly_gap    3318506..3318525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3348566..3348744
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    3355292..3355451
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    3361665..3361799
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   gene            complement(3368117..3432401)
FT                   /gene="Itk"
FT                   /locus_tag="mCG_12690"
FT                   /note="gene_id=mCG12690.1"
FT   mRNA            complement(join(3368117..3370490,3374764..3374921,
FT                   3377808..3377926,3378011..3378075,3379282..3379498,
FT                   3381111..3381282,3383524..3383598,3383979..3384109,
FT                   3385372..3385454,3390844..3390898,3396776..3396841,
FT                   3398624..3398775,3403170..3403210,3406872..3407000,
FT                   3409052..3409151,3410907..3411011,3432174..3432401))
FT                   /gene="Itk"
FT                   /locus_tag="mCG_12690"
FT                   /product="IL2-inducible T-cell kinase, transcript variant
FT                   mCT13451"
FT                   /note="gene_id=mCG12690.1 transcript_id=mCT13451.1 created
FT                   on 03-JUL-2002"
FT   mRNA            complement(join(3368117..3370490,3374764..3374921,
FT                   3377808..3377926,3378011..3378075,3379282..3379498,
FT                   3381111..3381282,3383524..3383598,3383979..3384109,
FT                   3385372..3385454,3390844..3390898,3396776..3396841,
FT                   3398624..3398775,3403170..3403210,3406872..3407000,
FT                   3409052..3409133,3410907..3411011,3432174..>3432377))
FT                   /gene="Itk"
FT                   /locus_tag="mCG_12690"
FT                   /product="IL2-inducible T-cell kinase, transcript variant
FT                   mCT193129"
FT                   /note="gene_id=mCG12690.1 transcript_id=mCT193129.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3370419..3370490,3374764..3374921,
FT                   3377808..3377926,3378011..3378075,3379282..3379498,
FT                   3381111..3381282,3383524..3383598,3383979..3384109,
FT                   3385372..3385454,3390844..3390898,3396776..3396841,
FT                   3398624..3398775,3403170..3403210,3406872..3407000,
FT                   3409052..3409133,3410907..3411011,3432174..>3432344))
FT                   /codon_start=1
FT                   /gene="Itk"
FT                   /locus_tag="mCG_12690"
FT                   /product="IL2-inducible T-cell kinase, isoform CRA_b"
FT                   /note="gene_id=mCG12690.1 transcript_id=mCT193129.0
FT                   protein_id=mCP114080.0 isoform=CRA_b"
FT                   /protein_id="EDL33822.1"
FT   CDS             complement(join(3370419..3370490,3374764..3374921,
FT                   3377808..3377926,3378011..3378075,3379282..3379498,
FT                   3381111..3381282,3383524..3383598,3383979..3384109,
FT                   3385372..3385454,3390844..3390898,3396776..3396841,
FT                   3398624..3398775,3403170..3403210,3406872..3407000,
FT                   3409052..3409151,3410907..3411011,3432174..3432311))
FT                   /codon_start=1
FT                   /gene="Itk"
FT                   /locus_tag="mCG_12690"
FT                   /product="IL2-inducible T-cell kinase, isoform CRA_a"
FT                   /note="gene_id=mCG12690.1 transcript_id=mCT13451.1
FT                   protein_id=mCP8417.1 isoform=CRA_a"
FT                   /protein_id="EDL33821.1"
FT   assembly_gap    3380622..3380641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3403875..3404147
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    3437055..3437074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3447622..3450875
FT                   /gene="RP23-273O7.4"
FT                   /locus_tag="mCG_52652"
FT                   /note="gene_id=mCG52652.2"
FT   mRNA            join(<3447622..3448322,3449409..3449576,3449934..3450875)
FT                   /gene="RP23-273O7.4"
FT                   /locus_tag="mCG_52652"
FT                   /product="hypothetical protein LOC432552"
FT                   /note="gene_id=mCG52652.2 transcript_id=mCT52835.2 created
FT                   on 03-JUL-2002"
FT   CDS             join(<3447624..3448322,3449409..3449576,3449934..3450761)
FT                   /codon_start=1
FT                   /gene="RP23-273O7.4"
FT                   /locus_tag="mCG_52652"
FT                   /product="hypothetical protein LOC432552"
FT                   /note="gene_id=mCG52652.2 transcript_id=mCT52835.2
FT                   protein_id=mCP30770.2"
FT                   /protein_id="EDL33820.1"
FT   assembly_gap    3455890..3455909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3458374..3458393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3477915..3482489
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /note="gene_id=mCG12679.1"
FT   mRNA            join(3477915..3477973,3480770..3480939,3481525..3482489)
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, transcript variant mCT170495"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT170495.0 created
FT                   on 03-JUL-2002"
FT   mRNA            join(3477938..3477973,3481525..3482485)
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, transcript variant mCT170492"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT170492.0 created
FT                   on 03-JUL-2002"
FT   mRNA            join(3477941..3478155,3481525..3482485)
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, transcript variant mCT170493"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT170493.0 created
FT                   on 03-JUL-2002"
FT   mRNA            join(3477943..3478276,3480770..3480939,3481525..3482485)
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, transcript variant mCT170494"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT170494.0 created
FT                   on 03-JUL-2002"
FT   mRNA            join(3477945..3478155,3480770..3480939,3481525..3482485)
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, transcript variant mCT13440"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT13440.0 created
FT                   on 03-JUL-2002"
FT   CDS             3481542..3482243
FT                   /codon_start=1
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, isoform CRA_a"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT170492.0
FT                   protein_id=mCP93410.0 isoform=CRA_a"
FT                   /protein_id="EDL33815.1"
FT                   CVLIDEMNERP"
FT   CDS             3481542..3482243
FT                   /codon_start=1
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, isoform CRA_a"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT170493.0
FT                   protein_id=mCP93413.0 isoform=CRA_a"
FT                   /protein_id="EDL33816.1"
FT                   CVLIDEMNERP"
FT   CDS             3481542..3482243
FT                   /codon_start=1
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, isoform CRA_a"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT170494.0
FT                   protein_id=mCP93412.0 isoform=CRA_a"
FT                   /protein_id="EDL33817.1"
FT                   CVLIDEMNERP"
FT   CDS             3481542..3482243
FT                   /codon_start=1
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, isoform CRA_a"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT170495.0
FT                   protein_id=mCP93411.0 isoform=CRA_a"
FT                   /protein_id="EDL33818.1"
FT                   CVLIDEMNERP"
FT   CDS             3481542..3482243
FT                   /codon_start=1
FT                   /gene="Crsp9"
FT                   /locus_tag="mCG_12679"
FT                   /product="cofactor required for Sp1 transcriptional
FT                   activation, subunit 9, isoform CRA_a"
FT                   /note="gene_id=mCG12679.1 transcript_id=mCT13440.0
FT                   protein_id=mCP8432.1 isoform=CRA_a"
FT                   /protein_id="EDL33819.1"
FT                   CVLIDEMNERP"
FT   gene            complement(3490042..3492338)
FT                   /pseudo
FT                   /locus_tag="mCG_142505"
FT                   /note="gene_id=mCG142505.0"
FT   mRNA            complement(3490042..3492338)
FT                   /pseudo
FT                   /locus_tag="mCG_142505"
FT                   /note="gene_id=mCG142505.0 transcript_id=mCT180557.0
FT                   created on 13-FEB-2003"
FT   gene            3495892..3524032
FT                   /gene="Havcr2"
FT                   /locus_tag="mCG_51157"
FT                   /note="gene_id=mCG51157.2"
FT   mRNA            join(3495892..3496015,3497274..3497612,3500097..3500180,
FT                   3509621..3509661,3512207..3512333,3518656..3518692,
FT                   3522071..3524032)
FT                   /gene="Havcr2"
FT                   /locus_tag="mCG_51157"
FT                   /product="hepatitis A virus cellular receptor 2, transcript
FT                   variant mCT51340"
FT                   /note="gene_id=mCG51157.2 transcript_id=mCT51340.2 created
FT                   on 20-AUG-2002"
FT   mRNA            join(<3495924..3496015,3497274..3497302,3497450..3497612,
FT                   3500097..3500180,3509621..3509661,3512207..3512333,
FT                   3518656..3518692,3522071..>3522174)
FT                   /gene="Havcr2"
FT                   /locus_tag="mCG_51157"
FT                   /product="hepatitis A virus cellular receptor 2, transcript
FT                   variant mCT193130"
FT                   /note="gene_id=mCG51157.2 transcript_id=mCT193130.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3495925..3496015,3497274..3497302,3497450..3497612,
FT                   3500097..3500180,3509621..3509661,3512207..3512333,
FT                   3518656..3518692,3522071..>3522174)
FT                   /codon_start=1
FT                   /gene="Havcr2"
FT                   /locus_tag="mCG_51157"
FT                   /product="hepatitis A virus cellular receptor 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG51157.2 transcript_id=mCT193130.0
FT                   protein_id=mCP114100.0 isoform=CRA_a"
FT                   /protein_id="EDL33813.1"
FT                   NVY"
FT   CDS             join(3495958..3496015,3497274..3497612,3500097..3500180,
FT                   3509621..3509661,3512207..3512333,3518656..3518692,
FT                   3522071..3522230)
FT                   /codon_start=1
FT                   /gene="Havcr2"
FT                   /locus_tag="mCG_51157"
FT                   /product="hepatitis A virus cellular receptor 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG51157.2 transcript_id=mCT51340.2
FT                   protein_id=mCP30783.2 isoform=CRA_b"
FT                   /protein_id="EDL33814.1"
FT                   "
FT   assembly_gap    3496519..3496634
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    3506562..3506581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3507724..3507743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3508958..3508977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3514825..3514865
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    3527258..3527277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3532959..3532978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3536158..3539267
FT                   /estimated_length=3110
FT                   /gap_type="unknown"
FT   assembly_gap    3542771..3543130
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    3550238..3550935
FT                   /estimated_length=698
FT                   /gap_type="unknown"
FT   gene            3561363..3575500
FT                   /locus_tag="mCG_12681"
FT                   /note="gene_id=mCG12681.2"
FT   mRNA            join(3561363..3561475,3563361..3563418,3565521..3565859,
FT                   3570487..3570536,3572853..3572961,3573756..3573789,
FT                   3575181..3575500)
FT                   /locus_tag="mCG_12681"
FT                   /product="mCG12681"
FT                   /note="gene_id=mCG12681.2 transcript_id=mCT13442.2 created
FT                   on 03-JUL-2002"
FT   CDS             join(3563370..3563418,3565521..3565859,3570487..3570536,
FT                   3572853..3572961,3573756..3573789,3575181..3575352)
FT                   /codon_start=1
FT                   /locus_tag="mCG_12681"
FT                   /product="mCG12681"
FT                   /note="gene_id=mCG12681.2 transcript_id=mCT13442.2
FT                   protein_id=mCP8413.1"
FT                   /protein_id="EDL33812.1"
FT   assembly_gap    3569239..3569530
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    3570130..3570262
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    3580254..3580600
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   gene            3599310..3599883
FT                   /pseudo
FT                   /locus_tag="mCG_117154"
FT                   /note="gene_id=mCG117154.1"
FT   mRNA            3599310..3599883
FT                   /pseudo
FT                   /locus_tag="mCG_117154"
FT                   /note="gene_id=mCG117154.1 transcript_id=mCT118290.1
FT                   created on 03-JUL-2002"
FT   gene            3608882..3628161
FT                   /gene="BC053393"
FT                   /locus_tag="mCG_140645"
FT                   /note="gene_id=mCG140645.0"
FT   mRNA            join(3608882..3608968,3611845..3611902,3617604..3617942,
FT                   3623294..3623383,3625120..3625156,3626829..3628161)
FT                   /gene="BC053393"
FT                   /locus_tag="mCG_140645"
FT                   /product="cDNA sequence BC053393"
FT                   /note="gene_id=mCG140645.0 transcript_id=mCT170491.0
FT                   created on 03-JUL-2002"
FT   CDS             join(3611854..3611902,3617604..3617942,3623294..3623383,
FT                   3625120..3625156,3626829..3626892)
FT                   /codon_start=1
FT                   /gene="BC053393"
FT                   /locus_tag="mCG_140645"
FT                   /product="cDNA sequence BC053393"
FT                   /note="gene_id=mCG140645.0 transcript_id=mCT170491.0
FT                   protein_id=mCP93409.0"
FT                   /db_xref="GOA:A0A0B4J1F6"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:3039605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0B4J1F6"
FT                   /protein_id="EDL33811.1"
FT   assembly_gap    3616038..3616057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3619254..3619273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3620741..3621178
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    3628336..3628355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3629405..3629424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3638372..3638391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3640161..3641665
FT                   /estimated_length=1505
FT                   /gap_type="unknown"
FT   gene            complement(3648028..3668728)
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /note="gene_id=mCG12688.2"
FT   mRNA            complement(join(3648028..3648497,3649978..3650011,
FT                   3652452..3652563,3665011..3665068,3668676..3668728))
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /product="developmental pluripotency associated 1,
FT                   transcript variant mCT13449"
FT                   /note="gene_id=mCG12688.2 transcript_id=mCT13449.2 created
FT                   on 10-MAR-2003"
FT   mRNA            complement(join(3648028..3648497,3649978..3650011,
FT                   3652452..3652563,3655591..3655643,3665011..3665068,
FT                   3668676..3668727))
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /product="developmental pluripotency associated 1,
FT                   transcript variant mCT170498"
FT                   /note="gene_id=mCG12688.2 transcript_id=mCT170498.0 created
FT                   on 10-MAR-2003"
FT   mRNA            complement(join(3648028..3648497,3649978..3650011,
FT                   3652452..3652563,3655591..3655643,3665011..3665068,
FT                   3666360..3666445,3668676..3668727))
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /product="developmental pluripotency associated 1,
FT                   transcript variant mCT170497"
FT                   /note="gene_id=mCG12688.2 transcript_id=mCT170497.0 created
FT                   on 10-MAR-2003"
FT   mRNA            complement(join(3648384..3648497,3649978..3650011,
FT                   3652452..3652563,3655591..3655640,3665011..3665075))
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /product="developmental pluripotency associated 1,
FT                   transcript variant mCT181167"
FT                   /note="gene_id=mCG12688.2 transcript_id=mCT181167.0 created
FT                   on 10-MAR-2003"
FT   CDS             complement(join(3648395..3648497,3649978..3650011,
FT                   3652452..3652563,3655591..3655640,3665011..3665059))
FT                   /codon_start=1
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /product="developmental pluripotency associated 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG12688.2 transcript_id=mCT181167.0
FT                   protein_id=mCP104089.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TL00"
FT                   /db_xref="MGI:MGI:2157522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TL00"
FT                   /protein_id="EDL33810.1"
FT                   TVDIIKVPVAI"
FT   CDS             complement(join(3648395..3648497,3649978..3650011,
FT                   3652452..3652563,3655591..3655643,3665011..3665059))
FT                   /codon_start=1
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /product="developmental pluripotency associated 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG12688.2 transcript_id=mCT170497.0
FT                   protein_id=mCP93416.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q810Y7"
FT                   /db_xref="MGI:MGI:2157522"
FT                   /db_xref="UniProtKB/TrEMBL:Q810Y7"
FT                   /protein_id="EDL33808.1"
FT                   DTVDIIKVPVAI"
FT   CDS             complement(join(3648395..3648497,3649978..3650011,
FT                   3652452..3652563,3655591..3655643,3665011..3665059))
FT                   /codon_start=1
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /product="developmental pluripotency associated 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG12688.2 transcript_id=mCT170498.0
FT                   protein_id=mCP93415.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q810Y7"
FT                   /db_xref="MGI:MGI:2157522"
FT                   /db_xref="UniProtKB/TrEMBL:Q810Y7"
FT                   /protein_id="EDL33809.1"
FT                   DTVDIIKVPVAI"
FT   CDS             complement(join(3652523..3652563,3665011..3665059))
FT                   /codon_start=1
FT                   /gene="Dppa1"
FT                   /locus_tag="mCG_12688"
FT                   /product="developmental pluripotency associated 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG12688.2 transcript_id=mCT13449.2
FT                   protein_id=mCP8405.2 isoform=CRA_a"
FT                   /protein_id="EDL33807.1"
FT                   /translation="MMSLQVLISGLLLLLPGSDPNTTLPEDLH"
FT   assembly_gap    3671559..3671578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3677901..>3686363)
FT                   /locus_tag="mCG_1037731"
FT                   /note="gene_id=mCG1037731.1"
FT   mRNA            complement(join(3677901..3678975,3680502..3680538,
FT                   3681391..3681502,3682575..3682624,3686030..>3686363))
FT                   /locus_tag="mCG_1037731"
FT                   /product="mCG1037731"
FT                   /note="gene_id=mCG1037731.1 transcript_id=mCT155435.1
FT                   created on 03-JUL-2002"
FT   CDS             complement(join(3678837..3678975,3680502..3680538,
FT                   3681391..3681502,3682575..3682624,3686030..>3686186))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037731"
FT                   /product="mCG1037731"
FT                   /note="gene_id=mCG1037731.1 transcript_id=mCT155435.1
FT                   protein_id=mCP81073.1"
FT                   /protein_id="EDL33806.1"
FT                   A"
FT   assembly_gap    3692587..3692606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3695396..3695496
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    3696807..3696826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3698681..3699520
FT                   /locus_tag="mCG_12680"
FT                   /note="gene_id=mCG12680.1"
FT   mRNA            3698681..3699520
FT                   /locus_tag="mCG_12680"
FT                   /product="mCG12680"
FT                   /note="gene_id=mCG12680.1 transcript_id=mCT13441.1 created
FT                   on 02-JUL-2002"
FT   CDS             3698729..3699346
FT                   /codon_start=1
FT                   /locus_tag="mCG_12680"
FT                   /product="mCG12680"
FT                   /note="gene_id=mCG12680.1 transcript_id=mCT13441.1
FT                   protein_id=mCP8433.1"
FT                   /protein_id="EDL33805.1"
FT   assembly_gap    3699815..3710366
FT                   /estimated_length=10552
FT                   /gap_type="unknown"
FT   gene            complement(3715045..3752869)
FT                   /gene="Timd2"
FT                   /locus_tag="mCG_117139"
FT                   /note="gene_id=mCG117139.1"
FT   mRNA            complement(join(3715045..3716047,3721338..3721374,
FT                   3722234..3722345,3723210..3723259,3724677..3724745,
FT                   3727675..3727818,3731952..3732287,3734515..3734572,
FT                   3752710..3752869))
FT                   /gene="Timd2"
FT                   /locus_tag="mCG_117139"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   2, transcript variant mCT118284"
FT                   /note="gene_id=mCG117139.1 transcript_id=mCT118284.1
FT                   created on 02-JUL-2002"
FT   mRNA            complement(join(3715045..3716047,3721338..3721374,
FT                   3722234..3722345,3723210..3723259,3724677..3724745,
FT                   3727675..3727818,3731952..3732287,3734515..3734572,
FT                   3743472..3743537,3752710..3752868))
FT                   /gene="Timd2"
FT                   /locus_tag="mCG_117139"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   2, transcript variant mCT118279"
FT                   /note="gene_id=mCG117139.1 transcript_id=mCT118279.1
FT                   created on 02-JUL-2002"
FT   mRNA            complement(join(3715052..3716047,3721338..3721374,
FT                   3722234..3722341,3723206..3723259,3724677..3724745,
FT                   3727675..3727818,3731952..3732287,3734515..3734572,
FT                   3743472..3743746))
FT                   /gene="Timd2"
FT                   /locus_tag="mCG_117139"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   2, transcript variant mCT170490"
FT                   /note="gene_id=mCG117139.1 transcript_id=mCT170490.0
FT                   created on 02-JUL-2002"
FT   CDS             complement(join(3715927..3716047,3721338..3721374,
FT                   3722234..3722345,3723210..3723259,3724677..3724745,
FT                   3727675..3727818,3731952..3732287,3734515..3734563))
FT                   /codon_start=1
FT                   /gene="Timd2"
FT                   /locus_tag="mCG_117139"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG117139.1 transcript_id=mCT118279.1
FT                   protein_id=mCP80936.1 isoform=CRA_a"
FT                   /db_xref="GOA:A8C1R4"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:2159681"
FT                   /db_xref="UniProtKB/TrEMBL:A8C1R4"
FT                   /protein_id="EDL33802.1"
FT   CDS             complement(join(3715927..3716047,3721338..3721374,
FT                   3722234..3722345,3723210..3723259,3724677..3724745,
FT                   3727675..3727818,3731952..3732287,3734515..3734563))
FT                   /codon_start=1
FT                   /gene="Timd2"
FT                   /locus_tag="mCG_117139"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG117139.1 transcript_id=mCT118284.1
FT                   protein_id=mCP80947.1 isoform=CRA_a"
FT                   /db_xref="GOA:A8C1R4"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:2159681"
FT                   /db_xref="UniProtKB/TrEMBL:A8C1R4"
FT                   /protein_id="EDL33803.1"
FT   CDS             complement(join(3715927..3716047,3721338..3721374,
FT                   3722234..3722341,3723206..3723259,3724677..3724745,
FT                   3727675..3727818,3731952..3732287,3734515..3734563))
FT                   /codon_start=1
FT                   /gene="Timd2"
FT                   /locus_tag="mCG_117139"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG117139.1 transcript_id=mCT170490.0
FT                   protein_id=mCP93408.0 isoform=CRA_b"
FT                   /protein_id="EDL33804.1"
FT   assembly_gap    3741531..3741550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3743969..3743988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3745038..3745057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3763143..3763234
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    3767525..3768700
FT                   /estimated_length=1176
FT                   /gap_type="unknown"
FT   gene            3778704..3811156
FT                   /gene="Havcr1"
FT                   /locus_tag="mCG_117142"
FT                   /note="gene_id=mCG117142.2"
FT   mRNA            join(3778704..3778748,3789629..3789686,3790765..3791103,
FT                   3794595..3794753,3802961..3803010,3806111..3806222,
FT                   3807967..3808003,3810989..3811156)
FT                   /gene="Havcr1"
FT                   /locus_tag="mCG_117142"
FT                   /product="hepatitis A virus cellular receptor 1, transcript
FT                   variant mCT179836"
FT                   /note="gene_id=mCG117142.2 transcript_id=mCT179836.0
FT                   created on 06-FEB-2003"
FT   mRNA            join(3789629..3789686,3790765..3791103,3794595..3794753,
FT                   3798000..3798068,3802961..3803010,3806111..3806222,
FT                   3807967..3808003,3810989..3811156)
FT                   /gene="Havcr1"
FT                   /locus_tag="mCG_117142"
FT                   /product="hepatitis A virus cellular receptor 1, transcript
FT                   variant mCT118277"
FT                   /note="gene_id=mCG117142.2 transcript_id=mCT118277.2
FT                   created on 06-FEB-2003"
FT   CDS             join(3789638..3789686,3790765..3791103,3794595..3794753,
FT                   3798000..3798068,3802961..3803010,3806111..3806222,
FT                   3807967..3808003,3810989..3811091)
FT                   /codon_start=1
FT                   /gene="Havcr1"
FT                   /locus_tag="mCG_117142"
FT                   /product="hepatitis A virus cellular receptor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG117142.2 transcript_id=mCT118277.2
FT                   protein_id=mCP80931.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0A0MQ86"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:2159680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A0MQ86"
FT                   /protein_id="EDL33800.1"
FT   CDS             join(3789638..3789686,3790765..3791103,3794595..3794753,
FT                   3802961..3803010,3806111..3806222,3807967..3808003,
FT                   3810989..3811091)
FT                   /codon_start=1
FT                   /gene="Havcr1"
FT                   /locus_tag="mCG_117142"
FT                   /product="hepatitis A virus cellular receptor 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG117142.2 transcript_id=mCT179836.0
FT                   protein_id=mCP102758.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V033"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:2159680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V033"
FT                   /protein_id="EDL33801.1"
FT                   P"
FT   assembly_gap    3797495..3797514
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3798622..3798641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3815709..3815728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3834091..3834204
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            3843304..3884700
FT                   /gene="Timd4"
FT                   /locus_tag="mCG_140650"
FT                   /note="gene_id=mCG140650.0"
FT   mRNA            join(3843304..3843375,3847949..3848290,3850061..3850294,
FT                   3877426..3877472,3879660..3879768,3882545..3882584,
FT                   3883500..3884700)
FT                   /gene="Timd4"
FT                   /locus_tag="mCG_140650"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   4, transcript variant mCT170508"
FT                   /note="gene_id=mCG140650.0 transcript_id=mCT170508.0
FT                   created on 02-JUL-2002"
FT   mRNA            join(<3843318..3843375,3847949..3848290,3850061..3850294,
FT                   3851688..3851771,3852502..3852555,3877426..3877472,
FT                   3879660..3879747,3882545..3882584,3883500..>3883584)
FT                   /gene="Timd4"
FT                   /locus_tag="mCG_140650"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   4, transcript variant mCT193127"
FT                   /note="gene_id=mCG140650.0 transcript_id=mCT193127.0
FT                   created on 09-MAR-2004"
FT   CDS             join(3843318..3843375,3847949..3848290,3850061..3850294,
FT                   3851688..3851771,3852502..3852555,3877426..3877472,
FT                   3879660..3879747,3882545..3882584,3883500..3883584)
FT                   /codon_start=1
FT                   /gene="Timd4"
FT                   /locus_tag="mCG_140650"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   4, isoform CRA_b"
FT                   /note="gene_id=mCG140650.0 transcript_id=mCT193127.0
FT                   protein_id=mCP114087.0 isoform=CRA_b"
FT                   /protein_id="EDL33799.1"
FT                   FTL"
FT   CDS             join(3843318..3843375,3847949..3848290,3850061..3850294,
FT                   3877426..3877472,3879660..3879768,3882545..3882584,
FT                   3883500..3883584)
FT                   /codon_start=1
FT                   /gene="Timd4"
FT                   /locus_tag="mCG_140650"
FT                   /product="T-cell immunoglobulin and mucin domain containing
FT                   4, isoform CRA_a"
FT                   /note="gene_id=mCG140650.0 transcript_id=mCT170508.0
FT                   protein_id=mCP93426.0 isoform=CRA_a"
FT                   /protein_id="EDL33798.1"
FT   assembly_gap    3865126..3865145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3870161..3870180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3871463..3871482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3872651..3872670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3873840..3873859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3875029..3875048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3891371..3891437
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    3896625..3896781
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    3904117..3904279
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    3905896..3905915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3907978..3907997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3909583..3912261
FT                   /estimated_length=2679
FT                   /gap_type="unknown"
FT   gene            3913529..3913869
FT                   /pseudo
FT                   /locus_tag="mCG_140649"
FT                   /note="gene_id=mCG140649.0"
FT   mRNA            3913529..3913869
FT                   /pseudo
FT                   /locus_tag="mCG_140649"
FT                   /note="gene_id=mCG140649.0 transcript_id=mCT170507.0
FT                   created on 02-JUL-2002"
FT   assembly_gap    3918868..3918888
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    3935621..3935640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3935736..4680771)
FT                   /gene="Sgcd"
FT                   /locus_tag="mCG_140648"
FT                   /note="gene_id=mCG140648.1"
FT   mRNA            complement(join(3935736..3937452,4126363..4126435,
FT                   4169617..4169736,4176890..4176977,4403113..4403301,
FT                   4622043..4622203,4680688..4680771))
FT                   /gene="Sgcd"
FT                   /locus_tag="mCG_140648"
FT                   /product="sarcoglycan, delta (dystrophin-associated
FT                   glycoprotein), transcript variant mCT179858"
FT                   /note="gene_id=mCG140648.1 transcript_id=mCT179858.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(3937446..3937452,4126363..4126435,
FT                   4169617..4169736,4176890..4176977,4403113..4403301))
FT                   /codon_start=1
FT                   /gene="Sgcd"
FT                   /locus_tag="mCG_140648"
FT                   /product="sarcoglycan, delta (dystrophin-associated
FT                   glycoprotein), isoform CRA_b"
FT                   /note="gene_id=mCG140648.1 transcript_id=mCT179858.0
FT                   protein_id=mCP102780.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C8D9"
FT                   /db_xref="InterPro:IPR006875"
FT                   /db_xref="InterPro:IPR027661"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C8D9"
FT                   /protein_id="EDL33796.1"
FT   assembly_gap    3944299..3949390
FT                   /estimated_length=5092
FT                   /gap_type="unknown"
FT   assembly_gap    3950916..3950935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3952049..3953605
FT                   /estimated_length=1557
FT                   /gap_type="unknown"
FT   assembly_gap    3982327..3982346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3989312..3989347
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    3994373..3994447
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    3998893..3998954
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    4001878..4002222
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    4012130..4012149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4015849..4015868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4022414..4023066,4024441..4024564,
FT                   4126363..4126435,4169617..4169736,4176890..4176977,
FT                   4243050..4243151,4403113..4403301,4427182..4427451))
FT                   /gene="Sgcd"
FT                   /locus_tag="mCG_140648"
FT                   /product="sarcoglycan, delta (dystrophin-associated
FT                   glycoprotein), transcript variant mCT170506"
FT                   /note="gene_id=mCG140648.1 transcript_id=mCT170506.0
FT                   created on 06-FEB-2003"
FT   mRNA            complement(join(4022821..4023066,4024441..4024564,
FT                   4126363..4126435,4169617..4169736,4176890..4176977,
FT                   4403113..4403301,4427182..4427451))
FT                   /gene="Sgcd"
FT                   /locus_tag="mCG_140648"
FT                   /product="sarcoglycan, delta (dystrophin-associated
FT                   glycoprotein), transcript variant mCT179859"
FT                   /note="gene_id=mCG140648.1 transcript_id=mCT179859.0
FT                   created on 06-FEB-2003"
FT   CDS             complement(join(4022893..4023066,4024441..4024564,
FT                   4126363..4126435,4169617..4169736,4176890..4176977,
FT                   4403113..4403301))
FT                   /codon_start=1
FT                   /gene="Sgcd"
FT                   /locus_tag="mCG_140648"
FT                   /product="sarcoglycan, delta (dystrophin-associated
FT                   glycoprotein), isoform CRA_c"
FT                   /note="gene_id=mCG140648.1 transcript_id=mCT179859.0
FT                   protein_id=mCP102781.0 isoform=CRA_c"
FT                   /protein_id="EDL33797.1"
FT   CDS             complement(join(4022893..4023066,4024441..4024564,
FT                   4126363..4126435,4169617..4169736,4176890..4176977,
FT                   4243050..4243151,4403113..4403301))
FT                   /codon_start=1
FT                   /gene="Sgcd"
FT                   /locus_tag="mCG_140648"
FT                   /product="sarcoglycan, delta (dystrophin-associated
FT                   glycoprotein), isoform CRA_a"
FT                   /note="gene_id=mCG140648.1 transcript_id=mCT170506.0
FT                   protein_id=mCP93424.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544D4"
FT                   /db_xref="InterPro:IPR006875"
FT                   /db_xref="InterPro:IPR027661"
FT                   /db_xref="MGI:MGI:1346525"
FT                   /db_xref="UniProtKB/TrEMBL:Q544D4"
FT                   /protein_id="EDL33795.1"
FT                   QINTSVCL"
FT   assembly_gap    4085763..4085785
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    4116412..4116757
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    4135138..4135419
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    4158393..4159319
FT                   /estimated_length=927
FT                   /gap_type="unknown"
FT   assembly_gap    4167031..4167713
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   assembly_gap    4169305..4169324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4178814..4178833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4182092..4182111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4271255..4271420
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4299188..4299207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4301254..4301273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4334893..4334912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4458850..4459135
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    4462960..4463550
FT                   /estimated_length=591
FT                   /gap_type="unknown"
FT   assembly_gap    4467924..4478351
FT                   /estimated_length=10428
FT                   /gap_type="unknown"
FT   assembly_gap    4480678..4480697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4497880..4498229
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    4504786..4511141
FT                   /estimated_length=6356
FT                   /gap_type="unknown"
FT   assembly_gap    4540941..4540960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4554697..4555259
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    4573679..4573698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4584723..4584742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4665615..4665634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4747626..4747645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4770466..4770485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4775035..4775506
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    4791170..4791241
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    4805513..4805532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4809112..4809131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4817096..4817284
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    4822957..4822976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4840242..4842546
FT                   /estimated_length=2305
FT                   /gap_type="unknown"
FT   assembly_gap    4879656..4879706
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    4897182..4900831
FT                   /estimated_length=3650
FT                   /gap_type="unknown"
FT   assembly_gap    4902836..4902855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4938546..4938600
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5059348..5059367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5094379..5094398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5137771..5137841
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5143724..5143743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5163329..5163368
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5221577..5221596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5239368..5239887
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    5296350..5296369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5308987..5309006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5333000..5333277
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    5358084..5364544
FT                   /estimated_length=6461
FT                   /gap_type="unknown"
FT   assembly_gap    5369677..5369696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5403413..5403432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5412113..5415873
FT                   /estimated_length=3761
FT                   /gap_type="unknown"
FT   assembly_gap    5437582..5437607
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    5438814..5438833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5452008..5452027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5460069..5460312
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    5473564..5473666
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    5478499..5478657
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    5496372..5496391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5511033..5511052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5515359..5517919
FT                   /estimated_length=2561
FT                   /gap_type="unknown"
FT   assembly_gap    5564860..5564928
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    5570525..5570949
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   assembly_gap    5602079..5602225
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   gene            5610659..5611166
FT                   /pseudo
FT                   /locus_tag="mCG_19411"
FT                   /note="gene_id=mCG19411.2"
FT   mRNA            5610659..5611166
FT                   /pseudo
FT                   /locus_tag="mCG_19411"
FT                   /note="gene_id=mCG19411.2 transcript_id=mCT18575.2 created
FT                   on 02-JUL-2002"
FT   gene            5637481..>5638115
FT                   /locus_tag="mCG_19407"
FT                   /note="gene_id=mCG19407.2"
FT   mRNA            join(5637481..5637509,5637582..>5638115)
FT                   /locus_tag="mCG_19407"
FT                   /product="mCG19407"
FT                   /note="gene_id=mCG19407.2 transcript_id=mCT18571.2 created
FT                   on 02-JUL-2002"
FT   CDS             5637582..5638115
FT                   /codon_start=1
FT                   /locus_tag="mCG_19407"
FT                   /product="mCG19407"
FT                   /note="gene_id=mCG19407.2 transcript_id=mCT18571.2
FT                   protein_id=mCP8397.1"
FT                   /protein_id="EDL33794.1"
FT                   VLNPPGGKSSLSFY"
FT   assembly_gap    5667328..5668061
FT                   /estimated_length=734
FT                   /gap_type="unknown"
FT   assembly_gap    5675073..5675092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5705268..5705287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5707630..5707649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5731113..5732178
FT                   /estimated_length=1066
FT                   /gap_type="unknown"
FT   assembly_gap    5749476..5749495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5759658..5760752
FT                   /estimated_length=1095
FT                   /gap_type="unknown"
FT   gene            complement(5773808..5775063)
FT                   /pseudo
FT                   /locus_tag="mCG_19406"
FT                   /note="gene_id=mCG19406.1"
FT   mRNA            complement(join(5773808..5773944,5773961..5775063))
FT                   /pseudo
FT                   /locus_tag="mCG_19406"
FT                   /note="gene_id=mCG19406.1 transcript_id=mCT18570.2 created
FT                   on 02-JUL-2002"
FT   assembly_gap    5783363..5783840
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   gene            complement(5790015..5793167)
FT                   /locus_tag="mCG_19408"
FT                   /note="gene_id=mCG19408.1"
FT   mRNA            complement(join(5790015..5790074,5790919..5793167))
FT                   /locus_tag="mCG_19408"
FT                   /product="mCG19408"
FT                   /note="gene_id=mCG19408.1 transcript_id=mCT18573.0 created
FT                   on 02-JUL-2002"
FT   CDS             complement(5791171..5793018)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19408"
FT                   /product="mCG19408"
FT                   /note="gene_id=mCG19408.1 transcript_id=mCT18573.0
FT                   protein_id=mCP8411.1"
FT                   /protein_id="EDL33793.1"
FT   assembly_gap    5814298..5814317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5839303..5845663
FT                   /gene="Gnb2l1"
FT                   /locus_tag="mCG_19409"
FT                   /note="gene_id=mCG19409.1"
FT   mRNA            join(5839303..5839799,5840890..5841061,5841500..5841647,
FT                   5842631..5842726,5843085..5843195,5843383..5843523,
FT                   5844772..5844882,5845207..5845663)
FT                   /gene="Gnb2l1"
FT                   /locus_tag="mCG_19409"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta polypeptide 2 like 1, transcript variant mCT18572"
FT                   /note="gene_id=mCG19409.1 transcript_id=mCT18572.1 created
FT                   on 05-FEB-2003"
FT   mRNA            join(<5839593..5839799,5840890..5841647,5842631..5842726,
FT                   5843085..5843195,5843383..5843523,5844772..5844882,
FT                   5845207..5845312)
FT                   /gene="Gnb2l1"
FT                   /locus_tag="mCG_19409"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta polypeptide 2 like 1, transcript variant mCT193112"
FT                   /note="gene_id=mCG19409.1 transcript_id=mCT193112.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(5839610..5839799,5841595..5841647,5842631..5842726,
FT                   5843085..5843195,5843383..5843523,5844772..5844882,
FT                   5845207..>5845272)
FT                   /gene="Gnb2l1"
FT                   /locus_tag="mCG_19409"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta polypeptide 2 like 1, transcript variant mCT179868"
FT                   /note="gene_id=mCG19409.1 transcript_id=mCT179868.0 created
FT                   on 05-FEB-2003"
FT   CDS             join(5839691..5839799,5840890..5841061,5841500..5841647,
FT                   5842631..5842726,5843085..5843195,5843383..5843523,
FT                   5844772..5844882,5845207..5845272)
FT                   /codon_start=1
FT                   /gene="Gnb2l1"
FT                   /locus_tag="mCG_19409"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta polypeptide 2 like 1, isoform CRA_b"
FT                   /note="gene_id=mCG19409.1 transcript_id=mCT18572.1
FT                   protein_id=mCP8412.1 isoform=CRA_b"
FT                   /db_xref="GOA:P68040"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:101849"
FT                   /db_xref="UniProtKB/Swiss-Prot:P68040"
FT                   /protein_id="EDL33791.1"
FT   CDS             join(5839691..5839799,5841595..5841647,5842631..5842726,
FT                   5843085..5843195,5843383..5843523,5844772..5844882,
FT                   5845207..5845272)
FT                   /codon_start=1
FT                   /gene="Gnb2l1"
FT                   /locus_tag="mCG_19409"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta polypeptide 2 like 1, isoform CRA_a"
FT                   /note="gene_id=mCG19409.1 transcript_id=mCT179868.0
FT                   protein_id=mCP102790.0 isoform=CRA_a"
FT                   /protein_id="EDL33790.1"
FT                   VTIGTR"
FT   CDS             join(<5841378..5841647,5842631..5842726,5843085..5843195,
FT                   5843383..5843523,5844772..5844882,5845207..5845272)
FT                   /codon_start=1
FT                   /gene="Gnb2l1"
FT                   /locus_tag="mCG_19409"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   beta polypeptide 2 like 1, isoform CRA_c"
FT                   /note="gene_id=mCG19409.1 transcript_id=mCT193112.0
FT                   protein_id=mCP114096.0 isoform=CRA_c"
FT                   /protein_id="EDL33792.1"
FT   gene            complement(5845631..5855940)
FT                   /locus_tag="mCG_1051084"
FT                   /note="gene_id=mCG1051084.0"
FT   mRNA            complement(join(5845631..5847073,5847352..5847479,
FT                   5847692..5847714,5848277..5848507,5851527..5851622,
FT                   5855070..5855940))
FT                   /locus_tag="mCG_1051084"
FT                   /product="mCG1051084"
FT                   /note="gene_id=mCG1051084.0 transcript_id=mCT194873.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(5846472..5847073,5847352..5847479,
FT                   5847692..5847714,5848277..5848507,5851527..5851622,
FT                   5855070..5855882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051084"
FT                   /product="mCG1051084"
FT                   /note="gene_id=mCG1051084.0 transcript_id=mCT194873.0
FT                   protein_id=mCP115902.0"
FT                   /db_xref="GOA:Q5NCC3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:2384814"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5NCC3"
FT                   /protein_id="EDL33789.1"
FT   assembly_gap    5855941..5855969
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    5865110..5865303
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    5867889..5867908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5872791..5872810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5873964..5873983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5876821..5889962
FT                   /gene="Trim7"
FT                   /locus_tag="mCG_19414"
FT                   /note="gene_id=mCG19414.2"
FT   mRNA            join(5876821..5877395,5878187..5878835,5879284..5880752)
FT                   /gene="Trim7"
FT                   /locus_tag="mCG_19414"
FT                   /product="tripartite motif protein 7, transcript variant
FT                   mCT170500"
FT                   /note="gene_id=mCG19414.2 transcript_id=mCT170500.0 created
FT                   on 01-JUL-2002"
FT   mRNA            join(5876823..5877395,5878187..5878282,5884786..5885016,
FT                   5886865..5886887,5887375..5887490,5887923..5887979,
FT                   5888828..5889962)
FT                   /gene="Trim7"
FT                   /locus_tag="mCG_19414"
FT                   /product="tripartite motif protein 7, transcript variant
FT                   mCT18578"
FT                   /note="gene_id=mCG19414.2 transcript_id=mCT18578.1 created
FT                   on 01-JUL-2002"
FT   CDS             join(5876877..5877395,5878187..5878282,5884786..5885016,
FT                   5886865..5886887,5887375..5887490,5887923..5887979,
FT                   5888828..5889339)
FT                   /codon_start=1
FT                   /gene="Trim7"
FT                   /locus_tag="mCG_19414"
FT                   /product="tripartite motif protein 7, isoform CRA_b"
FT                   /note="gene_id=mCG19414.2 transcript_id=mCT18578.1
FT                   protein_id=mCP8442.2 isoform=CRA_b"
FT                   /protein_id="EDL33788.1"
FT                   "
FT   CDS             join(5876877..5877395,5878187..5878399)
FT                   /codon_start=1
FT                   /gene="Trim7"
FT                   /locus_tag="mCG_19414"
FT                   /product="tripartite motif protein 7, isoform CRA_a"
FT                   /note="gene_id=mCG19414.2 transcript_id=mCT170500.0
FT                   protein_id=mCP93418.0 isoform=CRA_a"
FT                   /db_xref="GOA:B2RR25"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR020457"
FT                   /db_xref="MGI:MGI:2137353"
FT                   /db_xref="UniProtKB/TrEMBL:B2RR25"
FT                   /protein_id="EDL33787.1"
FT   gene            complement(5904596..5910698)
FT                   /gene="Irgm"
FT                   /locus_tag="mCG_19410"
FT                   /note="gene_id=mCG19410.2"
FT   mRNA            complement(join(5904596..5906353,5910438..5910698))
FT                   /gene="Irgm"
FT                   /locus_tag="mCG_19410"
FT                   /product="immunity-related GTPase family, M, transcript
FT                   variant mCT170499"
FT                   /note="gene_id=mCG19410.2 transcript_id=mCT170499.0 created
FT                   on 01-JUL-2002"
FT   mRNA            complement(join(5904599..5906353,5907906..5908124,
FT                   5910438..5910690))
FT                   /gene="Irgm"
FT                   /locus_tag="mCG_19410"
FT                   /product="immunity-related GTPase family, M, transcript
FT                   variant mCT18574"
FT                   /note="gene_id=mCG19410.2 transcript_id=mCT18574.0 created
FT                   on 01-JUL-2002"
FT   CDS             complement(join(5905151..5906353,5907906..5907932))
FT                   /codon_start=1
FT                   /gene="Irgm"
FT                   /locus_tag="mCG_19410"
FT                   /product="immunity-related GTPase family, M, isoform CRA_b"
FT                   /note="gene_id=mCG19410.2 transcript_id=mCT18574.0
FT                   protein_id=mCP8423.1 isoform=CRA_b"
FT                   /protein_id="EDL33786.1"
FT                   LRDSIFPPQI"
FT   CDS             complement(5905151..5906332)
FT                   /codon_start=1
FT                   /gene="Irgm"
FT                   /locus_tag="mCG_19410"
FT                   /product="immunity-related GTPase family, M, isoform CRA_a"
FT                   /note="gene_id=mCG19410.2 transcript_id=mCT170499.0
FT                   protein_id=mCP93417.0 isoform=CRA_a"
FT                   /db_xref="GOA:J7NUP1"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030385"
FT                   /db_xref="MGI:MGI:107567"
FT                   /db_xref="UniProtKB/TrEMBL:J7NUP1"
FT                   /protein_id="EDL33785.1"
FT   assembly_gap    5907466..5907485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5915072..5915484
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    5919838..5919857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<5933587..5942659)
FT                   /gene="9930111J21Rik"
FT                   /locus_tag="mCG_114074"
FT                   /note="gene_id=mCG114074.1"
FT   mRNA            complement(join(<5933587..5935011,5942367..5942516,
FT                   5942628..5942659))
FT                   /gene="9930111J21Rik"
FT                   /locus_tag="mCG_114074"
FT                   /product="RIKEN cDNA 9930111J21, transcript variant
FT                   mCT115165"
FT                   /note="gene_id=mCG114074.1 transcript_id=mCT115165.1
FT                   created on 01-JUL-2002"
FT   CDS             complement(5933587..5934990)
FT                   /codon_start=1
FT                   /gene="9930111J21Rik"
FT                   /locus_tag="mCG_114074"
FT                   /product="RIKEN cDNA 9930111J21, isoform CRA_a"
FT                   /note="gene_id=mCG114074.1 transcript_id=mCT115165.1
FT                   protein_id=mCP80836.1 isoform=CRA_a"
FT                   /db_xref="GOA:J7P1W8"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030385"
FT                   /db_xref="UniProtKB/TrEMBL:J7P1W8"
FT                   /protein_id="EDL33783.1"
FT                   WGLSGETVT"
FT   mRNA            complement(join(<5934088..5934182,5940805..5940896,
FT                   5942367..5942516,5942628..5942659))
FT                   /gene="9930111J21Rik"
FT                   /locus_tag="mCG_114074"
FT                   /product="RIKEN cDNA 9930111J21, transcript variant
FT                   mCT170489"
FT                   /note="gene_id=mCG114074.1 transcript_id=mCT170489.0
FT                   created on 01-JUL-2002"
FT   CDS             complement(<5934088..5934156)
FT                   /codon_start=1
FT                   /gene="9930111J21Rik"
FT                   /locus_tag="mCG_114074"
FT                   /product="RIKEN cDNA 9930111J21, isoform CRA_b"
FT                   /note="gene_id=mCG114074.1 transcript_id=mCT170489.0
FT                   protein_id=mCP93407.0 isoform=CRA_b"
FT                   /protein_id="EDL33784.1"
FT                   /translation="MLKQKIWKESIMPRAWATIPSRG"
FT   assembly_gap    5940249..5940268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5945164..5967667)
FT                   /gene="RP23-14F5.8"
FT                   /locus_tag="mCG_53753"
FT                   /note="gene_id=mCG53753.2"
FT   mRNA            complement(join(5945164..5948985,5955684..5956890,
FT                   5967433..5967667))
FT                   /gene="RP23-14F5.8"
FT                   /locus_tag="mCG_53753"
FT                   /product="similar to T-cell specific GTPase"
FT                   /note="gene_id=mCG53753.2 transcript_id=mCT53936.2 created
FT                   on 01-JUL-2002"
FT   CDS             complement(join(5947663..5948985,5955684..5956868))
FT                   /codon_start=1
FT                   /gene="RP23-14F5.8"
FT                   /locus_tag="mCG_53753"
FT                   /product="similar to T-cell specific GTPase"
FT                   /note="gene_id=mCG53753.2 transcript_id=mCT53936.2
FT                   protein_id=mCP30787.2"
FT                   /db_xref="GOA:Q5NCB2"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030385"
FT                   /db_xref="MGI:MGI:3652173"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NCB2"
FT                   /protein_id="EDL33782.1"
FT   assembly_gap    5968044..5968261
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    5971368..5973850
FT                   /estimated_length=2483
FT                   /gap_type="unknown"
FT   assembly_gap    5976512..6052878
FT                   /estimated_length=76367
FT                   /gap_type="unknown"
FT   assembly_gap    6056974..6057293
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   gene            complement(6060984..6069850)
FT                   /gene="Tgtp"
FT                   /locus_tag="mCG_65051"
FT                   /note="gene_id=mCG65051.3"
FT   mRNA            complement(join(6060984..6063548,6067667..>6067911))
FT                   /gene="Tgtp"
FT                   /locus_tag="mCG_65051"
FT                   /product="T-cell specific GTPase, transcript variant
FT                   mCT193107"
FT                   /note="gene_id=mCG65051.3 transcript_id=mCT193107.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(6061922..6063548,6067667..6067815,
FT                   6069666..6069850))
FT                   /gene="Tgtp"
FT                   /locus_tag="mCG_65051"
FT                   /product="T-cell specific GTPase, transcript variant
FT                   mCT65234"
FT                   /note="gene_id=mCG65051.3 transcript_id=mCT65234.2 created
FT                   on 01-JUL-2002"
FT   CDS             complement(join(6062283..6063548,6067667..>6067735))
FT                   /codon_start=1
FT                   /gene="Tgtp"
FT                   /locus_tag="mCG_65051"
FT                   /product="T-cell specific GTPase, isoform CRA_a"
FT                   /note="gene_id=mCG65051.3 transcript_id=mCT193107.0
FT                   protein_id=mCP114101.0 isoform=CRA_a"
FT                   /protein_id="EDL33780.1"
FT   CDS             complement(6062283..6063530)
FT                   /codon_start=1
FT                   /gene="Tgtp"
FT                   /locus_tag="mCG_65051"
FT                   /product="T-cell specific GTPase, isoform CRA_b"
FT                   /note="gene_id=mCG65051.3 transcript_id=mCT65234.2
FT                   protein_id=mCP38180.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q62293"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030385"
FT                   /db_xref="MGI:MGI:3710083"
FT                   /db_xref="MGI:MGI:98734"
FT                   /db_xref="UniProtKB/TrEMBL:Q62293"
FT                   /protein_id="EDL33781.1"
FT                   KKVGPYISEPPEYWEA"
FT   assembly_gap    6068782..6068898
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    6084021..6084040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6095938..6116461
FT                   /gene="Ifi47"
FT                   /locus_tag="mCG_14415"
FT                   /note="gene_id=mCG14415.3"
FT   mRNA            join(6095938..6095963,6106354..6106464,6114792..6116382)
FT                   /gene="Ifi47"
FT                   /locus_tag="mCG_14415"
FT                   /product="interferon gamma inducible protein 47, transcript
FT                   variant mCT16805"
FT                   /note="gene_id=mCG14415.3 transcript_id=mCT16805.2 created
FT                   on 10-JUN-2003"
FT   assembly_gap    6100510..6100636
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   mRNA            join(6106020..6106464,6111080..6111289,6114792..6116313)
FT                   /gene="Ifi47"
FT                   /locus_tag="mCG_14415"
FT                   /product="interferon gamma inducible protein 47, transcript
FT                   variant mCT185270"
FT                   /note="gene_id=mCG14415.3 transcript_id=mCT185270.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(6106388..6106464,6113972..6114021,6114792..6116461)
FT                   /gene="Ifi47"
FT                   /locus_tag="mCG_14415"
FT                   /product="interferon gamma inducible protein 47, transcript
FT                   variant mCT185271"
FT                   /note="gene_id=mCG14415.3 transcript_id=mCT185271.0 created
FT                   on 10-JUN-2003"
FT   assembly_gap    6112563..6112669
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   CDS             6114811..6116073
FT                   /codon_start=1
FT                   /gene="Ifi47"
FT                   /locus_tag="mCG_14415"
FT                   /product="interferon gamma inducible protein 47, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14415.3 transcript_id=mCT16805.2
FT                   protein_id=mCP17424.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q61635"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030385"
FT                   /db_xref="MGI:MGI:99448"
FT                   /db_xref="UniProtKB/TrEMBL:Q61635"
FT                   /protein_id="EDL33777.1"
FT   CDS             6114811..6116073
FT                   /codon_start=1
FT                   /gene="Ifi47"
FT                   /locus_tag="mCG_14415"
FT                   /product="interferon gamma inducible protein 47, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14415.3 transcript_id=mCT185270.0
FT                   protein_id=mCP106529.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q61635"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030385"
FT                   /db_xref="MGI:MGI:99448"
FT                   /db_xref="UniProtKB/TrEMBL:Q61635"
FT                   /protein_id="EDL33778.1"
FT   CDS             6114811..6116073
FT                   /codon_start=1
FT                   /gene="Ifi47"
FT                   /locus_tag="mCG_14415"
FT                   /product="interferon gamma inducible protein 47, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14415.3 transcript_id=mCT185271.0
FT                   protein_id=mCP106528.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q61635"
FT                   /db_xref="InterPro:IPR007743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030385"
FT                   /db_xref="MGI:MGI:99448"
FT                   /db_xref="UniProtKB/TrEMBL:Q61635"
FT                   /protein_id="EDL33779.1"
FT   gene            complement(<6132181..>6133161)
FT                   /gene="Olfr1396"
FT                   /locus_tag="mCG_59720"
FT                   /note="gene_id=mCG59720.1"
FT   mRNA            complement(<6132181..>6133161)
FT                   /gene="Olfr1396"
FT                   /locus_tag="mCG_59720"
FT                   /product="olfactory receptor 1396"
FT                   /note="gene_id=mCG59720.1 transcript_id=mCT59903.1 created
FT                   on 01-JUL-2002"
FT   CDS             complement(6132181..6133161)
FT                   /codon_start=1
FT                   /gene="Olfr1396"
FT                   /locus_tag="mCG_59720"
FT                   /product="olfactory receptor 1396"
FT                   /note="gene_id=mCG59720.1 transcript_id=mCT59903.1
FT                   protein_id=mCP38194.1"
FT                   /db_xref="GOA:Q8VEY7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031230"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VEY7"
FT                   /protein_id="EDL33776.1"
FT   assembly_gap    6136536..6136555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6144419..6145439
FT                   /estimated_length=1021
FT                   /gap_type="unknown"
FT   gene            <6153676..>6154623
FT                   /locus_tag="mCG_51119"
FT                   /note="gene_id=mCG51119.1"
FT   mRNA            <6153676..>6154623
FT                   /locus_tag="mCG_51119"
FT                   /product="mCG51119"
FT                   /note="gene_id=mCG51119.1 transcript_id=mCT51302.1 created
FT                   on 01-JUL-2002"
FT   CDS             6153676..6154623
FT                   /codon_start=1
FT                   /locus_tag="mCG_51119"
FT                   /product="mCG51119"
FT                   /note="gene_id=mCG51119.1 transcript_id=mCT51302.1
FT                   protein_id=mCP38187.1"
FT                   /db_xref="GOA:Q8VGD6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VGD6"
FT                   /protein_id="EDL33775.1"
FT   assembly_gap    6160749..6160768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6167929..>6168882
FT                   /gene="Olfr1395"
FT                   /locus_tag="mCG_59721"
FT                   /note="gene_id=mCG59721.0"
FT   mRNA            <6167929..>6168882
FT                   /gene="Olfr1395"
FT                   /locus_tag="mCG_59721"
FT                   /product="olfactory receptor 1395"
FT                   /note="gene_id=mCG59721.0 transcript_id=mCT59904.0 created
FT                   on 01-JUL-2002"
FT   CDS             6167929..6168882
FT                   /codon_start=1
FT                   /gene="Olfr1395"
FT                   /locus_tag="mCG_59721"
FT                   /product="olfactory receptor 1395"
FT                   /note="gene_id=mCG59721.0 transcript_id=mCT59904.0
FT                   protein_id=mCP38195.0"
FT                   /db_xref="GOA:Q8VGD7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031229"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGD7"
FT                   /protein_id="EDL33774.1"
FT   gene            <6179610..>6180548
FT                   /gene="Olfr1394"
FT                   /locus_tag="mCG_55366"
FT                   /note="gene_id=mCG55366.1"
FT   mRNA            <6179610..>6180548
FT                   /gene="Olfr1394"
FT                   /locus_tag="mCG_55366"
FT                   /product="olfactory receptor 1394"
FT                   /note="gene_id=mCG55366.1 transcript_id=mCT55549.1 created
FT                   on 01-JUL-2002"
FT   CDS             6179610..6180548
FT                   /codon_start=1
FT                   /gene="Olfr1394"
FT                   /locus_tag="mCG_55366"
FT                   /product="olfactory receptor 1394"
FT                   /note="gene_id=mCG55366.1 transcript_id=mCT55549.1
FT                   protein_id=mCP38188.1"
FT                   /db_xref="GOA:Q8VET2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031228"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VET2"
FT                   /protein_id="EDL33773.1"
FT   gene            complement(6187677..6206689)
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /note="gene_id=mCG14417.3"
FT   mRNA            complement(join(6187677..6189258,6190191..6190217,
FT                   6192806..6192832,6193047..6193067,6194420..6194452,
FT                   6195162..6195290,6198313..6198594,6200139..6200486,
FT                   6202564..6202690,6206586..6206689))
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /product="RIKEN cDNA D330012D11, transcript variant
FT                   mCT16806"
FT                   /note="gene_id=mCG14417.3 transcript_id=mCT16806.3 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(6187677..6189285,6190191..6190217,
FT                   6192806..6192832,6193047..6193067,6194420..6194452,
FT                   6195162..6195290,6198313..6198594,6200139..6200486,
FT                   6202564..6202690,6206586..>6206670))
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /product="RIKEN cDNA D330012D11, transcript variant
FT                   mCT193124"
FT                   /note="gene_id=mCG14417.3 transcript_id=mCT193124.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(<6188648..6189258,6190191..6190217,
FT                   6192806..6192832,6194420..6194452,6195162..6195290,
FT                   6195348..6195650,6198313..6198594,6200139..6200486,
FT                   6202564..6202690,6206586..6206643))
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /product="RIKEN cDNA D330012D11, transcript variant
FT                   mCT185689"
FT                   /note="gene_id=mCG14417.3 transcript_id=mCT185689.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(6188648..6189285,6190191..6190217,
FT                   6192806..6192832,6193047..6193067,6194420..6194452,
FT                   6195162..6195290,6198313..6198594,6200139..6200486,
FT                   6202564..>6202672))
FT                   /codon_start=1
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /product="RIKEN cDNA D330012D11, isoform CRA_c"
FT                   /note="gene_id=mCG14417.3 transcript_id=mCT193124.0
FT                   protein_id=mCP114091.0 isoform=CRA_c"
FT                   /protein_id="EDL33771.1"
FT   CDS             complement(join(6188648..6189258,6190191..6190217,
FT                   6192806..6192832,6193047..6193067,6194420..6194452,
FT                   6195162..6195290,6198313..6198594,6200139..6200486,
FT                   6202564..6202669))
FT                   /codon_start=1
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /product="RIKEN cDNA D330012D11, isoform CRA_a"
FT                   /note="gene_id=mCG14417.3 transcript_id=mCT16806.3
FT                   protein_id=mCP17426.3 isoform=CRA_a"
FT                   /protein_id="EDL33769.1"
FT                   PAWAVNEAVS"
FT   CDS             complement(join(6188648..6189258,6190191..6190217,
FT                   6192806..6192832,6194420..6194452,6195162..6195290,
FT                   6195348..6195650,6198313..6198594,6200139..6200486,
FT                   6202564..6202669))
FT                   /codon_start=1
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /product="RIKEN cDNA D330012D11, isoform CRA_d"
FT                   /note="gene_id=mCG14417.3 transcript_id=mCT185689.0
FT                   protein_id=mCP106947.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q8BJE2"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013162"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:2442439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJE2"
FT                   /protein_id="EDL33772.1"
FT   mRNA            complement(join(6201895..6202320,6202564..6202690,
FT                   6206586..6206689))
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /product="RIKEN cDNA D330012D11, transcript variant
FT                   mCT170397"
FT                   /note="gene_id=mCG14417.3 transcript_id=mCT170397.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(6202301..6202320,6202564..6202669))
FT                   /codon_start=1
FT                   /gene="D330012D11Rik"
FT                   /locus_tag="mCG_14417"
FT                   /product="RIKEN cDNA D330012D11, isoform CRA_b"
FT                   /note="gene_id=mCG14417.3 transcript_id=mCT170397.0
FT                   protein_id=mCP93315.1 isoform=CRA_b"
FT                   /protein_id="EDL33770.1"
FT   assembly_gap    6215015..6216211
FT                   /estimated_length=1197
FT                   /gap_type="unknown"
FT   assembly_gap    6217495..6217711
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   gene            6222766..6238259
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /note="gene_id=mCG114070.1"
FT   mRNA            join(6222766..6223012,6232169..6232250,6233064..6233116,
FT                   6234538..6238259)
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /product="zinc finger protein 62, transcript variant
FT                   mCT115161"
FT                   /note="gene_id=mCG114070.1 transcript_id=mCT115161.1
FT                   created on 27-JUN-2002"
FT   mRNA            join(6222766..6223012,6232169..6232250,6233064..6233116,
FT                   6234029..6234128,6234538..6238257)
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /product="zinc finger protein 62, transcript variant
FT                   mCT170387"
FT                   /note="gene_id=mCG114070.1 transcript_id=mCT170387.0
FT                   created on 27-JUN-2002"
FT   mRNA            join(<6222800..6223016,6232169..6232250,6233064..6233116,
FT                   6234538..>6236325)
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /product="zinc finger protein 62, transcript variant
FT                   mCT193116"
FT                   /note="gene_id=mCG114070.1 transcript_id=mCT193116.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(6223793..6223949,6232169..6232250,6233064..6233116,
FT                   6234538..6238259)
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /product="zinc finger protein 62, transcript variant
FT                   mCT170386"
FT                   /note="gene_id=mCG114070.1 transcript_id=mCT170386.0
FT                   created on 27-JUN-2002"
FT   CDS             join(<6233068..6233116,6234538..>6236325)
FT                   /codon_start=1
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /product="zinc finger protein 62, isoform CRA_c"
FT                   /note="gene_id=mCG114070.1 transcript_id=mCT193116.0
FT                   protein_id=mCP114079.0 isoform=CRA_c"
FT                   /protein_id="EDL33768.1"
FT   CDS             join(6233116,6234538..6237281)
FT                   /codon_start=1
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /product="zinc finger protein 62, isoform CRA_a"
FT                   /note="gene_id=mCG114070.1 transcript_id=mCT115161.1
FT                   protein_id=mCP81094.1 isoform=CRA_a"
FT                   /protein_id="EDL33765.1"
FT   CDS             join(6233116,6234538..6237281)
FT                   /codon_start=1
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /product="zinc finger protein 62, isoform CRA_a"
FT                   /note="gene_id=mCG114070.1 transcript_id=mCT170386.0
FT                   protein_id=mCP93304.0 isoform=CRA_a"
FT                   /protein_id="EDL33766.1"
FT   CDS             6234558..6237281
FT                   /codon_start=1
FT                   /gene="Zfp62"
FT                   /locus_tag="mCG_114070"
FT                   /product="zinc finger protein 62, isoform CRA_b"
FT                   /note="gene_id=mCG114070.1 transcript_id=mCT170387.0
FT                   protein_id=mCP93305.0 isoform=CRA_b"
FT                   /protein_id="EDL33767.1"
FT   assembly_gap    6247800..6249828
FT                   /estimated_length=2029
FT                   /gap_type="unknown"
FT   gene            6263803..6282538
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /note="gene_id=mCG14414.2"
FT   mRNA            join(6263803..6263895,6264749..6264962,6271058..6271182,
FT                   6280079..6282530)
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /product="mannoside acetylglucosaminyltransferase 1,
FT                   transcript variant mCT170396"
FT                   /note="gene_id=mCG14414.2 transcript_id=mCT170396.0 created
FT                   on 27-JUN-2002"
FT   assembly_gap    6264963..6265281
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   mRNA            join(6270060..6270163,6271058..6271182,6280079..6282530)
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /product="mannoside acetylglucosaminyltransferase 1,
FT                   transcript variant mCT170394"
FT                   /note="gene_id=mCG14414.2 transcript_id=mCT170394.0 created
FT                   on 27-JUN-2002"
FT   mRNA            join(6270092..6270163,6280079..6282538)
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /product="mannoside acetylglucosaminyltransferase 1,
FT                   transcript variant mCT170395"
FT                   /note="gene_id=mCG14414.2 transcript_id=mCT170395.0 created
FT                   on 27-JUN-2002"
FT   mRNA            join(6270171..6270314,6271058..6271182,6280079..6282531)
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /product="mannoside acetylglucosaminyltransferase 1,
FT                   transcript variant mCT16804"
FT                   /note="gene_id=mCG14414.2 transcript_id=mCT16804.1 created
FT                   on 27-JUN-2002"
FT   CDS             6280200..6281543
FT                   /codon_start=1
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /product="mannoside acetylglucosaminyltransferase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14414.2 transcript_id=mCT16804.1
FT                   protein_id=mCP17423.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q544F0"
FT                   /db_xref="InterPro:IPR004139"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:96973"
FT                   /db_xref="UniProtKB/TrEMBL:Q544F0"
FT                   /protein_id="EDL33761.1"
FT   CDS             6280200..6281543
FT                   /codon_start=1
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /product="mannoside acetylglucosaminyltransferase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14414.2 transcript_id=mCT170394.0
FT                   protein_id=mCP93313.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544F0"
FT                   /db_xref="InterPro:IPR004139"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:96973"
FT                   /db_xref="UniProtKB/TrEMBL:Q544F0"
FT                   /protein_id="EDL33762.1"
FT   CDS             6280200..6281543
FT                   /codon_start=1
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /product="mannoside acetylglucosaminyltransferase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14414.2 transcript_id=mCT170395.0
FT                   protein_id=mCP93312.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544F0"
FT                   /db_xref="InterPro:IPR004139"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:96973"
FT                   /db_xref="UniProtKB/TrEMBL:Q544F0"
FT                   /protein_id="EDL33763.1"
FT   CDS             6280200..6281543
FT                   /codon_start=1
FT                   /gene="Mgat1"
FT                   /locus_tag="mCG_14414"
FT                   /product="mannoside acetylglucosaminyltransferase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14414.2 transcript_id=mCT170396.0
FT                   protein_id=mCP93314.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q544F0"
FT                   /db_xref="InterPro:IPR004139"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:96973"
FT                   /db_xref="UniProtKB/TrEMBL:Q544F0"
FT                   /protein_id="EDL33764.1"
FT   assembly_gap    6285167..6285456
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   gene            <6299599..>6300534
FT                   /locus_tag="mCG_1037712"
FT                   /note="gene_id=mCG1037712.1"
FT   mRNA            <6299599..>6300534
FT                   /locus_tag="mCG_1037712"
FT                   /product="mCG1037712"
FT                   /note="gene_id=mCG1037712.1 transcript_id=mCT155416.1
FT                   created on 27-JUN-2002"
FT   CDS             6299599..6300534
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037712"
FT                   /product="mCG1037712"
FT                   /note="gene_id=mCG1037712.1 transcript_id=mCT155416.1
FT                   protein_id=mCP81027.1"
FT                   /db_xref="GOA:Q8VFA7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031227"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFA7"
FT                   /protein_id="EDL33760.1"
FT   assembly_gap    6307099..6307339
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   gene            <6312854..>6313789
FT                   /locus_tag="mCG_140633"
FT                   /note="gene_id=mCG140633.0"
FT   mRNA            <6312854..>6313789
FT                   /locus_tag="mCG_140633"
FT                   /product="mCG140633"
FT                   /note="gene_id=mCG140633.0 transcript_id=mCT170405.0
FT                   created on 27-JUN-2002"
FT   CDS             6312854..6313789
FT                   /codon_start=1
FT                   /locus_tag="mCG_140633"
FT                   /product="mCG140633"
FT                   /note="gene_id=mCG140633.0 transcript_id=mCT170405.0
FT                   protein_id=mCP93322.0"
FT                   /db_xref="GOA:Q8VFA6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031226"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFA6"
FT                   /protein_id="EDL33759.1"
FT   gene            <6337078..>6338013
FT                   /locus_tag="mCG_140632"
FT                   /note="gene_id=mCG140632.0"
FT   mRNA            <6337078..>6338013
FT                   /locus_tag="mCG_140632"
FT                   /product="mCG140632"
FT                   /note="gene_id=mCG140632.0 transcript_id=mCT170404.0
FT                   created on 27-JUN-2002"
FT   CDS             6337078..6338013
FT                   /codon_start=1
FT                   /locus_tag="mCG_140632"
FT                   /product="mCG140632"
FT                   /note="gene_id=mCG140632.0 transcript_id=mCT170404.0
FT                   protein_id=mCP93323.0"
FT                   /protein_id="EDL33758.1"
FT   gene            <6346943..>6347878
FT                   /gene="Olfr1391"
FT                   /locus_tag="mCG_140631"
FT                   /note="gene_id=mCG140631.0"
FT   mRNA            <6346943..>6347878
FT                   /gene="Olfr1391"
FT                   /locus_tag="mCG_140631"
FT                   /product="olfactory receptor 1391"
FT                   /note="gene_id=mCG140631.0 transcript_id=mCT170407.0
FT                   created on 27-JUN-2002"
FT   CDS             6346943..6347878
FT                   /codon_start=1
FT                   /gene="Olfr1391"
FT                   /locus_tag="mCG_140631"
FT                   /product="olfactory receptor 1391"
FT                   /note="gene_id=mCG140631.0 transcript_id=mCT170407.0
FT                   protein_id=mCP93324.0"
FT                   /db_xref="GOA:Q8VFA4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031225"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFA4"
FT                   /protein_id="EDL33757.1"
FT   gene            <6360065..>6361000
FT                   /gene="Olfr1390"
FT                   /locus_tag="mCG_140630"
FT                   /note="gene_id=mCG140630.0"
FT   mRNA            <6360065..>6361000
FT                   /gene="Olfr1390"
FT                   /locus_tag="mCG_140630"
FT                   /product="olfactory receptor 1390"
FT                   /note="gene_id=mCG140630.0 transcript_id=mCT170406.0
FT                   created on 27-JUN-2002"
FT   CDS             6360065..6361000
FT                   /codon_start=1
FT                   /gene="Olfr1390"
FT                   /locus_tag="mCG_140630"
FT                   /product="olfactory receptor 1390"
FT                   /note="gene_id=mCG140630.0 transcript_id=mCT170406.0
FT                   protein_id=mCP93325.0"
FT                   /db_xref="GOA:Q8VGW9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031224"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGW9"
FT                   /protein_id="EDL33756.1"
FT   assembly_gap    6364313..6367063
FT                   /estimated_length=2751
FT                   /gap_type="unknown"
FT   assembly_gap    6368419..6368821
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    6384788..6384807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6403384..6403540
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    6410666..6410685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6449789..>6450724
FT                   /gene="Olfr1389"
FT                   /locus_tag="mCG_63854"
FT                   /note="gene_id=mCG63854.2"
FT   mRNA            <6449789..>6450724
FT                   /gene="Olfr1389"
FT                   /locus_tag="mCG_63854"
FT                   /product="olfactory receptor 1389"
FT                   /note="gene_id=mCG63854.2 transcript_id=mCT64037.2 created
FT                   on 27-JUN-2002"
FT   CDS             6449789..6450724
FT                   /codon_start=1
FT                   /gene="Olfr1389"
FT                   /locus_tag="mCG_63854"
FT                   /product="olfactory receptor 1389"
FT                   /note="gene_id=mCG63854.2 transcript_id=mCT64037.2
FT                   protein_id=mCP38186.2"
FT                   /db_xref="GOA:Q8VGX0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031223"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGX0"
FT                   /protein_id="EDL33755.1"
FT   gene            <6463164..>6464099
FT                   /gene="Olfr1388"
FT                   /locus_tag="mCG_53916"
FT                   /note="gene_id=mCG53916.1"
FT   mRNA            <6463164..>6464099
FT                   /gene="Olfr1388"
FT                   /locus_tag="mCG_53916"
FT                   /product="olfactory receptor 1388"
FT                   /note="gene_id=mCG53916.1 transcript_id=mCT54099.1 created
FT                   on 27-JUN-2002"
FT   CDS             6463164..6464099
FT                   /codon_start=1
FT                   /gene="Olfr1388"
FT                   /locus_tag="mCG_53916"
FT                   /product="olfactory receptor 1388"
FT                   /note="gene_id=mCG53916.1 transcript_id=mCT54099.1
FT                   protein_id=mCP38193.1"
FT                   /db_xref="GOA:Q8VFA3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031222"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFA3"
FT                   /protein_id="EDL33754.1"
FT   assembly_gap    6466816..6469935
FT                   /estimated_length=3120
FT                   /gap_type="unknown"
FT   gene            <6479010..>6479945
FT                   /gene="Olfr1387"
FT                   /locus_tag="mCG_140635"
FT                   /note="gene_id=mCG140635.0"
FT   mRNA            <6479010..>6479945
FT                   /gene="Olfr1387"
FT                   /locus_tag="mCG_140635"
FT                   /product="olfactory receptor 1387"
FT                   /note="gene_id=mCG140635.0 transcript_id=mCT170409.0
FT                   created on 27-JUN-2002"
FT   CDS             6479010..6479945
FT                   /codon_start=1
FT                   /gene="Olfr1387"
FT                   /locus_tag="mCG_140635"
FT                   /product="olfactory receptor 1387"
FT                   /note="gene_id=mCG140635.0 transcript_id=mCT170409.0
FT                   protein_id=mCP93327.0"
FT                   /db_xref="GOA:Q8VFA9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031221"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFA9"
FT                   /protein_id="EDL33753.1"
FT   assembly_gap    6484990..6486265
FT                   /estimated_length=1276
FT                   /gap_type="unknown"
FT   gene            <6489395..>6490324
FT                   /locus_tag="mCG_140634"
FT                   /note="gene_id=mCG140634.0"
FT   mRNA            <6489395..>6490324
FT                   /locus_tag="mCG_140634"
FT                   /product="mCG140634"
FT                   /note="gene_id=mCG140634.0 transcript_id=mCT170408.0
FT                   created on 27-JUN-2002"
FT   CDS             6489395..6490324
FT                   /codon_start=1
FT                   /locus_tag="mCG_140634"
FT                   /product="mCG140634"
FT                   /note="gene_id=mCG140634.0 transcript_id=mCT170408.0
FT                   protein_id=mCP93326.0"
FT                   /db_xref="GOA:Q7TQT0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031220"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQT0"
FT                   /protein_id="EDL33752.1"
FT   assembly_gap    6508925..6509019
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            <6512359..>6513288
FT                   /locus_tag="mCG_1037707"
FT                   /note="gene_id=mCG1037707.1"
FT   mRNA            <6512359..>6513288
FT                   /locus_tag="mCG_1037707"
FT                   /product="mCG1037707"
FT                   /note="gene_id=mCG1037707.1 transcript_id=mCT155411.1
FT                   created on 27-JUN-2002"
FT   CDS             6512359..6513288
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037707"
FT                   /product="mCG1037707"
FT                   /note="gene_id=mCG1037707.1 transcript_id=mCT155411.1
FT                   protein_id=mCP80910.1"
FT                   /db_xref="GOA:Q7TQT1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031219"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQT1"
FT                   /protein_id="EDL33751.1"
FT   gene            <6531464..>6532420
FT                   /locus_tag="mCG_1037706"
FT                   /note="gene_id=mCG1037706.0"
FT   mRNA            <6531464..>6532420
FT                   /locus_tag="mCG_1037706"
FT                   /product="mCG1037706"
FT                   /note="gene_id=mCG1037706.0 transcript_id=mCT155410.0
FT                   created on 27-JUN-2002"
FT   CDS             6531464..6532420
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037706"
FT                   /product="mCG1037706"
FT                   /note="gene_id=mCG1037706.0 transcript_id=mCT155410.0
FT                   protein_id=mCP80908.0"
FT                   /db_xref="GOA:Q8VFA8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031218"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFA8"
FT                   /protein_id="EDL33750.1"
FT   gene            <6541549..>6542484
FT                   /locus_tag="mCG_140628"
FT                   /note="gene_id=mCG140628.0"
FT   mRNA            <6541549..>6542484
FT                   /locus_tag="mCG_140628"
FT                   /product="mCG140628"
FT                   /note="gene_id=mCG140628.0 transcript_id=mCT170385.0
FT                   created on 27-JUN-2002"
FT   CDS             6541549..6542484
FT                   /codon_start=1
FT                   /locus_tag="mCG_140628"
FT                   /product="mCG140628"
FT                   /note="gene_id=mCG140628.0 transcript_id=mCT170385.0
FT                   protein_id=mCP93301.0"
FT                   /db_xref="GOA:Q7TQT2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031217"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQT2"
FT                   /protein_id="EDL33749.1"
FT   gene            <6553011..>6553946
FT                   /locus_tag="mCG_140627"
FT                   /note="gene_id=mCG140627.0"
FT   mRNA            <6553011..>6553946
FT                   /locus_tag="mCG_140627"
FT                   /product="mCG140627"
FT                   /note="gene_id=mCG140627.0 transcript_id=mCT170384.0
FT                   created on 27-JUN-2002"
FT   CDS             6553011..6553946
FT                   /codon_start=1
FT                   /locus_tag="mCG_140627"
FT                   /product="mCG140627"
FT                   /note="gene_id=mCG140627.0 transcript_id=mCT170384.0
FT                   protein_id=mCP93302.0"
FT                   /db_xref="GOA:Q7TQT3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031216"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQT3"
FT                   /protein_id="EDL33748.1"
FT   assembly_gap    6565886..6565970
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            <6569675..>6570610
FT                   /locus_tag="mCG_140626"
FT                   /note="gene_id=mCG140626.0"
FT   mRNA            <6569675..>6570610
FT                   /locus_tag="mCG_140626"
FT                   /product="mCG140626"
FT                   /note="gene_id=mCG140626.0 transcript_id=mCT170383.0
FT                   created on 27-JUN-2002"
FT   CDS             6569675..6570610
FT                   /codon_start=1
FT                   /locus_tag="mCG_140626"
FT                   /product="mCG140626"
FT                   /note="gene_id=mCG140626.0 transcript_id=mCT170383.0
FT                   protein_id=mCP93303.0"
FT                   /db_xref="GOA:Q7TQT4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031215"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQT4"
FT                   /protein_id="EDL33747.1"
FT   assembly_gap    6579001..6579111
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            <6582209..>6583144
FT                   /locus_tag="mCG_1037705"
FT                   /note="gene_id=mCG1037705.1"
FT   mRNA            <6582209..>6583144
FT                   /locus_tag="mCG_1037705"
FT                   /product="mCG1037705"
FT                   /note="gene_id=mCG1037705.1 transcript_id=mCT155409.1
FT                   created on 27-JUN-2002"
FT   CDS             6582209..6583144
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037705"
FT                   /product="mCG1037705"
FT                   /note="gene_id=mCG1037705.1 transcript_id=mCT155409.1
FT                   protein_id=mCP80907.1"
FT                   /db_xref="GOA:Q7TQT5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031214"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQT5"
FT                   /protein_id="EDL33746.1"
FT   assembly_gap    6606096..6606206
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    6607687..6613867
FT                   /estimated_length=6181
FT                   /gap_type="unknown"
FT   assembly_gap    6623096..6623115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6628392..6670880
FT                   /gene="Flt4"
FT                   /locus_tag="mCG_20801"
FT                   /note="gene_id=mCG20801.1"
FT   mRNA            join(6628392..6628493,6643354..6643450,6643936..6644180,
FT                   6644407..6644519,6644610..6644772,6644965..6645104,
FT                   6645378..6645546,6645829..6645946,6648978..6649132,
FT                   6649222..6649384,6650626..6650752,6651790..6651898,
FT                   6652633..6652995,6653296..6653442,6653540..6653601,
FT                   6654253..6654388,6654877..6654981,6655310..6655423,
FT                   6655634..6655722,6655853..6656003,6656437..6656531,
FT                   6656913..6657035,6658833..6658944,6660872..6660971,
FT                   6662086..6662191,6662935..6663083,6664542..6664662,
FT                   6666598..6666683,6669536..6670880)
FT                   /gene="Flt4"
FT                   /locus_tag="mCG_20801"
FT                   /product="FMS-like tyrosine kinase 4"
FT                   /note="gene_id=mCG20801.1 transcript_id=mCT20787.1 created
FT                   on 26-JUN-2002"
FT   CDS             join(6628436..6628493,6643354..6643450,6643936..6644180,
FT                   6644407..6644519,6644610..6644772,6644965..6645104,
FT                   6645378..6645546,6645829..6645946,6648978..6649132,
FT                   6649222..6649384,6650626..6650752,6651790..6651898,
FT                   6652633..6652995,6653296..6653442,6653540..6653601,
FT                   6654253..6654388,6654877..6654981,6655310..6655423,
FT                   6655634..6655722,6655853..6656003,6656437..6656531,
FT                   6656913..6657035,6658833..6658944,6660872..6660971,
FT                   6662086..6662191,6662935..6663083,6664542..6664662,
FT                   6666598..6666683,6669536..6669734)
FT                   /codon_start=1
FT                   /gene="Flt4"
FT                   /locus_tag="mCG_20801"
FT                   /product="FMS-like tyrosine kinase 4"
FT                   /note="gene_id=mCG20801.1 transcript_id=mCT20787.1
FT                   protein_id=mCP21782.2"
FT                   /protein_id="EDL33745.1"
FT   assembly_gap    6637686..6637705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6649787..6650111
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    6653602..6653899
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   gene            6682395..6683903
FT                   /gene="Scgb3a1"
FT                   /locus_tag="mCG_125225"
FT                   /note="gene_id=mCG125225.2"
FT   mRNA            join(6682395..6682500,6682804..6682908,6683155..6683390,
FT                   6683753..6683903)
FT                   /gene="Scgb3a1"
FT                   /locus_tag="mCG_125225"
FT                   /product="secretoglobin, family 3A, member 1, transcript
FT                   variant mCT179837"
FT                   /note="gene_id=mCG125225.2 transcript_id=mCT179837.0
FT                   created on 05-FEB-2003"
FT   mRNA            join(6682398..6682500,6683155..6683390,6683753..6683903)
FT                   /gene="Scgb3a1"
FT                   /locus_tag="mCG_125225"
FT                   /product="secretoglobin, family 3A, member 1, transcript
FT                   variant mCT126485"
FT                   /note="gene_id=mCG125225.2 transcript_id=mCT126485.1
FT                   created on 05-FEB-2003"
FT   CDS             join(6682446..6682500,6683155..6683390,6683753..6683776)
FT                   /codon_start=1
FT                   /gene="Scgb3a1"
FT                   /locus_tag="mCG_125225"
FT                   /product="secretoglobin, family 3A, member 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG125225.2 transcript_id=mCT126485.1
FT                   protein_id=mCP80883.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5NCL1"
FT                   /db_xref="MGI:MGI:1915912"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NCL1"
FT                   /protein_id="EDL33743.1"
FT                   "
FT   CDS             join(6682884..6682908,6683155..6683390,6683753..6683776)
FT                   /codon_start=1
FT                   /gene="Scgb3a1"
FT                   /locus_tag="mCG_125225"
FT                   /product="secretoglobin, family 3A, member 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG125225.2 transcript_id=mCT179837.0
FT                   protein_id=mCP102759.0 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:1915912"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CJC6"
FT                   /protein_id="EDL33744.1"
FT   gene            complement(6690507..6721472)
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /note="gene_id=mCG20800.2"
FT   mRNA            complement(join(6690507..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6703938,6704046..6704135,
FT                   6705630..6705715,6707948..6708134,6721357..6721472))
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   transcript variant mCT170401"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT170401.0 created
FT                   on 27-FEB-2003"
FT   mRNA            complement(join(6690507..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6704135,6705630..6705715,
FT                   6707948..6708134,6721357..6721472))
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   transcript variant mCT20786"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT20786.2 created
FT                   on 27-FEB-2003"
FT   mRNA            complement(join(6693496..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6703938,6704046..6704135,
FT                   6705630..6705715,6707948..6708041,6721348..6721472))
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   transcript variant mCT180815"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT180815.0 created
FT                   on 27-FEB-2003"
FT   mRNA            complement(join(6693496..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6703938,6704031..6704135,
FT                   6705630..6705715,6707948..6708134,6721357..>6721468))
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   transcript variant mCT180814"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT180814.0 created
FT                   on 27-FEB-2003"
FT   mRNA            complement(join(6693496..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6703938,6704046..6704135,
FT                   6705630..6705715,6707948..6708121,6721400..6721448))
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   transcript variant mCT180813"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT180813.0 created
FT                   on 27-FEB-2003"
FT   CDS             complement(join(6693976..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6703938,6704046..6704135,
FT                   6705630..6705715,6707948..6708134,6721357..6721468))
FT                   /codon_start=1
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT170401.0
FT                   protein_id=mCP93319.0 isoform=CRA_a"
FT                   /protein_id="EDL33737.1"
FT   CDS             complement(join(6693976..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6703938,6704031..6704135,
FT                   6705630..6705715,6707948..6708134,6721357..6721468))
FT                   /codon_start=1
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT180814.0
FT                   protein_id=mCP103736.0 isoform=CRA_c"
FT                   /protein_id="EDL33739.1"
FT   CDS             complement(join(6693976..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6703938,6704046..6704135,
FT                   6705630..6705715,6707948..6708041,6721348..6721468))
FT                   /codon_start=1
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT180815.0
FT                   protein_id=mCP103737.0 isoform=CRA_d"
FT                   /protein_id="EDL33740.1"
FT                   IHLPGRR"
FT   CDS             complement(join(6693976..6694188,6696083..6696285,
FT                   6698704..6698934,6699924..6700078,6700822..6700976,
FT                   6701908..6702065,6703870..6703938,6704046..6704135,
FT                   6705630..6705715,6707948..6707961))
FT                   /codon_start=1
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT180813.0
FT                   protein_id=mCP103735.0 isoform=CRA_b"
FT                   /protein_id="EDL33738.1"
FT   gene            complement(6697435..6697924)
FT                   /locus_tag="mCG_20799"
FT                   /note="gene_id=mCG20799.1"
FT   mRNA            complement(6697435..6697924)
FT                   /locus_tag="mCG_20799"
FT                   /product="mCG20799"
FT                   /note="gene_id=mCG20799.1 transcript_id=mCT20785.1 created
FT                   on 26-JUN-2002"
FT   CDS             complement(6697493..6697840)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20799"
FT                   /product="mCG20799"
FT                   /note="gene_id=mCG20799.1 transcript_id=mCT20785.1
FT                   protein_id=mCP21781.1"
FT                   /db_xref="GOA:Q58DZ3"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="MGI:MGI:98037"
FT                   /db_xref="UniProtKB/TrEMBL:Q58DZ3"
FT                   /protein_id="EDL33742.1"
FT                   IRSMPEQTGEK"
FT   CDS             complement(join(6704011..6704135,6705630..6705715,
FT                   6707948..6708134,6721357..6721468))
FT                   /codon_start=1
FT                   /gene="Cnot6"
FT                   /locus_tag="mCG_20800"
FT                   /product="CCR4-NOT transcription complex, subunit 6,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG20800.2 transcript_id=mCT20786.2
FT                   protein_id=mCP21784.2 isoform=CRA_e"
FT                   /protein_id="EDL33741.1"
FT                   SKWLFV"
FT   gene            6710554..7152167
FT                   /locus_tag="mCG_148148"
FT                   /note="gene_id=mCG148148.0"
FT   mRNA            join(6710554..6710585,7150478..7152167)
FT                   /locus_tag="mCG_148148"
FT                   /product="mCG148148"
FT                   /note="gene_id=mCG148148.0 transcript_id=mCT188411.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    6714685..6714782
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    6724532..6724620
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    6730540..6731450
FT                   /estimated_length=911
FT                   /gap_type="unknown"
FT   assembly_gap    6750492..6750808
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    6759586..6759646
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    6771076..6771194
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    6773033..6773052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6794801..6795033
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   gene            6795598..6795982
FT                   /pseudo
FT                   /locus_tag="mCG_55235"
FT                   /note="gene_id=mCG55235.2"
FT   mRNA            6795598..6795982
FT                   /pseudo
FT                   /locus_tag="mCG_55235"
FT                   /note="gene_id=mCG55235.2 transcript_id=mCT55418.1 created
FT                   on 26-JUN-2002"
FT   gene            <6813288..6857709
FT                   /gene="Gfpt2"
FT                   /locus_tag="mCG_20797"
FT                   /note="gene_id=mCG20797.2"
FT   mRNA            join(<6813288..6813342,6824051..6824158,6826794..6826892,
FT                   6828133..6828258,6830063..6830121,6830769..6830903,
FT                   6834379..6834440,6837679..6837758,6838236..6838353,
FT                   6842309..6842472,6842831..6842926,6843038..6843135,
FT                   6843429..6843549,6845841..6845999,6846229..6846343,
FT                   6848838..6848965,6851959..6852126,6854710..6854871,
FT                   6856819..6857709)
FT                   /gene="Gfpt2"
FT                   /locus_tag="mCG_20797"
FT                   /product="glutamine fructose-6-phosphate transaminase 2"
FT                   /note="gene_id=mCG20797.2 transcript_id=mCT20784.2 created
FT                   on 26-JUN-2002"
FT   CDS             join(<6813312..6813342,6824051..6824158,6826794..6826892,
FT                   6828133..6828258,6830063..6830121,6830769..6830903,
FT                   6834379..6834440,6837679..6837758,6838236..6838353,
FT                   6842309..6842472,6842831..6842926,6843038..6843135,
FT                   6843429..6843549,6845841..6845881)
FT                   /codon_start=1
FT                   /gene="Gfpt2"
FT                   /locus_tag="mCG_20797"
FT                   /product="glutamine fructose-6-phosphate transaminase 2"
FT                   /note="gene_id=mCG20797.2 transcript_id=mCT20784.2
FT                   protein_id=mCP21780.1"
FT                   /protein_id="EDL33736.1"
FT   assembly_gap    6858155..6858174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6865832..6905363
FT                   /gene="Mapk9"
FT                   /locus_tag="mCG_20796"
FT                   /note="gene_id=mCG20796.1"
FT   mRNA            join(6865832..6866027,6873139..6873334,6882496..6882625,
FT                   6885935..6885993,6888124..6888262,6891686..6891851,
FT                   6892788..6892859,6897183..6897365,6898654..6898778,
FT                   6900171..6900234,6901083..6901151,6902099..6905363)
FT                   /gene="Mapk9"
FT                   /locus_tag="mCG_20796"
FT                   /product="mitogen activated protein kinase 9, transcript
FT                   variant mCT20594"
FT                   /note="gene_id=mCG20796.1 transcript_id=mCT20594.2 created
FT                   on 05-FEB-2003"
FT   mRNA            join(6865832..6866027,6873139..6873334,6882496..6882625,
FT                   6885935..6885993,6888124..6888262,6891686..6891851,
FT                   6893216..6893287,6897183..6897365,6898654..6898778,
FT                   6900171..6900234,6901083..6901151,6902099..6905363)
FT                   /gene="Mapk9"
FT                   /locus_tag="mCG_20796"
FT                   /product="mitogen activated protein kinase 9, transcript
FT                   variant mCT170398"
FT                   /note="gene_id=mCG20796.1 transcript_id=mCT170398.1 created
FT                   on 05-FEB-2003"
FT   mRNA            join(6865832..6866027,6873139..6873334,6882496..6882625,
FT                   6885935..6885993,6888124..6888262,6891686..6892347)
FT                   /gene="Mapk9"
FT                   /locus_tag="mCG_20796"
FT                   /product="mitogen activated protein kinase 9, transcript
FT                   variant mCT170399"
FT                   /note="gene_id=mCG20796.1 transcript_id=mCT170399.1 created
FT                   on 05-FEB-2003"
FT   assembly_gap    6866031..6866148
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   CDS             join(6873213..6873334,6882496..6882625,6885935..6885993,
FT                   6888124..6888262,6891686..6891851,6892788..6892859,
FT                   6897183..6897365,6898654..6898778,6900171..6900234,
FT                   6901083..6901151,6902099..6902241)
FT                   /codon_start=1
FT                   /gene="Mapk9"
FT                   /locus_tag="mCG_20796"
FT                   /product="mitogen activated protein kinase 9, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG20796.1 transcript_id=mCT20594.2
FT                   protein_id=mCP21786.1 isoform=CRA_c"
FT                   /protein_id="EDL33735.1"
FT   CDS             join(6873213..6873334,6882496..6882625,6885935..6885993,
FT                   6888124..6888262,6891686..6891851,6893216..6893287,
FT                   6897183..6897365,6898654..6898778,6900171..6900234,
FT                   6901083..6901151,6902099..6902241)
FT                   /codon_start=1
FT                   /gene="Mapk9"
FT                   /locus_tag="mCG_20796"
FT                   /product="mitogen activated protein kinase 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG20796.1 transcript_id=mCT170398.1
FT                   protein_id=mCP93316.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5NCK8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008351"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346862"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NCK8"
FT                   /protein_id="EDL33733.1"
FT   CDS             join(6873213..6873334,6882496..6882625,6885935..6885993,
FT                   6888124..6888262,6891686..6891865)
FT                   /codon_start=1
FT                   /gene="Mapk9"
FT                   /locus_tag="mCG_20796"
FT                   /product="mitogen activated protein kinase 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG20796.1 transcript_id=mCT170399.1
FT                   protein_id=mCP93317.0 isoform=CRA_b"
FT                   /protein_id="EDL33734.1"
FT   assembly_gap    6917216..6917395
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            <6920757..6999837
FT                   /gene="Rasgef1c"
FT                   /locus_tag="mCG_20798"
FT                   /note="gene_id=mCG20798.3"
FT   mRNA            join(<6920757..6920892,6976691..6976873,6978257..6978394,
FT                   6980055..6980255,6980811..6980885,6986973..6987062,
FT                   6989111..6989213,6989659..6989738,6989821..6989916,
FT                   6990984..6991079,6995242..6995365,6998023..6998095,
FT                   6999110..6999837)
FT                   /gene="Rasgef1c"
FT                   /locus_tag="mCG_20798"
FT                   /product="RasGEF domain family, member 1C, transcript
FT                   variant mCT193105"
FT                   /note="gene_id=mCG20798.3 transcript_id=mCT193105.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<6920758..6920892,6976691..6976873,6978257..6978394,
FT                   6980055..6980255,6980811..6980885,6986973..6987062,
FT                   6989111..6989213,6989659..6989738,6989821..6989916,
FT                   6990984..6991079,6995242..6995365,6998023..6998095,
FT                   6999110..6999134)
FT                   /codon_start=1
FT                   /gene="Rasgef1c"
FT                   /locus_tag="mCG_20798"
FT                   /product="RasGEF domain family, member 1C, isoform CRA_b"
FT                   /note="gene_id=mCG20798.3 transcript_id=mCT193105.0
FT                   protein_id=mCP114097.0 isoform=CRA_b"
FT                   /protein_id="EDL33731.1"
FT                   ERWKSLRSSILGKT"
FT   mRNA            join(6920775..6920892,6976691..6976873,6977020..6977142,
FT                   6978257..6978394,6980055..6980255,6980811..6980885,
FT                   6986973..6987062,6989111..6989213,6989659..6989738,
FT                   6989821..6989916,6990984..6991079,6995242..6995365,
FT                   6998023..6998095,6999110..6999837)
FT                   /gene="Rasgef1c"
FT                   /locus_tag="mCG_20798"
FT                   /product="RasGEF domain family, member 1C, transcript
FT                   variant mCT20595"
FT                   /note="gene_id=mCG20798.3 transcript_id=mCT20595.2 created
FT                   on 26-JUN-2002"
FT   mRNA            join(6921084..6921581,6976691..6976873,6977020..6977142,
FT                   6978257..6978394,6980055..6980255,6980811..6980885,
FT                   6986973..6987062,6989111..6989213,6989659..6989738,
FT                   6989821..6989916,6990984..6991079,6995242..6995365,
FT                   6998023..6998095,6999110..6999837)
FT                   /gene="Rasgef1c"
FT                   /locus_tag="mCG_20798"
FT                   /product="RasGEF domain family, member 1C, transcript
FT                   variant mCT170400"
FT                   /note="gene_id=mCG20798.3 transcript_id=mCT170400.0 created
FT                   on 26-JUN-2002"
FT   CDS             join(6921579..6921581,6976691..6976873,6977020..6977142,
FT                   6978257..6978394,6980055..6980255,6980811..6980885,
FT                   6986973..6987062,6989111..6989213,6989659..6989738,
FT                   6989821..6989916,6990984..6991079,6995242..6995365,
FT                   6998023..6998095,6999110..6999134)
FT                   /codon_start=1
FT                   /gene="Rasgef1c"
FT                   /locus_tag="mCG_20798"
FT                   /product="RasGEF domain family, member 1C, isoform CRA_a"
FT                   /note="gene_id=mCG20798.3 transcript_id=mCT170400.0
FT                   protein_id=mCP93318.0 isoform=CRA_a"
FT                   /protein_id="EDL33730.1"
FT                   KSLRSSILGKT"
FT   assembly_gap    6926247..6930133
FT                   /estimated_length=3887
FT                   /gap_type="unknown"
FT   assembly_gap    6957176..6957195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6959312..6959331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(6976697..6976873,6977020..6977142,6978257..6978394,
FT                   6980055..6980255,6980811..6980885,6986973..6987062,
FT                   6989111..6989213,6989659..6989738,6989821..6989916,
FT                   6990984..6991079,6995242..6995365,6998023..6998095,
FT                   6999110..6999134)
FT                   /codon_start=1
FT                   /gene="Rasgef1c"
FT                   /locus_tag="mCG_20798"
FT                   /product="RasGEF domain family, member 1C, isoform CRA_c"
FT                   /note="gene_id=mCG20798.3 transcript_id=mCT20595.2
FT                   protein_id=mCP21783.2 isoform=CRA_c"
FT                   /protein_id="EDL33732.1"
FT                   RSSILGKT"
FT   assembly_gap    6981323..6981465
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    6987745..6987784
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    7003020..7003130
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    7009701..7009720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7045025..7124398
FT                   /gene="Rnf130"
FT                   /locus_tag="mCG_20802"
FT                   /note="gene_id=mCG20802.2"
FT   mRNA            join(<7045025..7045113,7072412..7072608,7090809..7091059,
FT                   7105379..7105450,7107017..7107099,7113362..7113458,
FT                   7115415..7115619,7118885..7118978,7124188..7124391)
FT                   /gene="Rnf130"
FT                   /locus_tag="mCG_20802"
FT                   /product="ring finger protein 130, transcript variant
FT                   mCT20788"
FT                   /note="gene_id=mCG20802.2 transcript_id=mCT20788.2 created
FT                   on 19-AUG-2002"
FT   mRNA            join(<7045060..7045113,7072412..7072608,7090809..7091059,
FT                   7105379..7105450,7107017..7107099,7113362..7113458,
FT                   7115415..7115619,7124188..7124398)
FT                   /gene="Rnf130"
FT                   /locus_tag="mCG_20802"
FT                   /product="ring finger protein 130, transcript variant
FT                   mCT170402"
FT                   /note="gene_id=mCG20802.2 transcript_id=mCT170402.0 created
FT                   on 19-AUG-2002"
FT   assembly_gap    7045114..7045829
FT                   /estimated_length=716
FT                   /gap_type="unknown"
FT   assembly_gap    7063650..7064076
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    7072154..7072219
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   CDS             join(<7072413..7072608,7090809..7091059,7105379..7105450,
FT                   7107017..7107099,7113362..7113458,7115415..7115619,
FT                   7118885..7118978,7124188..7124203)
FT                   /codon_start=1
FT                   /gene="Rnf130"
FT                   /locus_tag="mCG_20802"
FT                   /product="ring finger protein 130, isoform CRA_a"
FT                   /note="gene_id=mCG20802.2 transcript_id=mCT20788.2
FT                   protein_id=mCP21785.1 isoform=CRA_a"
FT                   /protein_id="EDL33728.1"
FT   CDS             join(<7072413..7072608,7090809..7091059,7105379..7105450,
FT                   7107017..7107099,7113362..7113458,7115415..7115619,
FT                   7124188..7124192)
FT                   /codon_start=1
FT                   /gene="Rnf130"
FT                   /locus_tag="mCG_20802"
FT                   /product="ring finger protein 130, isoform CRA_b"
FT                   /note="gene_id=mCG20802.2 transcript_id=mCT170402.0
FT                   protein_id=mCP93320.0 isoform=CRA_b"
FT                   /protein_id="EDL33729.1"
FT   assembly_gap    7134623..7134642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7144062..7145276)
FT                   /pseudo
FT                   /locus_tag="mCG_1037687"
FT                   /note="gene_id=mCG1037687.1"
FT   mRNA            complement(join(7144062..7145058,7145232..7145276))
FT                   /pseudo
FT                   /locus_tag="mCG_1037687"
FT                   /note="gene_id=mCG1037687.1 transcript_id=mCT155391.1
FT                   created on 26-JUN-2002"
FT   gene            <7148550..7190121
FT                   /locus_tag="mCG_67972"
FT                   /note="gene_id=mCG67972.3"
FT   mRNA            join(<7148550..7148712,7152981..7153091,7157539..7157657,
FT                   7162183..7162411,7163441..7163699,7165359..7165566,
FT                   7167040..7167252,7168657..7168818,7169260..7169410,
FT                   7169962..7170176,7172424..7172541,7174083..7174368,
FT                   7175755..7175884,7176000..7176098,7176981..7177049,
FT                   7178793..7179033,7179384..7179449,7181163..7181234,
FT                   7185506..7185562,7186033..7186139,7188041..>7188686)
FT                   /locus_tag="mCG_67972"
FT                   /product="mCG67972, transcript variant mCT193121"
FT                   /note="gene_id=mCG67972.3 transcript_id=mCT193121.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7148550..7148712,7152981..7153091,7157539..7157657,
FT                   7162183..7162411,7163441..7163699,7165359..7165566,
FT                   7167040..7167252,7168657..7168818,7169260..7169410,
FT                   7169962..7170176,7172424..7172541,7174083..7174368,
FT                   7175755..7175884,7176000..7176098,7176981..7177049,
FT                   7178793..7179033,7179384..7179449,7181163..7181234,
FT                   7185506..7185562,7186033..7186139,7188041..>7188686)
FT                   /codon_start=1
FT                   /locus_tag="mCG_67972"
FT                   /product="mCG67972, isoform CRA_b"
FT                   /note="gene_id=mCG67972.3 transcript_id=mCT193121.0
FT                   protein_id=mCP114105.0 isoform=CRA_b"
FT                   /protein_id="EDL33725.1"
FT                   NFFEKRVDIGLKIKD"
FT   mRNA            join(7148555..7148712,7152981..7153091,7157539..7157657,
FT                   7162183..7162411,7163441..7163699,7165359..7165566,
FT                   7167040..7167252,7168657..7168818,7169260..7169410,
FT                   7169962..7170176,7172424..7172541,7174083..7174368,
FT                   7175755..7175884,7176000..7176098,7176981..7177049,
FT                   7178793..7179033,7179384..7179449,7181163..7181234,
FT                   7181500..7181550,7185506..7185562,7186033..7186139,
FT                   7188041..7190121)
FT                   /locus_tag="mCG_67972"
FT                   /product="mCG67972, transcript variant mCT68131"
FT                   /note="gene_id=mCG67972.3 transcript_id=mCT68131.2 created
FT                   on 26-JUN-2002"
FT   mRNA            join(7148556..7148712,7152981..7153091,7162183..7162411,
FT                   7163441..7163699,7165359..7165566,7167040..7167252,
FT                   7168657..7168818,7169260..7169410,7169962..7170176,
FT                   7172424..7172541,7174083..7174368,7175755..7175884,
FT                   7176000..7176098,7176981..7177049,7178793..7179033,
FT                   7179384..7179449,7181163..7181234,7186033..7186139,
FT                   7188041..7190102)
FT                   /locus_tag="mCG_67972"
FT                   /product="mCG67972, transcript variant mCT170416"
FT                   /note="gene_id=mCG67972.3 transcript_id=mCT170416.0 created
FT                   on 26-JUN-2002"
FT   CDS             join(7148595..7148712,7152981..7153091,7157539..7157657,
FT                   7162183..7162411,7163441..7163699,7165359..7165566,
FT                   7167040..7167252,7168657..7168818,7169260..7169410,
FT                   7169962..7170176,7172424..7172541,7174083..7174368,
FT                   7175755..7175884,7176000..7176098,7176981..7177049,
FT                   7178793..7179033,7179384..7179449,7181163..7181234,
FT                   7181500..7181550,7185506..7185562,7186033..7186139,
FT                   7188041..7188751)
FT                   /codon_start=1
FT                   /locus_tag="mCG_67972"
FT                   /product="mCG67972, isoform CRA_c"
FT                   /note="gene_id=mCG67972.3 transcript_id=mCT68131.2
FT                   protein_id=mCP41834.2 isoform=CRA_c"
FT                   /protein_id="EDL33726.1"
FT   CDS             7151904..7152095
FT                   /codon_start=1
FT                   /locus_tag="mCG_148148"
FT                   /product="mCG148148"
FT                   /note="gene_id=mCG148148.0 transcript_id=mCT188411.0
FT                   protein_id=mCP108593.0"
FT                   /protein_id="EDL33727.1"
FT                   NKIVIKDKVCKLSILTYW"
FT   CDS             join(7162264..7162411,7163441..7163699,7165359..7165566,
FT                   7167040..7167252,7168657..7168818,7169260..7169410,
FT                   7169962..7170176,7172424..7172541,7174083..7174368,
FT                   7175755..7175884,7176000..7176098,7176981..7177049,
FT                   7178793..7179033,7179384..7179449,7181163..7181234,
FT                   7186033..7186139,7188041..7188751)
FT                   /codon_start=1
FT                   /locus_tag="mCG_67972"
FT                   /product="mCG67972, isoform CRA_a"
FT                   /note="gene_id=mCG67972.3 transcript_id=mCT170416.0
FT                   protein_id=mCP93334.0 isoform=CRA_a"
FT                   /protein_id="EDL33724.1"
FT   assembly_gap    7162622..7162888
FT                   /estimated_length=267
FT                   /gap_type="unknown"
FT   assembly_gap    7187752..7187772
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            7191785..7218704
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /note="gene_id=mCG67970.3"
FT   mRNA            join(7191785..7191891,7194171..7194230,7195020..7195246)
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /product="RIKEN cDNA 3010026O09, transcript variant
FT                   mCT170413"
FT                   /note="gene_id=mCG67970.3 transcript_id=mCT170413.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(7191807..7191891,7194171..7194230,7195020..7195069)
FT                   /codon_start=1
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /product="RIKEN cDNA 3010026O09, isoform CRA_a"
FT                   /note="gene_id=mCG67970.3 transcript_id=mCT170413.0
FT                   protein_id=mCP93331.0 isoform=CRA_a"
FT                   /protein_id="EDL33720.1"
FT   mRNA            join(7192161..7192295,7194171..7194230,7199836..7199924,
FT                   7211569..7211644,7214341..7214489,7215016..7215100,
FT                   7216933..7218704)
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /product="RIKEN cDNA 3010026O09, transcript variant
FT                   mCT68129"
FT                   /note="gene_id=mCG67970.3 transcript_id=mCT68129.2 created
FT                   on 12-JUN-2003"
FT   mRNA            join(7192161..7192295,7194171..7194230,7199836..7199924,
FT                   7211569..7211644,7214341..7214438,7217051..7217506)
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /product="RIKEN cDNA 3010026O09, transcript variant
FT                   mCT185615"
FT                   /note="gene_id=mCG67970.3 transcript_id=mCT185615.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(7192161..7192295,7194171..7194230,7199836..7199924,
FT                   7204904..7205023,7211569..7211644,7214341..7214421)
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /product="RIKEN cDNA 3010026O09, transcript variant
FT                   mCT179887"
FT                   /note="gene_id=mCG67970.3 transcript_id=mCT179887.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(7192230..7192295,7194171..7194230,7199836..7199924,
FT                   7211569..7211644,7214341..7214489,7215016..7215100,
FT                   7216933..7217415)
FT                   /codon_start=1
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /product="RIKEN cDNA 3010026O09, isoform CRA_c"
FT                   /note="gene_id=mCG67970.3 transcript_id=mCT68129.2
FT                   protein_id=mCP41853.0 isoform=CRA_c"
FT                   /protein_id="EDL33722.1"
FT   CDS             join(7192230..7192295,7194171..7194230,7199836..7199924,
FT                   7211569..7211644,7214341..7214438,7217051..7217054)
FT                   /codon_start=1
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /product="RIKEN cDNA 3010026O09, isoform CRA_d"
FT                   /note="gene_id=mCG67970.3 transcript_id=mCT185615.0
FT                   protein_id=mCP106873.0 isoform=CRA_d"
FT                   /protein_id="EDL33723.1"
FT   CDS             join(7192230..7192295,7194171..7194230,7199836..7199924,
FT                   7204904..7205021)
FT                   /codon_start=1
FT                   /gene="3010026O09Rik"
FT                   /locus_tag="mCG_67970"
FT                   /product="RIKEN cDNA 3010026O09, isoform CRA_b"
FT                   /note="gene_id=mCG67970.3 transcript_id=mCT179887.1
FT                   protein_id=mCP102809.0 isoform=CRA_b"
FT                   /protein_id="EDL33721.1"
FT                   LPGGAQ"
FT   assembly_gap    7201197..7201216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7212977..7213161
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   gene            complement(7217549..>7228187)
FT                   /gene="Sqstm1"
FT                   /locus_tag="mCG_67971"
FT                   /note="gene_id=mCG67971.1"
FT   mRNA            complement(join(7217549..7218342,7219792..7219991,
FT                   7220211..7220431,7223420..7223500,7224557..7224698,
FT                   7224804..7225033,7225218..7225313,7227950..>7228187))
FT                   /gene="Sqstm1"
FT                   /locus_tag="mCG_67971"
FT                   /product="sequestosome 1, transcript variant mCT68130"
FT                   /note="gene_id=mCG67971.1 transcript_id=mCT68130.1 created
FT                   on 26-JUN-2002"
FT   mRNA            complement(join(7217549..7218342,7219792..7219991,
FT                   7220211..7220431,7223420..7223500,7224557..7224698,
FT                   7224804..7225033,7227994..7228183))
FT                   /gene="Sqstm1"
FT                   /locus_tag="mCG_67971"
FT                   /product="sequestosome 1, transcript variant mCT170415"
FT                   /note="gene_id=mCG67971.1 transcript_id=mCT170415.0 created
FT                   on 26-JUN-2002"
FT   mRNA            complement(join(7217756..7218344,7219910..7219991,
FT                   7220211..7220431,7223420..7223500,7224557..7224698,
FT                   7224804..7225033,7225218..7225313,7227950..7228183))
FT                   /gene="Sqstm1"
FT                   /locus_tag="mCG_67971"
FT                   /product="sequestosome 1, transcript variant mCT170414"
FT                   /note="gene_id=mCG67971.1 transcript_id=mCT170414.0 created
FT                   on 26-JUN-2002"
FT   CDS             complement(join(7218187..7218344,7219910..7219991,
FT                   7220211..7220431,7223420..7223500,7224557..7224698,
FT                   7224804..7225033,7225218..7225313,7227950..7228154))
FT                   /codon_start=1
FT                   /gene="Sqstm1"
FT                   /locus_tag="mCG_67971"
FT                   /product="sequestosome 1, isoform CRA_c"
FT                   /note="gene_id=mCG67971.1 transcript_id=mCT170414.0
FT                   protein_id=mCP93332.0 isoform=CRA_c"
FT                   /protein_id="EDL33719.1"
FT                   HPPPL"
FT   CDS             complement(join(7218327..7218342,7219792..7219991,
FT                   7220211..7220431,7223420..7223500,7224557..7224698,
FT                   7224804..7225033,7225218..7225313,7227950..>7228163))
FT                   /codon_start=1
FT                   /gene="Sqstm1"
FT                   /locus_tag="mCG_67971"
FT                   /product="sequestosome 1, isoform CRA_b"
FT                   /note="gene_id=mCG67971.1 transcript_id=mCT68130.1
FT                   protein_id=mCP41856.1 isoform=CRA_b"
FT                   /protein_id="EDL33718.1"
FT                   "
FT   CDS             complement(join(7218327..7218342,7219792..7219991,
FT                   7220211..7220431,7223420..7223500,7224557..7224698,
FT                   7224804..7224974))
FT                   /codon_start=1
FT                   /gene="Sqstm1"
FT                   /locus_tag="mCG_67971"
FT                   /product="sequestosome 1, isoform CRA_a"
FT                   /note="gene_id=mCG67971.1 transcript_id=mCT170415.0
FT                   protein_id=mCP93333.0 isoform=CRA_a"
FT                   /protein_id="EDL33717.1"
FT   gene            7228151..7252669
FT                   /gene="Mgat4b"
FT                   /locus_tag="mCG_67968"
FT                   /note="gene_id=mCG67968.2"
FT   mRNA            join(7228151..7228427,7248245..7248430,7248526..7248666,
FT                   7248756..7248889,7249304..7249350,7249589..7249702,
FT                   7249872..7249947,7250129..7250243,7250510..7250640,
FT                   7250841..7250948,7251029..7251222,7251648..7251726,
FT                   7251809..7251896,7251975..7252088,7252172..7252669)
FT                   /gene="Mgat4b"
FT                   /locus_tag="mCG_67968"
FT                   /product="mannoside acetylglucosaminyltransferase 4,
FT                   isoenzyme B, transcript variant mCT170412"
FT                   /note="gene_id=mCG67968.2 transcript_id=mCT170412.0 created
FT                   on 25-JUN-2002"
FT   CDS             join(7228307..7228427,7248245..7248430,7248526..7248666,
FT                   7248756..7248889,7249304..7249350,7249589..7249702,
FT                   7249872..7249947,7250129..7250243,7250510..7250640,
FT                   7250841..7250948,7251029..7251222,7251648..7251726,
FT                   7251809..7251896,7251975..7252087)
FT                   /codon_start=1
FT                   /gene="Mgat4b"
FT                   /locus_tag="mCG_67968"
FT                   /product="mannoside acetylglucosaminyltransferase 4,
FT                   isoenzyme B, isoform CRA_a"
FT                   /note="gene_id=mCG67968.2 transcript_id=mCT170412.0
FT                   protein_id=mCP93330.0 isoform=CRA_a"
FT                   /protein_id="EDL33715.1"
FT   assembly_gap    7228942..7231391
FT                   /estimated_length=2450
FT                   /gap_type="unknown"
FT   mRNA            join(7242940..7243304,7248245..7248430,7248526..7248666,
FT                   7248756..7248889,7249304..7249350,7249589..7249702,
FT                   7249872..7249947,7250129..7250243,7250510..7250640,
FT                   7250841..7250948,7251029..7251222,7251648..7251726,
FT                   7251809..7251896,7251975..7252088,7252172..7252669)
FT                   /gene="Mgat4b"
FT                   /locus_tag="mCG_67968"
FT                   /product="mannoside acetylglucosaminyltransferase 4,
FT                   isoenzyme B, transcript variant mCT68127"
FT                   /note="gene_id=mCG67968.2 transcript_id=mCT68127.2 created
FT                   on 25-JUN-2002"
FT   CDS             join(7243208..7243304,7248245..7248430,7248526..7248666,
FT                   7248756..7248889,7249304..7249350,7249589..7249702,
FT                   7249872..7249947,7250129..7250243,7250510..7250640,
FT                   7250841..7250948,7251029..7251222,7251648..7251726,
FT                   7251809..7251896,7251975..7252087)
FT                   /codon_start=1
FT                   /gene="Mgat4b"
FT                   /locus_tag="mCG_67968"
FT                   /product="mannoside acetylglucosaminyltransferase 4,
FT                   isoenzyme B, isoform CRA_b"
FT                   /note="gene_id=mCG67968.2 transcript_id=mCT68127.2
FT                   protein_id=mCP41842.2 isoform=CRA_b"
FT                   /protein_id="EDL33716.1"
FT   gene            complement(<7253940..7256182)
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /note="gene_id=mCG67966.1"
FT   mRNA            complement(join(<7253940..7254278,7254583..7254664,
FT                   7254760..7254830,7254907..7254989,7255944..7256182))
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, transcript variant
FT                   mCT170411"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT170411.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(<7253940..7254167,7254583..7254664,
FT                   7254760..7254830,7254907..7254989,7255944..7256061))
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, transcript variant
FT                   mCT179886"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT179886.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(<7253940..7254290,7254594..7254664,
FT                   7254760..7254830,7254907..7255006,7255944..7256055))
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, transcript variant
FT                   mCT179884"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT179884.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(7253940..7254167,7254583..7254664,
FT                   7254760..7254830,7254907..7254989,7255944..7256001))
FT                   /codon_start=1
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, isoform CRA_e"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT179886.0
FT                   protein_id=mCP102806.0 isoform=CRA_e"
FT                   /protein_id="EDL33713.1"
FT                   QMQPGFGRLG"
FT   CDS             complement(join(7253940..7254278,7254583..7254664,
FT                   7254760..7254830,7254907..7254989,7255944..7256001))
FT                   /codon_start=1
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, isoform CRA_b"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT170411.0
FT                   protein_id=mCP93329.0 isoform=CRA_b"
FT                   /protein_id="EDL33710.1"
FT   CDS             complement(join(7253940..7254290,7254594..7254664,
FT                   7254760..7254830,7254907..7255006,7255944..7256001))
FT                   /codon_start=1
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, isoform CRA_c"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT179884.0
FT                   protein_id=mCP102807.0 isoform=CRA_c"
FT                   /protein_id="EDL33711.1"
FT   mRNA            complement(join(7254038..7254167,7254583..7254664,
FT                   7254760..7254830,7254907..7255006,7255944..7256182))
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, transcript variant
FT                   mCT170410"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT170410.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(7254038..7254278,7254583..7254664,
FT                   7254760..7254830,7254907..7255006,7255944..7256182))
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, transcript variant
FT                   mCT68125"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT68125.1 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(7254052..7254290,7254594..7254664,
FT                   7254760..7254830,7254907..7254989,7255944..7256064))
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, transcript variant
FT                   mCT179885"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT179885.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(7254137..7254167,7254583..7254664,
FT                   7254760..7254830,7254907..7255006,7255944..7256001))
FT                   /codon_start=1
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, isoform CRA_a"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT170410.0
FT                   protein_id=mCP93328.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8K355"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR001446"
FT                   /db_xref="InterPro:IPR018295"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="MGI:MGI:107498"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K355"
FT                   /protein_id="EDL33709.1"
FT                   WLQMLLPMA"
FT   CDS             complement(join(7254137..7254278,7254583..7254664,
FT                   7254760..7254830,7254907..7255006,7255944..7256001))
FT                   /codon_start=1
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, isoform CRA_f"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT68125.1
FT                   protein_id=mCP41837.1 isoform=CRA_f"
FT                   /protein_id="EDL33714.1"
FT   CDS             complement(join(7254274..7254290,7254594..7254664,
FT                   7254760..7254830,7254907..7254989,7255944..7256001))
FT                   /codon_start=1
FT                   /gene="Ltc4s"
FT                   /locus_tag="mCG_67966"
FT                   /product="leukotriene C4 synthase, isoform CRA_d"
FT                   /note="gene_id=mCG67966.1 transcript_id=mCT179885.0
FT                   protein_id=mCP102808.0 isoform=CRA_d"
FT                   /protein_id="EDL33712.1"
FT   assembly_gap    7264466..7264663
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   gene            complement(<7275434..7309933)
FT                   /gene="Maml1"
FT                   /locus_tag="mCG_67969"
FT                   /note="gene_id=mCG67969.2"
FT   mRNA            complement(join(<7275434..7276413,7278562..7278658,
FT                   7280835..7281068,7283180..7284595,7309323..7309933))
FT                   /gene="Maml1"
FT                   /locus_tag="mCG_67969"
FT                   /product="mastermind like 1 (Drosophila)"
FT                   /note="gene_id=mCG67969.2 transcript_id=mCT68128.2 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(7275434..7276413,7278562..7278658,
FT                   7280835..7281068,7283180..7284595,7309323..7309658))
FT                   /codon_start=1
FT                   /gene="Maml1"
FT                   /locus_tag="mCG_67969"
FT                   /product="mastermind like 1 (Drosophila)"
FT                   /note="gene_id=mCG67969.2 transcript_id=mCT68128.2
FT                   protein_id=mCP41849.2"
FT                   /protein_id="EDL33707.1"
FT   assembly_gap    7290081..7290113
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            complement(7292096..7293963)
FT                   /locus_tag="mCG_148147"
FT                   /note="gene_id=mCG148147.0"
FT   mRNA            complement(7292096..7293963)
FT                   /locus_tag="mCG_148147"
FT                   /product="mCG148147"
FT                   /note="gene_id=mCG148147.0 transcript_id=mCT188410.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7292143..7292334)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148147"
FT                   /product="mCG148147"
FT                   /note="gene_id=mCG148147.0 transcript_id=mCT188410.0
FT                   protein_id=mCP108592.0"
FT                   /protein_id="EDL33708.1"
FT                   PHGGSQPSVMGLDAFWCV"
FT   gene            7309006..7310749
FT                   /locus_tag="mCG_148150"
FT                   /note="gene_id=mCG148150.0"
FT   mRNA            7309006..7310749
FT                   /locus_tag="mCG_148150"
FT                   /product="mCG148150"
FT                   /note="gene_id=mCG148150.0 transcript_id=mCT188413.0
FT                   created on 13-JAN-2004"
FT   CDS             7309579..7310001
FT                   /codon_start=1
FT                   /locus_tag="mCG_148150"
FT                   /product="mCG148150"
FT                   /note="gene_id=mCG148150.0 transcript_id=mCT188413.0
FT                   protein_id=mCP108595.0"
FT                   /protein_id="EDL33706.1"
FT   gene            complement(7311553..7343256)
FT                   /gene="Canx"
FT                   /locus_tag="mCG_125213"
FT                   /note="gene_id=mCG125213.1"
FT   mRNA            complement(join(7311553..7313932,7314655..7314734,
FT                   7314871..7314991,7315714..7315833,7316726..7316941,
FT                   7318495..7318651,7319355..7319468,7321923..7322112,
FT                   7325067..7325259,7325907..7325988,7326385..7326526,
FT                   7327969..7328027,7328391..7328464,7329201..7329381,
FT                   7343090..7343256))
FT                   /gene="Canx"
FT                   /locus_tag="mCG_125213"
FT                   /product="calnexin, transcript variant mCT126473"
FT                   /note="gene_id=mCG125213.1 transcript_id=mCT126473.1
FT                   created on 25-JUN-2002"
FT   mRNA            complement(join(7311553..7313932,7314655..7314734,
FT                   7314871..7314991,7315714..7315833,7316726..7316941,
FT                   7318495..7318651,7319355..7319468,7321923..7322112,
FT                   7325067..7325259,7325907..7325988,7326385..7326526,
FT                   7327969..7328027,7328391..7328464,7329201..7329381,
FT                   7343126..7343205))
FT                   /gene="Canx"
FT                   /locus_tag="mCG_125213"
FT                   /product="calnexin, transcript variant mCT170391"
FT                   /note="gene_id=mCG125213.1 transcript_id=mCT170391.0
FT                   created on 25-JUN-2002"
FT   mRNA            complement(join(7311553..7313932,7314655..7314734,
FT                   7314871..7314991,7315714..7315833,7316726..7316941,
FT                   7318495..7318651,7319355..7319468,7321923..7322112,
FT                   7325067..7325259,7325907..7325988,7326385..7326526,
FT                   7327969..7328027,7328391..7328464,7329201..7329377,
FT                   7343090..7343197))
FT                   /gene="Canx"
FT                   /locus_tag="mCG_125213"
FT                   /product="calnexin, transcript variant mCT170392"
FT                   /note="gene_id=mCG125213.1 transcript_id=mCT170392.0
FT                   created on 25-JUN-2002"
FT   CDS             complement(join(7313879..7313932,7314655..7314734,
FT                   7314871..7314991,7315714..7315833,7316726..7316941,
FT                   7318495..7318651,7319355..7319468,7321923..7322112,
FT                   7325067..7325259,7325907..7325988,7326385..7326526,
FT                   7327969..7328027,7328391..7328464,7329201..7329374))
FT                   /codon_start=1
FT                   /gene="Canx"
FT                   /locus_tag="mCG_125213"
FT                   /product="calnexin, isoform CRA_a"
FT                   /note="gene_id=mCG125213.1 transcript_id=mCT170391.0
FT                   protein_id=mCP93310.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SUC3"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR009033"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018124"
FT                   /db_xref="MGI:MGI:88261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUC3"
FT                   /protein_id="EDL33703.1"
FT                   EILNRSPRNRKPRRE"
FT   CDS             complement(join(7313879..7313932,7314655..7314734,
FT                   7314871..7314991,7315714..7315833,7316726..7316941,
FT                   7318495..7318651,7319355..7319468,7321923..7322112,
FT                   7325067..7325259,7325907..7325988,7326385..7326526,
FT                   7327969..7328027,7328391..7328464,7329201..7329374))
FT                   /codon_start=1
FT                   /gene="Canx"
FT                   /locus_tag="mCG_125213"
FT                   /product="calnexin, isoform CRA_a"
FT                   /note="gene_id=mCG125213.1 transcript_id=mCT126473.1
FT                   protein_id=mCP81088.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SUC3"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR009033"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018124"
FT                   /db_xref="MGI:MGI:88261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUC3"
FT                   /protein_id="EDL33704.1"
FT                   EILNRSPRNRKPRRE"
FT   CDS             complement(join(7313879..7313932,7314655..7314734,
FT                   7314871..7314991,7315714..7315833,7316726..7316941,
FT                   7318495..7318651,7319355..7319468,7321923..7322112,
FT                   7325067..7325259,7325907..7325988,7326385..7326526,
FT                   7327969..7328027,7328391..7328464,7329201..7329374))
FT                   /codon_start=1
FT                   /gene="Canx"
FT                   /locus_tag="mCG_125213"
FT                   /product="calnexin, isoform CRA_a"
FT                   /note="gene_id=mCG125213.1 transcript_id=mCT170392.0
FT                   protein_id=mCP93309.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SUC3"
FT                   /db_xref="InterPro:IPR001580"
FT                   /db_xref="InterPro:IPR009033"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018124"
FT                   /db_xref="MGI:MGI:88261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUC3"
FT                   /protein_id="EDL33705.1"
FT                   EILNRSPRNRKPRRE"
FT   assembly_gap    7354080..7354120
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    7358597..7358616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7370645..7370687
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   gene            <7375406..7377355
FT                   /locus_tag="mCG_67962"
FT                   /note="gene_id=mCG67962.1"
FT   mRNA            join(<7375406..7375456,7376693..7377355)
FT                   /locus_tag="mCG_67962"
FT                   /product="mCG67962"
FT                   /note="gene_id=mCG67962.1 transcript_id=mCT68121.1 created
FT                   on 25-JUN-2002"
FT   CDS             join(<7375407..7375456,7376693..7377329)
FT                   /codon_start=1
FT                   /locus_tag="mCG_67962"
FT                   /product="mCG67962"
FT                   /note="gene_id=mCG67962.1 transcript_id=mCT68121.1
FT                   protein_id=mCP41847.1"
FT                   /protein_id="EDL33702.1"
FT                   RALESR"
FT   assembly_gap    7379439..7379491
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            <7395388..7404164
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /note="gene_id=mCG67961.2"
FT   mRNA            join(<7395388..7395439,7395928..7396064,7397105..7397260,
FT                   7397458..7400352,7400437..7400508,7400565..7400698,
FT                   7400816..7400951,7401317..7401376,7401468..7401557,
FT                   7402281..7402373,7403414..7404164)
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /product="heterogeneous nuclear ribonucleoprotein H1,
FT                   transcript variant mCT193118"
FT                   /note="gene_id=mCG67961.2 transcript_id=mCT193118.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<7395402..7395439,7395928..7396064,7397105..7397260,
FT                   7397458..7400352,7400437..7400508,7400565..7400698,
FT                   7400816..7400951,7401317..7401376,7401468..7401557,
FT                   7402281..7402373,7402778..7402827,7403414..7403558)
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /product="heterogeneous nuclear ribonucleoprotein H1,
FT                   transcript variant mCT193120"
FT                   /note="gene_id=mCG67961.2 transcript_id=mCT193120.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(7395409..7395439,7395928..7396064,7397105..7397260,
FT                   7397458..7397601,7399096..7399234,7400174..7400352,
FT                   7400437..7400508,7400565..7400698,7400816..7400951,
FT                   7401317..7401376,7401468..7401557,7402281..7402373,
FT                   7402778..7402827,7403414..7404162)
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /product="heterogeneous nuclear ribonucleoprotein H1,
FT                   transcript variant mCT68120"
FT                   /note="gene_id=mCG67961.2 transcript_id=mCT68120.1 created
FT                   on 25-JUN-2002"
FT   mRNA            join(<7395928..7396064,7397105..7397260,7397458..7397601,
FT                   7399096..7399234,7400174..7400352,7400437..7400508,
FT                   7400565..7400698,7400816..7400951,7401317..7401376,
FT                   7401468..7401557,7402281..7402373,7403414..7404164)
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /product="heterogeneous nuclear ribonucleoprotein H1,
FT                   transcript variant mCT193119"
FT                   /note="gene_id=mCG67961.2 transcript_id=mCT193119.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<7395929..7396064,7397105..7397260,7397458..7397601,
FT                   7399096..7399234,7400174..7400352,7400437..7400508,
FT                   7400565..7400698,7400816..7400951,7401317..7401376,
FT                   7401468..7401557,7402281..7402373,7403414..7403532)
FT                   /codon_start=1
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /product="heterogeneous nuclear ribonucleoprotein H1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG67961.2 transcript_id=mCT193119.0
FT                   protein_id=mCP114103.0 isoform=CRA_b"
FT                   /protein_id="EDL33699.1"
FT   CDS             join(7395968..7396064,7397105..7397260,7397458..7397601,
FT                   7399096..7399234,7400174..7400352,7400437..7400508,
FT                   7400565..7400698,7400816..7400951,7401317..7401376,
FT                   7401468..7401557,7402281..7402373,7402778..7402827)
FT                   /codon_start=1
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /product="heterogeneous nuclear ribonucleoprotein H1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG67961.2 transcript_id=mCT68120.1
FT                   protein_id=mCP41841.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q811L7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012996"
FT                   /db_xref="MGI:MGI:1891925"
FT                   /db_xref="UniProtKB/TrEMBL:Q811L7"
FT                   /protein_id="EDL33701.1"
FT   gene            complement(7399135..7448964)
FT                   /gene="Rufy1"
FT                   /locus_tag="mCG_125221"
FT                   /note="gene_id=mCG125221.1"
FT   mRNA            complement(join(7399135..7399202,7407330..7407546,
FT                   7407882..7407959,7409607..7409655,7412509..7412603,
FT                   7415228..7415357,7415955..7416074,7419022..7419119,
FT                   7422038..7422205,7423951..7424067,7425408..7425509,
FT                   7428151..7428220,7432100..7432165,7433823..7433884,
FT                   7434767..7434890,7437204..7437305,7437960..7438077,
FT                   7439213..7439386,7448350..7448964))
FT                   /gene="Rufy1"
FT                   /locus_tag="mCG_125221"
FT                   /product="RUN and FYVE domain containing 1, transcript
FT                   variant mCT126481"
FT                   /note="gene_id=mCG125221.1 transcript_id=mCT126481.1
FT                   created on 25-JUN-2002"
FT   CDS             join(<7400121..7400352,7400437..7400508,7400565..7400698,
FT                   7400816..7400951,7401317..7401376,7401468..7401557,
FT                   7402281..7402373,7403414..7403532)
FT                   /codon_start=1
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /product="heterogeneous nuclear ribonucleoprotein H1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG67961.2 transcript_id=mCT193118.0
FT                   protein_id=mCP114102.0 isoform=CRA_a"
FT                   /protein_id="EDL33698.1"
FT   CDS             join(<7400121..7400352,7400437..7400508,7400565..7400698,
FT                   7400816..7400951,7401317..7401376,7401468..7401557,
FT                   7402281..7402373,7402778..7402827)
FT                   /codon_start=1
FT                   /gene="Hnrph1"
FT                   /locus_tag="mCG_67961"
FT                   /product="heterogeneous nuclear ribonucleoprotein H1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG67961.2 transcript_id=mCT193120.0
FT                   protein_id=mCP114104.0 isoform=CRA_c"
FT                   /protein_id="EDL33700.1"
FT                   DFQSNIA"
FT   assembly_gap    7406467..7406639
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   mRNA            complement(join(7406884..7407546,7407882..7407959,
FT                   7409607..7409655,7412509..7412603,7415228..7415357,
FT                   7415955..7416074,7419022..7419119,7422038..7422205,
FT                   7423951..7424067,7425408..7425509,7428151..7428220,
FT                   7432100..7432165,7433823..7433884,7434767..7434890,
FT                   7437204..7437305,7437960..7438077,7439213..7439386,
FT                   7448350..7448964))
FT                   /gene="Rufy1"
FT                   /locus_tag="mCG_125221"
FT                   /product="RUN and FYVE domain containing 1, transcript
FT                   variant mCT170393"
FT                   /note="gene_id=mCG125221.1 transcript_id=mCT170393.0
FT                   created on 25-JUN-2002"
FT   CDS             complement(join(7407403..7407546,7407882..7407959,
FT                   7409607..7409655,7412509..7412603,7415228..7415357,
FT                   7415955..7416074,7419022..7419119,7422038..7422205,
FT                   7423951..7424067,7425408..7425509,7428151..7428220,
FT                   7432100..7432165,7433823..7433884,7434767..7434890,
FT                   7437204..7437305,7437960..7438077,7439213..7439386,
FT                   7448350..7448671))
FT                   /codon_start=1
FT                   /gene="Rufy1"
FT                   /locus_tag="mCG_125221"
FT                   /product="RUN and FYVE domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG125221.1 transcript_id=mCT126481.1
FT                   protein_id=mCP81003.1 isoform=CRA_a"
FT                   /protein_id="EDL33696.1"
FT                   VCDSCHTLLLQRCSSTAS"
FT   CDS             complement(join(7407403..7407546,7407882..7407959,
FT                   7409607..7409655,7412509..7412603,7415228..7415357,
FT                   7415955..7416074,7419022..7419119,7422038..7422205,
FT                   7423951..7424067,7425408..7425509,7428151..7428220,
FT                   7432100..7432165,7433823..7433884,7434767..7434890,
FT                   7437204..7437305,7437960..7438077,7439213..7439386,
FT                   7448350..7448671))
FT                   /codon_start=1
FT                   /gene="Rufy1"
FT                   /locus_tag="mCG_125221"
FT                   /product="RUN and FYVE domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG125221.1 transcript_id=mCT170393.0
FT                   protein_id=mCP93311.0 isoform=CRA_a"
FT                   /protein_id="EDL33697.1"
FT                   VCDSCHTLLLQRCSSTAS"
FT   assembly_gap    7505484..7507355
FT                   /estimated_length=1872
FT                   /gap_type="unknown"
FT   assembly_gap    7531541..7531577
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    7572820..7572839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7599981..7600000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7616960..7620177)
FT                   /locus_tag="mCG_148151"
FT                   /note="gene_id=mCG148151.0"
FT   mRNA            complement(join(7616960..7618669,7620076..7620177))
FT                   /locus_tag="mCG_148151"
FT                   /product="mCG148151"
FT                   /note="gene_id=mCG148151.0 transcript_id=mCT188414.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7617390..7617830)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148151"
FT                   /product="mCG148151"
FT                   /note="gene_id=mCG148151.0 transcript_id=mCT188414.0
FT                   protein_id=mCP108596.0"
FT                   /protein_id="EDL33695.1"
FT   assembly_gap    7618715..7619605
FT                   /estimated_length=891
FT                   /gap_type="unknown"
FT   gene            7619834..7823434
FT                   /gene="Adamts2"
FT                   /locus_tag="mCG_67958"
FT                   /note="gene_id=mCG67958.2"
FT   mRNA            join(7619834..7620025,7620963..7621357,7686110..7686269,
FT                   7755641..7755843,7775166..7775249,7791688..7791844,
FT                   7793785..7793890,7794590..7794733,7795093..7795225,
FT                   7795602..7795715,7798164..7798309,7800701..7800876,
FT                   7803606..7803739,7804550..7804673,7805588..7805668,
FT                   7806191..7806357,7807657..7807816,7810805..7810937,
FT                   7811648..7811855,7814358..7814487,7815479..7815568,
FT                   7822664..7823434)
FT                   /gene="Adamts2"
FT                   /locus_tag="mCG_67958"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 2"
FT                   /note="gene_id=mCG67958.2 transcript_id=mCT68117.2 created
FT                   on 25-JUN-2002"
FT   CDS             join(7619890..7620025,7620963..7621357,7686110..7686269,
FT                   7755641..7755843,7775166..7775249,7791688..7791844,
FT                   7793785..7793890,7794590..7794733,7795093..7795225,
FT                   7795602..7795715,7798164..7798309,7800701..7800876,
FT                   7803606..7803739,7804550..7804673,7805588..7805668,
FT                   7806191..7806357,7807657..7807816,7810805..7810937,
FT                   7811648..7811855,7814358..7814487,7815479..7815568,
FT                   7822664..7823124)
FT                   /codon_start=1
FT                   /gene="Adamts2"
FT                   /locus_tag="mCG_67958"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 2"
FT                   /note="gene_id=mCG67958.2 transcript_id=mCT68117.2
FT                   protein_id=mCP41840.2"
FT                   /protein_id="EDL33693.1"
FT   assembly_gap    7630140..7630159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7632367..7632454
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    7669392..7670151
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   assembly_gap    7671764..7671783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7675533..7675552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7729113..7729141
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    7730306..7730692
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   gene            complement(7738560..>7744019)
FT                   /locus_tag="mCG_144856"
FT                   /note="gene_id=mCG144856.0"
FT   mRNA            complement(join(7738560..7739678,7742186..7742286,
FT                   7742631..7742733,7743276..7743391,7743486..7743599,
FT                   7743715..>7744019))
FT                   /locus_tag="mCG_144856"
FT                   /product="mCG144856"
FT                   /note="gene_id=mCG144856.0 transcript_id=mCT184280.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(7739258..>7739563)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144856"
FT                   /product="mCG144856"
FT                   /note="gene_id=mCG144856.0 transcript_id=mCT184280.0
FT                   protein_id=mCP105975.0"
FT                   /protein_id="EDL33694.1"
FT   assembly_gap    7753666..7753685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7799625..7800228
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    7802080..7802115
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    7812703..7812782
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    7818851..7819269
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   gene            complement(7830179..7846788)
FT                   /gene="Zfp354c"
FT                   /locus_tag="mCG_67955"
FT                   /note="gene_id=mCG67955.2"
FT   mRNA            complement(join(7830179..7835087,7836213..7836305,
FT                   7836903..7837029,7845520..7845604,7846673..7846788))
FT                   /gene="Zfp354c"
FT                   /locus_tag="mCG_67955"
FT                   /product="zinc finger protein 354C"
FT                   /note="gene_id=mCG67955.2 transcript_id=mCT68267.1 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(7833658..7835087,7836213..7836305,
FT                   7836903..7837029,7845520..7845552))
FT                   /codon_start=1
FT                   /gene="Zfp354c"
FT                   /locus_tag="mCG_67955"
FT                   /product="zinc finger protein 354C"
FT                   /note="gene_id=mCG67955.2 transcript_id=mCT68267.1
FT                   protein_id=mCP41852.0"
FT                   /protein_id="EDL33692.1"
FT   gene            complement(7851132..7860645)
FT                   /gene="9630041N07Rik"
FT                   /locus_tag="mCG_67957"
FT                   /note="gene_id=mCG67957.2"
FT   mRNA            complement(join(7851132..7853068,7857008..7857103,
FT                   7857508..7857634,7859624..7859688,7860468..7860645))
FT                   /gene="9630041N07Rik"
FT                   /locus_tag="mCG_67957"
FT                   /product="RIKEN cDNA 9630041N07"
FT                   /note="gene_id=mCG67957.2 transcript_id=mCT68269.2 created
FT                   on 25-JUN-2002"
FT   CDS             complement(join(7851633..7853068,7857008..7857103,
FT                   7857508..7857634,7859624..7859656))
FT                   /codon_start=1
FT                   /gene="9630041N07Rik"
FT                   /locus_tag="mCG_67957"
FT                   /product="RIKEN cDNA 9630041N07"
FT                   /note="gene_id=mCG67957.2 transcript_id=mCT68269.2
FT                   protein_id=mCP41857.2"
FT                   /db_xref="GOA:Q8BI99"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:3053099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BI99"
FT                   /protein_id="EDL33691.1"
FT   gene            7869783..>7870782
FT                   /locus_tag="mCG_67956"
FT                   /note="gene_id=mCG67956.2"
FT   mRNA            join(7869783..7869937,7870229..>7870782)
FT                   /locus_tag="mCG_67956"
FT                   /product="mCG67956"
FT                   /note="gene_id=mCG67956.2 transcript_id=mCT68268.2 created
FT                   on 25-JUN-2002"
FT   CDS             7870240..7870782
FT                   /codon_start=1
FT                   /locus_tag="mCG_67956"
FT                   /product="mCG67956"
FT                   /note="gene_id=mCG67956.2 transcript_id=mCT68268.2
FT                   protein_id=mCP41855.1"
FT                   /protein_id="EDL33690.1"
FT                   RAGVCHPSSLPGGRYLY"
FT   assembly_gap    7871261..7880057
FT                   /estimated_length=8797
FT                   /gap_type="unknown"
FT   gene            complement(7886905..7901828)
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /note="gene_id=mCG114848.1"
FT   mRNA            complement(join(7886905..7888472,7900554..7900683,
FT                   7901570..7901680))
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /product="zinc finger protein 454, transcript variant
FT                   mCT170389"
FT                   /note="gene_id=mCG114848.1 transcript_id=mCT170389.0
FT                   created on 27-FEB-2003"
FT   CDS             complement(join(7887178..7888472,7900554..7900614))
FT                   /codon_start=1
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /product="zinc finger protein 454, isoform CRA_d"
FT                   /note="gene_id=mCG114848.1 transcript_id=mCT170389.0
FT                   protein_id=mCP93307.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q8BIK0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2679253"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BIK0"
FT                   /protein_id="EDL33689.1"
FT   mRNA            complement(join(7887476..7888472,7892228..7892290,
FT                   7897369..7897461,7897870..7897996,7900554..7900683,
FT                   7901570..7901708))
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /product="zinc finger protein 454, transcript variant
FT                   mCT115946"
FT                   /note="gene_id=mCG114848.1 transcript_id=mCT115946.1
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(7888346..7888472,7892272..7892290,
FT                   7900554..7900683,7901570..7901828))
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /product="zinc finger protein 454, transcript variant
FT                   mCT170390"
FT                   /note="gene_id=mCG114848.1 transcript_id=mCT170390.0
FT                   created on 27-FEB-2003"
FT   CDS             complement(join(7888448..7888472,7892272..7892290,
FT                   7900554..7900614))
FT                   /codon_start=1
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /product="zinc finger protein 454, isoform CRA_b"
FT                   /note="gene_id=mCG114848.1 transcript_id=mCT170390.0
FT                   protein_id=mCP93308.0 isoform=CRA_b"
FT                   /protein_id="EDL33687.1"
FT   mRNA            complement(join(7897369..7897458,7897870..7897996,
FT                   7900358..7900463,7900554..7900683,7901570..7901707))
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /product="zinc finger protein 454, transcript variant
FT                   mCT170388"
FT                   /note="gene_id=mCG114848.1 transcript_id=mCT170388.0
FT                   created on 27-FEB-2003"
FT   CDS             complement(join(7897884..7897996,7900554..7900614))
FT                   /codon_start=1
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /product="zinc finger protein 454, isoform CRA_c"
FT                   /note="gene_id=mCG114848.1 transcript_id=mCT115946.1
FT                   protein_id=mCP80980.1 isoform=CRA_c"
FT                   /protein_id="EDL33688.1"
FT                   GLVSGCDARELQ"
FT   CDS             complement(join(7900414..7900463,7900554..7900614))
FT                   /codon_start=1
FT                   /gene="Zfp454"
FT                   /locus_tag="mCG_114848"
FT                   /product="zinc finger protein 454, isoform CRA_a"
FT                   /note="gene_id=mCG114848.1 transcript_id=mCT170388.0
FT                   protein_id=mCP93306.0 isoform=CRA_a"
FT                   /protein_id="EDL33686.1"
FT   assembly_gap    7910884..7973556
FT                   /estimated_length=62673
FT                   /gap_type="unknown"
FT   gene            7974949..7975949
FT                   /pseudo
FT                   /locus_tag="mCG_1037702"
FT                   /note="gene_id=mCG1037702.0"
FT   mRNA            7974949..7975949
FT                   /pseudo
FT                   /locus_tag="mCG_1037702"
FT                   /note="gene_id=mCG1037702.0 transcript_id=mCT155406.1
FT                   created on 25-JUN-2002"
FT   gene            complement(7979091..>7979365)
FT                   /locus_tag="mCG_1037763"
FT                   /note="gene_id=mCG1037763.0"
FT   mRNA            complement(join(7979091..7979194,7979255..>7979365))
FT                   /locus_tag="mCG_1037763"
FT                   /product="mCG1037763"
FT                   /note="gene_id=mCG1037763.0 transcript_id=mCT155467.1
FT                   created on 24-JUN-2002"
FT   CDS             complement(join(7979180..7979194,7979255..>7979365))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037763"
FT                   /product="mCG1037763"
FT                   /note="gene_id=mCG1037763.0 transcript_id=mCT155467.1
FT                   protein_id=mCP80840.1"
FT                   /protein_id="EDL33685.1"
FT   gene            <7985014..>7985961
FT                   /locus_tag="mCG_142499"
FT                   /note="gene_id=mCG142499.0"
FT   mRNA            <7985014..>7985961
FT                   /locus_tag="mCG_142499"
FT                   /product="mCG142499"
FT                   /note="gene_id=mCG142499.0 transcript_id=mCT180542.0
FT                   created on 12-FEB-2003"
FT   CDS             7985014..7985961
FT                   /codon_start=1
FT                   /locus_tag="mCG_142499"
FT                   /product="mCG142499"
FT                   /note="gene_id=mCG142499.0 transcript_id=mCT180542.0
FT                   protein_id=mCP103464.0"
FT                   /db_xref="GOA:Q8VGH0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031212"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGH0"
FT                   /protein_id="EDL33684.1"
FT   gene            <8000696..>8001619
FT                   /gene="Olfr1377"
FT                   /locus_tag="mCG_1037701"
FT                   /note="gene_id=mCG1037701.1"
FT   mRNA            <8000696..>8001619
FT                   /gene="Olfr1377"
FT                   /locus_tag="mCG_1037701"
FT                   /product="olfactory receptor 1377"
FT                   /note="gene_id=mCG1037701.1 transcript_id=mCT155405.1
FT                   created on 24-JUN-2002"
FT   CDS             8000696..8001619
FT                   /codon_start=1
FT                   /gene="Olfr1377"
FT                   /locus_tag="mCG_1037701"
FT                   /product="olfactory receptor 1377"
FT                   /note="gene_id=mCG1037701.1 transcript_id=mCT155405.1
FT                   protein_id=mCP80898.1"
FT                   /db_xref="GOA:Q8VGH1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGH1"
FT                   /protein_id="EDL33683.1"
FT   gene            8007786..8008262
FT                   /pseudo
FT                   /locus_tag="mCG_114855"
FT                   /note="gene_id=mCG114855.1"
FT   mRNA            8007786..8008262
FT                   /pseudo
FT                   /locus_tag="mCG_114855"
FT                   /note="gene_id=mCG114855.1 transcript_id=mCT115953.1
FT                   created on 24-JUN-2002"
FT   assembly_gap    8008263..8010318
FT                   /estimated_length=2056
FT                   /gap_type="unknown"
FT   gene            <8023047..>8023970
FT                   /locus_tag="mCG_1037685"
FT                   /note="gene_id=mCG1037685.0"
FT   mRNA            <8023047..>8023970
FT                   /locus_tag="mCG_1037685"
FT                   /product="mCG1037685"
FT                   /note="gene_id=mCG1037685.0 transcript_id=mCT155389.0
FT                   created on 24-JUN-2002"
FT   CDS             8023047..8023970
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037685"
FT                   /product="mCG1037685"
FT                   /note="gene_id=mCG1037685.0 transcript_id=mCT155389.0
FT                   protein_id=mCP81015.0"
FT                   /db_xref="GOA:Q8VGG9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333747"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGG9"
FT                   /protein_id="EDL33682.1"
FT   assembly_gap    8033164..8033334
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    8034018..8040146
FT                   /estimated_length=6129
FT                   /gap_type="unknown"
FT   gene            <8042979..>8043920
FT                   /locus_tag="mCG_1037684"
FT                   /note="gene_id=mCG1037684.1"
FT   mRNA            <8042979..>8043920
FT                   /locus_tag="mCG_1037684"
FT                   /product="mCG1037684"
FT                   /note="gene_id=mCG1037684.1 transcript_id=mCT155388.1
FT                   created on 24-JUN-2002"
FT   CDS             8042979..8043920
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037684"
FT                   /product="mCG1037684"
FT                   /note="gene_id=mCG1037684.1 transcript_id=mCT155388.1
FT                   protein_id=mCP81011.1"
FT                   /db_xref="GOA:Q8VFE6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333750"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFE6"
FT                   /protein_id="EDL33681.1"
FT   assembly_gap    8049484..8049652
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   gene            8064177..8065111
FT                   /pseudo
FT                   /locus_tag="mCG_114850"
FT                   /note="gene_id=mCG114850.1"
FT   mRNA            8064177..8065111
FT                   /pseudo
FT                   /locus_tag="mCG_114850"
FT                   /note="gene_id=mCG114850.1 transcript_id=mCT115948.1
FT                   created on 24-JUN-2002"
FT   gene            8075365..8088123
FT                   /gene="Zfp354a"
FT                   /locus_tag="mCG_1040691"
FT                   /note="gene_id=mCG1040691.2"
FT   mRNA            join(8075365..8075472,8076142..8076224,8076930..8077056,
FT                   8077473..8077568,8085914..8088123)
FT                   /gene="Zfp354a"
FT                   /locus_tag="mCG_1040691"
FT                   /product="zinc finger protein 354A, transcript variant
FT                   mCT161188"
FT                   /note="gene_id=mCG1040691.2 transcript_id=mCT161188.2
FT                   created on 24-JUN-2002"
FT   mRNA            join(8075387..8075472,8075856..8076111,8076930..8077056,
FT                   8077473..8077568,8085914..8088123)
FT                   /gene="Zfp354a"
FT                   /locus_tag="mCG_1040691"
FT                   /product="zinc finger protein 354A, transcript variant
FT                   mCT170423"
FT                   /note="gene_id=mCG1040691.2 transcript_id=mCT170423.0
FT                   created on 24-JUN-2002"
FT   CDS             join(8076082..8076111,8076930..8077056,8077473..8077568,
FT                   8085914..8087376)
FT                   /codon_start=1
FT                   /gene="Zfp354a"
FT                   /locus_tag="mCG_1040691"
FT                   /product="zinc finger protein 354A, isoform CRA_b"
FT                   /note="gene_id=mCG1040691.2 transcript_id=mCT170423.0
FT                   protein_id=mCP93341.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5PPR4"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR033345"
FT                   /db_xref="MGI:MGI:103172"
FT                   /db_xref="UniProtKB/TrEMBL:Q5PPR4"
FT                   /protein_id="EDL33679.1"
FT   CDS             join(8076192..8076224,8076930..8077056,8077473..8077568,
FT                   8085914..8087376)
FT                   /codon_start=1
FT                   /gene="Zfp354a"
FT                   /locus_tag="mCG_1040691"
FT                   /product="zinc finger protein 354A, isoform CRA_c"
FT                   /note="gene_id=mCG1040691.2 transcript_id=mCT161188.2
FT                   protein_id=mCP90183.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q61751"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR033345"
FT                   /db_xref="MGI:MGI:103172"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61751"
FT                   /protein_id="EDL33680.1"
FT   mRNA            join(8076924..8077056,8086323..8086477,8086535..>8087297)
FT                   /gene="Zfp354a"
FT                   /locus_tag="mCG_1040691"
FT                   /product="zinc finger protein 354A, transcript variant
FT                   mCT115945"
FT                   /note="gene_id=mCG1040691.2 transcript_id=mCT115945.1
FT                   created on 24-JUN-2002"
FT   assembly_gap    8084372..8084580
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   CDS             8087017..>8087297
FT                   /codon_start=1
FT                   /gene="Zfp354a"
FT                   /locus_tag="mCG_1040691"
FT                   /product="zinc finger protein 354A, isoform CRA_a"
FT                   /note="gene_id=mCG1040691.2 transcript_id=mCT115945.1
FT                   protein_id=mCP80979.1 isoform=CRA_a"
FT                   /protein_id="EDL33678.1"
FT   assembly_gap    8103069..8103365
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    8118493..8119055
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   gene            8123985..8125000
FT                   /pseudo
FT                   /locus_tag="mCG_114851"
FT                   /note="gene_id=mCG114851.1"
FT   mRNA            8123985..8125000
FT                   /pseudo
FT                   /locus_tag="mCG_114851"
FT                   /note="gene_id=mCG114851.1 transcript_id=mCT115949.1
FT                   created on 24-JUN-2002"
FT   assembly_gap    8125001..8125361
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    8128101..8128133
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    8133788..8133807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8135091..8135110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8135111..8135620
FT                   /pseudo
FT                   /locus_tag="mCG_1037725"
FT                   /note="gene_id=mCG1037725.1"
FT   mRNA            8135111..8135620
FT                   /pseudo
FT                   /locus_tag="mCG_1037725"
FT                   /note="gene_id=mCG1037725.1 transcript_id=mCT155429.1
FT                   created on 01-JUL-2002"
FT   assembly_gap    8136197..8139516
FT                   /estimated_length=3320
FT                   /gap_type="unknown"
FT   assembly_gap    8141223..8141242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8190510..>8192557
FT                   /locus_tag="mCG_1037724"
FT                   /note="gene_id=mCG1037724.0"
FT   mRNA            join(<8190510..8191058,8191123..>8192557)
FT                   /locus_tag="mCG_1037724"
FT                   /product="mCG1037724"
FT                   /note="gene_id=mCG1037724.0 transcript_id=mCT155428.1
FT                   created on 24-JUN-2002"
FT   CDS             <8191979..8192557
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037724"
FT                   /product="mCG1037724"
FT                   /note="gene_id=mCG1037724.0 transcript_id=mCT155428.1
FT                   protein_id=mCP81056.0"
FT                   /protein_id="EDL33677.1"
FT   assembly_gap    8198327..8199068
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    8203715..8204668
FT                   /estimated_length=954
FT                   /gap_type="unknown"
FT   gene            complement(8206584..>8237171)
FT                   /locus_tag="mCG_6988"
FT                   /note="gene_id=mCG6988.2"
FT   mRNA            complement(join(8206584..8207064,8209137..8209278,
FT                   8215329..8215469,8236211..8236306,8237121..>8237171))
FT                   /locus_tag="mCG_6988"
FT                   /product="mCG6988, transcript variant mCT170421"
FT                   /note="gene_id=mCG6988.2 transcript_id=mCT170421.0 created
FT                   on 24-JUN-2002"
FT   mRNA            complement(join(8206584..8207064,8215329..8215469,
FT                   8230798..8230967,8236211..8236306,8237121..>8237171))
FT                   /locus_tag="mCG_6988"
FT                   /product="mCG6988, transcript variant mCT5631"
FT                   /note="gene_id=mCG6988.2 transcript_id=mCT5631.2 created on
FT                   24-JUN-2002"
FT   CDS             complement(join(8206866..8207064,8215329..>8215450))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6988"
FT                   /product="mCG6988, isoform CRA_b"
FT                   /note="gene_id=mCG6988.2 transcript_id=mCT5631.2
FT                   protein_id=mCP7923.2 isoform=CRA_b"
FT                   /protein_id="EDL33676.1"
FT                   LK"
FT   CDS             complement(join(8206866..8207064,8209137..>8209186))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6988"
FT                   /product="mCG6988, isoform CRA_a"
FT                   /note="gene_id=mCG6988.2 transcript_id=mCT170421.0
FT                   protein_id=mCP93339.0 isoform=CRA_a"
FT                   /protein_id="EDL33675.1"
FT   gene            complement(8270415..>8280412)
FT                   /gene="BC049762"
FT                   /locus_tag="mCG_6992"
FT                   /note="gene_id=mCG6992.3"
FT   mRNA            complement(join(8270415..8270820,8271127..8271432,
FT                   8279763..>8279814))
FT                   /gene="BC049762"
FT                   /locus_tag="mCG_6992"
FT                   /product="cDNA sequence BC049762, transcript variant
FT                   mCT193113"
FT                   /note="gene_id=mCG6992.3 transcript_id=mCT193113.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8270421..8270820,8271127..8271432,
FT                   8280363..>8280412))
FT                   /gene="BC049762"
FT                   /locus_tag="mCG_6992"
FT                   /product="cDNA sequence BC049762, transcript variant
FT                   mCT5621"
FT                   /note="gene_id=mCG6992.3 transcript_id=mCT5621.2 created on
FT                   24-JUN-2002"
FT   mRNA            complement(join(8270421..8270820,8271127..8271432,
FT                   8279545..>8279756))
FT                   /gene="BC049762"
FT                   /locus_tag="mCG_6992"
FT                   /product="cDNA sequence BC049762, transcript variant
FT                   mCT170422"
FT                   /note="gene_id=mCG6992.3 transcript_id=mCT170422.0 created
FT                   on 24-JUN-2002"
FT   CDS             complement(join(8270561..8270820,8271127..8271432,
FT                   8280363..>8280411))
FT                   /codon_start=1
FT                   /gene="BC049762"
FT                   /locus_tag="mCG_6992"
FT                   /product="cDNA sequence BC049762, isoform CRA_c"
FT                   /note="gene_id=mCG6992.3 transcript_id=mCT5621.2
FT                   protein_id=mCP7930.2 isoform=CRA_c"
FT                   /protein_id="EDL33674.1"
FT   CDS             complement(join(8270561..8270820,8271127..8271432,
FT                   8279763..>8279799))
FT                   /codon_start=1
FT                   /gene="BC049762"
FT                   /locus_tag="mCG_6992"
FT                   /product="cDNA sequence BC049762, isoform CRA_b"
FT                   /note="gene_id=mCG6992.3 transcript_id=mCT193113.0
FT                   protein_id=mCP114108.0 isoform=CRA_b"
FT                   /protein_id="EDL33673.1"
FT   CDS             complement(join(8270561..8270820,8271127..8271432,
FT                   8279545..>8279617))
FT                   /codon_start=1
FT                   /gene="BC049762"
FT                   /locus_tag="mCG_6992"
FT                   /product="cDNA sequence BC049762, isoform CRA_a"
FT                   /note="gene_id=mCG6992.3 transcript_id=mCT170422.0
FT                   protein_id=mCP93340.0 isoform=CRA_a"
FT                   /protein_id="EDL33672.1"
FT   gene            8279920..8298538
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /note="gene_id=mCG6984.2"
FT   mRNA            join(8279920..8280037,8283939..8284099,8284933..8284999,
FT                   8285537..8285614,8287305..8287363,8288568..8288790,
FT                   8289846..8289936,8290328..8290394,8291979..8292095,
FT                   8292180..8292346,8292538..8292632,8292886..8293015,
FT                   8294621..8294703,8297126..8297205,8297877..8297967,
FT                   8298045..8298538)
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, transcript variant mCT170417"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT170417.0 created
FT                   on 24-JUN-2002"
FT   mRNA            join(8279920..8280037,8283939..8284099,8288568..8288790,
FT                   8289846..8289936,8290328..8290394,8291979..8292095,
FT                   8292180..8292346,8292538..8292632,8292886..8293015,
FT                   8294621..8294703,8297126..8297205,8297877..8297967,
FT                   8298045..8298538)
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, transcript variant mCT5627"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT5627.1 created on
FT                   24-JUN-2002"
FT   mRNA            join(8279920..8280037,8283939..8284099,8288568..8288790,
FT                   8290328..8290394,8291979..8292095,8292180..8292346,
FT                   8292538..8292632,8292886..8293015,8294621..8294703,
FT                   8297126..8297205,8297877..8297967,8298045..8298538)
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, transcript variant mCT170419"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT170419.0 created
FT                   on 24-JUN-2002"
FT   mRNA            join(8279920..8280037,8288568..8288790,8290328..8290394,
FT                   8291979..8292095,8292180..8292346,8292538..8292632,
FT                   8292886..8293015,8294621..8294703,8297126..8297205,
FT                   8297877..8297967,8298045..8298534)
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, transcript variant mCT170418"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT170418.0 created
FT                   on 24-JUN-2002"
FT   mRNA            join(8280793..8280909,8283939..8284099,8288568..8288790,
FT                   8290328..8290394,8291979..8292095,8292180..8292346,
FT                   8292538..8292632,8292886..8293015,8294621..8294703,
FT                   8297126..8297205,8297877..8297967,8298045..8298538)
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, transcript variant mCT170420"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT170420.0 created
FT                   on 24-JUN-2002"
FT   CDS             join(8283939..8284099,8288568..8288790,8289846..8289936,
FT                   8290328..8290394,8291979..8292095,8292180..8292346,
FT                   8292538..8292632,8292886..8293015,8294621..8294703,
FT                   8297126..8297205,8297877..8297967,8298045..8298185)
FT                   /codon_start=1
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, isoform CRA_c"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT5627.1
FT                   protein_id=mCP7939.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q4FJV9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1098551"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJV9"
FT                   /protein_id="EDL33671.1"
FT   CDS             join(8287311..8287363,8288568..8288790,8289846..8289936,
FT                   8290328..8290394,8291979..8292095,8292180..8292346,
FT                   8292538..8292632,8292886..8293015,8294621..8294703,
FT                   8297126..8297205,8297877..8297967,8298045..8298185)
FT                   /codon_start=1
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, isoform CRA_a"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT170417.0
FT                   protein_id=mCP93337.0 isoform=CRA_a"
FT                   /protein_id="EDL33667.1"
FT   CDS             join(8290393..8290394,8291979..8292095,8292180..8292346,
FT                   8292538..8292632,8292886..8293015,8294621..8294703,
FT                   8297126..8297205,8297877..8297967,8298045..8298185)
FT                   /codon_start=1
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, isoform CRA_b"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT170418.0
FT                   protein_id=mCP93335.0 isoform=CRA_b"
FT                   /protein_id="EDL33668.1"
FT   CDS             join(8290393..8290394,8291979..8292095,8292180..8292346,
FT                   8292538..8292632,8292886..8293015,8294621..8294703,
FT                   8297126..8297205,8297877..8297967,8298045..8298185)
FT                   /codon_start=1
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, isoform CRA_b"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT170419.0
FT                   protein_id=mCP93336.0 isoform=CRA_b"
FT                   /protein_id="EDL33669.1"
FT   CDS             join(8290393..8290394,8291979..8292095,8292180..8292346,
FT                   8292538..8292632,8292886..8293015,8294621..8294703,
FT                   8297126..8297205,8297877..8297967,8298045..8298185)
FT                   /codon_start=1
FT                   /gene="Clk4"
FT                   /locus_tag="mCG_6984"
FT                   /product="CDC like kinase 4, isoform CRA_b"
FT                   /note="gene_id=mCG6984.2 transcript_id=mCT170420.0
FT                   protein_id=mCP93338.0 isoform=CRA_b"
FT                   /protein_id="EDL33670.1"
FT   assembly_gap    8306603..8306965
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   gene            <8306979..>8586004
FT                   /locus_tag="mCG_140629"
FT                   /note="gene_id=mCG140629.0"
FT   mRNA            join(<8306979..8307100,8333597..8333663,8545576..8545620,
FT                   8556302..8556328,8578126..8578152,8579567..8579593,
FT                   8580409..8580435,8585904..>8586004)
FT                   /locus_tag="mCG_140629"
FT                   /product="mCG140629"
FT                   /note="gene_id=mCG140629.0 transcript_id=mCT170403.0
FT                   created on 24-JUN-2002"
FT   CDS             join(<8306979..8307100,8333597..8333663,8545576..8545620,
FT                   8556302..8556328,8578126..8578152,8579567..8579593,
FT                   8580409..8580435,8585904..>8586004)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140629"
FT                   /product="mCG140629"
FT                   /note="gene_id=mCG140629.0 transcript_id=mCT170403.0
FT                   protein_id=mCP93321.0"
FT                   /protein_id="EDL33666.1"
FT   assembly_gap    8314834..8314853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8326467..8326486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8332438..8332459
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    8335820..8335942
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    8342104..8342221
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    8344721..8345096
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    8350410..8350429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8366618..8366637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8367656..8367675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8369350..8369369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8383508..8383527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8385230..8385249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8389606..8389625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8408764..8408976
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    8429095..8429318
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    8450246..8450265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8451983..8452397
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    8454369..8454388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8455502..8455521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8463709..8466264
FT                   /estimated_length=2556
FT                   /gap_type="unknown"
FT   assembly_gap    8485983..8486214
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    8505797..8505816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8510230..8510249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8512166..8512185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8513461..8513589
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    8515774..8515961
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    8527746..8527765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8551280..8551442
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    8559935..8559975
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    8566383..8566445
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    8577555..8577886
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   gene            8586883..8610793
FT                   /locus_tag="mCG_6996"
FT                   /note="gene_id=mCG6996.2"
FT   mRNA            join(8586883..8586897,8588446..8588473,8590329..8590355,
FT                   8591440..8591493,8593170..8593232,8593606..8593650,
FT                   8596325..8596402,8597913..8597966,8598554..8598598,
FT                   8599648..8599737,8600539..8600601,8600927..8600983,
FT                   8601227..8601253,8602466..8602528,8602612..8602665,
FT                   8602897..8602923,8605220..8605273,8605443..8605529,
FT                   8607893..8607931,8608382..8610793)
FT                   /locus_tag="mCG_6996"
FT                   /product="mCG6996"
FT                   /note="gene_id=mCG6996.2 transcript_id=mCT5625.2 created on
FT                   24-JUN-2002"
FT   CDS             join(8586887..8586897,8588446..8588473,8590329..8590355,
FT                   8591440..8591493,8593170..8593232,8593606..8593650,
FT                   8596325..8596402,8597913..8597966,8598554..8598598,
FT                   8599648..8599737,8600539..8600601,8600927..8600983,
FT                   8601227..8601253,8602466..8602528,8602612..8602665,
FT                   8602897..8602923,8605220..8605273,8605443..8605529,
FT                   8607893..8607931,8608382..8608384)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6996"
FT                   /product="mCG6996"
FT                   /note="gene_id=mCG6996.2 transcript_id=mCT5625.2
FT                   protein_id=mCP7934.2"
FT                   /protein_id="EDL33665.1"
FT   assembly_gap    8588277..8588296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8597535..8597554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8603455..8603474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8613090..8631557
FT                   /gene="2900006B13Rik"
FT                   /locus_tag="mCG_6995"
FT                   /note="gene_id=mCG6995.2"
FT   mRNA            join(8613090..8613197,8613832..8613950,8614879..8615038,
FT                   8619718..8619792,8620325..8620412,8620488..8620604,
FT                   8621924..8622006,8622236..8622461,8626594..8626748,
FT                   8626969..8627058,8627784..8627914,8628887..8628940,
FT                   8631113..8631557)
FT                   /gene="2900006B13Rik"
FT                   /locus_tag="mCG_6995"
FT                   /product="RIKEN cDNA 2900006B13"
FT                   /note="gene_id=mCG6995.2 transcript_id=mCT5624.2 created on
FT                   21-JUN-2002"
FT   CDS             join(8613139..8613197,8613832..8613950,8614879..8615038,
FT                   8619718..8619792,8620325..8620412,8620488..8620604,
FT                   8621924..8622006,8622236..8622461,8626594..8626748,
FT                   8626969..8627058,8627784..8627914,8628887..8628940,
FT                   8631113..8631159)
FT                   /codon_start=1
FT                   /gene="2900006B13Rik"
FT                   /locus_tag="mCG_6995"
FT                   /product="RIKEN cDNA 2900006B13"
FT                   /note="gene_id=mCG6995.2 transcript_id=mCT5624.2
FT                   protein_id=mCP7928.2"
FT                   /protein_id="EDL33664.1"
FT                   QILLTRQQD"
FT   gene            complement(8627189..8635165)
FT                   /gene="Hnrpab"
FT                   /locus_tag="mCG_6983"
FT                   /note="gene_id=mCG6983.2"
FT   mRNA            complement(join(8627189..8627409,8630175..8630208,
FT                   8630911..8631013,8632716..8632847,8632975..8633133,
FT                   8633777..8633945,8634657..8634903,8634984..8635165))
FT                   /gene="Hnrpab"
FT                   /locus_tag="mCG_6983"
FT                   /product="heterogeneous nuclear ribonucleoprotein A/B,
FT                   transcript variant mCT170178"
FT                   /note="gene_id=mCG6983.2 transcript_id=mCT170178.0 created
FT                   on 21-JUN-2002"
FT   CDS             complement(join(8627400..8627409,8630175..8630208,
FT                   8630911..8631013,8632716..8632847,8632975..8633133,
FT                   8633777..8633945,8634657..8634880))
FT                   /codon_start=1
FT                   /gene="Hnrpab"
FT                   /locus_tag="mCG_6983"
FT                   /product="heterogeneous nuclear ribonucleoprotein A/B,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6983.2 transcript_id=mCT170178.0
FT                   protein_id=mCP93018.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D6G1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012956"
FT                   /db_xref="MGI:MGI:1330294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D6G1"
FT                   /protein_id="EDL33662.1"
FT   mRNA            complement(join(8629189..8629796,8630068..8630208,
FT                   8630911..8631013,8632716..8632847,8632975..8633133,
FT                   8633777..8633945,8634657..8634903,8634984..8635161))
FT                   /gene="Hnrpab"
FT                   /locus_tag="mCG_6983"
FT                   /product="heterogeneous nuclear ribonucleoprotein A/B,
FT                   transcript variant mCT170177"
FT                   /note="gene_id=mCG6983.2 transcript_id=mCT170177.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(8629215..8629796,8630911..8631013,
FT                   8632716..8632847,8632975..8633133,8633777..8633945,
FT                   8634657..8634903,8634984..8635156))
FT                   /gene="Hnrpab"
FT                   /locus_tag="mCG_6983"
FT                   /product="heterogeneous nuclear ribonucleoprotein A/B,
FT                   transcript variant mCT5636"
FT                   /note="gene_id=mCG6983.2 transcript_id=mCT5636.2 created on
FT                   21-JUN-2002"
FT   CDS             complement(join(8629726..8629796,8630911..8631013,
FT                   8632716..8632847,8632975..8633133,8633777..8633945,
FT                   8634657..8634880))
FT                   /codon_start=1
FT                   /gene="Hnrpab"
FT                   /locus_tag="mCG_6983"
FT                   /product="heterogeneous nuclear ribonucleoprotein A/B,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG6983.2 transcript_id=mCT5636.2
FT                   protein_id=mCP7936.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q544Z3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012956"
FT                   /db_xref="MGI:MGI:1330294"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Z3"
FT                   /protein_id="EDL33663.1"
FT                   YKPY"
FT   CDS             complement(join(8629726..8629796,8630068..8630208,
FT                   8630911..8631013,8632716..8632847,8632975..8633133,
FT                   8633777..8633945,8634657..8634880))
FT                   /codon_start=1
FT                   /gene="Hnrpab"
FT                   /locus_tag="mCG_6983"
FT                   /product="heterogeneous nuclear ribonucleoprotein A/B,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6983.2 transcript_id=mCT170177.0
FT                   protein_id=mCP93002.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q20BD0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012956"
FT                   /db_xref="MGI:MGI:1330294"
FT                   /db_xref="UniProtKB/TrEMBL:Q20BD0"
FT                   /protein_id="EDL33661.1"
FT   gene            8648075..8652045
FT                   /gene="Nola2"
FT                   /locus_tag="mCG_6980"
FT                   /note="gene_id=mCG6980.2"
FT   mRNA            join(8648075..8648304,8648409..8648478,8650812..8650917,
FT                   8651419..8652045)
FT                   /gene="Nola2"
FT                   /locus_tag="mCG_6980"
FT                   /product="nucleolar protein family A, member 2, transcript
FT                   variant mCT5633"
FT                   /note="gene_id=mCG6980.2 transcript_id=mCT5633.1 created on
FT                   12-JUN-2003"
FT   mRNA            join(8648114..8648186,8648283..8648304,8648409..8648478,
FT                   8650812..8650917,8651419..8652045)
FT                   /gene="Nola2"
FT                   /locus_tag="mCG_6980"
FT                   /product="nucleolar protein family A, member 2, transcript
FT                   variant mCT185617"
FT                   /note="gene_id=mCG6980.2 transcript_id=mCT185617.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(8648145..8648304,8648409..8648478,8650812..8650917,
FT                   8651419..8651544)
FT                   /codon_start=1
FT                   /gene="Nola2"
FT                   /locus_tag="mCG_6980"
FT                   /product="nucleolar protein family A, member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG6980.2 transcript_id=mCT5633.1
FT                   protein_id=mCP7933.1 isoform=CRA_b"
FT                   /protein_id="EDL33659.1"
FT   CDS             join(8648145..8648186,8648283..8648304,8648409..8648478,
FT                   8650812..8650917,8651419..8651544)
FT                   /codon_start=1
FT                   /gene="Nola2"
FT                   /locus_tag="mCG_6980"
FT                   /product="nucleolar protein family A, member 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG6980.2 transcript_id=mCT185617.0
FT                   protein_id=mCP106875.0 isoform=CRA_c"
FT                   /protein_id="EDL33660.1"
FT                   ETYDKCLEEVQALPTPL"
FT   mRNA            join(8648172..8648478,8650812..8650917,8651419..8652045)
FT                   /gene="Nola2"
FT                   /locus_tag="mCG_6980"
FT                   /product="nucleolar protein family A, member 2, transcript
FT                   variant mCT170171"
FT                   /note="gene_id=mCG6980.2 transcript_id=mCT170171.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(8650816..8650917,8651419..8651544)
FT                   /codon_start=1
FT                   /gene="Nola2"
FT                   /locus_tag="mCG_6980"
FT                   /product="nucleolar protein family A, member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG6980.2 transcript_id=mCT170171.0
FT                   protein_id=mCP93012.0 isoform=CRA_a"
FT                   /protein_id="EDL33658.1"
FT   gene            complement(8652004..8664308)
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /note="gene_id=mCG6982.2"
FT   mRNA            complement(join(8652004..8652477,8652560..8652714,
FT                   8652806..8652908,8654000..8654165,8655052..8655218,
FT                   8655315..8655415,8655938..8656078,8656196..8656341,
FT                   8657792..8657977,8663902..8664308))
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /product="required for meiotic nuclear division 5 homolog B
FT                   (S. cerevisiae), transcript variant mCT5635"
FT                   /note="gene_id=mCG6982.2 transcript_id=mCT5635.2 created on
FT                   21-JUN-2002"
FT   mRNA            complement(join(8652004..8652477,8652560..8652714,
FT                   8652806..8652908,8654000..8654165,8655052..8655218,
FT                   8655315..8655415,8655938..8656078,8656196..8656341,
FT                   8657792..8658047,8663902..8664308))
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /product="required for meiotic nuclear division 5 homolog B
FT                   (S. cerevisiae), transcript variant mCT170175"
FT                   /note="gene_id=mCG6982.2 transcript_id=mCT170175.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(8652323..8652714,8652806..8652908,
FT                   8654000..8654165,8655052..8655218,8655315..8655415,
FT                   8655938..8656078,8656196..8656341,8657792..8657977,
FT                   8663902..8664308))
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /product="required for meiotic nuclear division 5 homolog B
FT                   (S. cerevisiae), transcript variant mCT170176"
FT                   /note="gene_id=mCG6982.2 transcript_id=mCT170176.0 created
FT                   on 21-JUN-2002"
FT   CDS             complement(join(8652414..8652477,8652560..8652714,
FT                   8652806..8652908,8654000..8654165,8655052..8655218,
FT                   8655315..8655415,8655938..8656078,8656196..8656341,
FT                   8657792..8657930))
FT                   /codon_start=1
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /product="required for meiotic nuclear division 5 homolog B
FT                   (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG6982.2 transcript_id=mCT170175.0
FT                   protein_id=mCP93024.0 isoform=CRA_c"
FT                   /protein_id="EDL33656.1"
FT   CDS             complement(join(8652414..8652477,8652560..8652714,
FT                   8652806..8652908,8654000..8654165,8655052..8655218,
FT                   8655315..8655415,8655938..8656078,8656196..8656341,
FT                   8657792..8657930))
FT                   /codon_start=1
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /product="required for meiotic nuclear division 5 homolog B
FT                   (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG6982.2 transcript_id=mCT5635.2
FT                   protein_id=mCP7938.1 isoform=CRA_c"
FT                   /protein_id="EDL33657.1"
FT   CDS             complement(join(8652556..8652714,8652806..8652908,
FT                   8654000..8654165,8655052..8655218,8655315..8655415,
FT                   8655938..8656078,8656196..8656341,8657792..8657930))
FT                   /codon_start=1
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /product="required for meiotic nuclear division 5 homolog B
FT                   (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG6982.2 transcript_id=mCT170176.0
FT                   protein_id=mCP93003.0 isoform=CRA_b"
FT                   /protein_id="EDL33655.1"
FT   mRNA            complement(join(8657648..8657977,8663902..8664308))
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /product="required for meiotic nuclear division 5 homolog B
FT                   (S. cerevisiae), transcript variant mCT170174"
FT                   /note="gene_id=mCG6982.2 transcript_id=mCT170174.0 created
FT                   on 21-JUN-2002"
FT   CDS             complement(8657763..8657930)
FT                   /codon_start=1
FT                   /gene="Rmnd5b"
FT                   /locus_tag="mCG_6982"
FT                   /product="required for meiotic nuclear division 5 homolog B
FT                   (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG6982.2 transcript_id=mCT170174.0
FT                   protein_id=mCP93014.0 isoform=CRA_a"
FT                   /protein_id="EDL33654.1"
FT                   AGGWPSPGTT"
FT   gene            complement(8667200..>8668837)
FT                   /locus_tag="mCG_1037759"
FT                   /note="gene_id=mCG1037759.0"
FT   mRNA            complement(join(8667200..8668454,8668645..>8668837))
FT                   /locus_tag="mCG_1037759"
FT                   /product="mCG1037759"
FT                   /note="gene_id=mCG1037759.0 transcript_id=mCT155463.0
FT                   created on 21-JUN-2002"
FT   CDS             complement(8667572..>8667874)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037759"
FT                   /product="mCG1037759"
FT                   /note="gene_id=mCG1037759.0 transcript_id=mCT155463.0
FT                   protein_id=mCP81097.0"
FT                   /protein_id="EDL33653.1"
FT   gene            complement(8671564..8731543)
FT                   /gene="C330016O10Rik"
FT                   /locus_tag="mCG_6981"
FT                   /note="gene_id=mCG6981.2"
FT   mRNA            complement(join(8671564..8672649,8672776..8673030,
FT                   8673674..8674186,8674428..8674775,8676509..8676663,
FT                   8679179..8679565,8731506..8731543))
FT                   /gene="C330016O10Rik"
FT                   /locus_tag="mCG_6981"
FT                   /product="RIKEN cDNA C330016O10, transcript variant
FT                   mCT170172"
FT                   /note="gene_id=mCG6981.2 transcript_id=mCT170172.0 created
FT                   on 21-JUN-2002"
FT   mRNA            complement(join(8671564..8672649,8672776..8673030,
FT                   8673674..8674186,8674428..8674775,8679179..8679575))
FT                   /gene="C330016O10Rik"
FT                   /locus_tag="mCG_6981"
FT                   /product="RIKEN cDNA C330016O10, transcript variant
FT                   mCT5634"
FT                   /note="gene_id=mCG6981.2 transcript_id=mCT5634.2 created on
FT                   21-JUN-2002"
FT   mRNA            complement(join(8671564..8672649,8672776..8673030,
FT                   8673674..8674186,8674428..8674775,8678650..8678855,
FT                   8679179..8679321))
FT                   /gene="C330016O10Rik"
FT                   /locus_tag="mCG_6981"
FT                   /product="RIKEN cDNA C330016O10, transcript variant
FT                   mCT170173"
FT                   /note="gene_id=mCG6981.2 transcript_id=mCT170173.0 created
FT                   on 21-JUN-2002"
FT   CDS             complement(join(8672122..8672649,8672776..8673030,
FT                   8673674..8674186,8674428..8674745))
FT                   /codon_start=1
FT                   /gene="C330016O10Rik"
FT                   /locus_tag="mCG_6981"
FT                   /product="RIKEN cDNA C330016O10, isoform CRA_a"
FT                   /note="gene_id=mCG6981.2 transcript_id=mCT170172.0
FT                   protein_id=mCP93013.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C7U1"
FT                   /db_xref="MGI:MGI:2442218"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C7U1"
FT                   /protein_id="EDL33646.1"
FT   CDS             complement(join(8672122..8672649,8672776..8673030,
FT                   8673674..8674186,8674428..8674745))
FT                   /codon_start=1
FT                   /gene="C330016O10Rik"
FT                   /locus_tag="mCG_6981"
FT                   /product="RIKEN cDNA C330016O10, isoform CRA_a"
FT                   /note="gene_id=mCG6981.2 transcript_id=mCT170173.0
FT                   protein_id=mCP93007.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C7U1"
FT                   /db_xref="MGI:MGI:2442218"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C7U1"
FT                   /protein_id="EDL33647.1"
FT   CDS             complement(join(8672122..8672649,8672776..8673030,
FT                   8673674..8674186,8674428..8674745))
FT                   /codon_start=1
FT                   /gene="C330016O10Rik"
FT                   /locus_tag="mCG_6981"
FT                   /product="RIKEN cDNA C330016O10, isoform CRA_a"
FT                   /note="gene_id=mCG6981.2 transcript_id=mCT5634.2
FT                   protein_id=mCP7937.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C7U1"
FT                   /db_xref="MGI:MGI:2442218"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C7U1"
FT                   /protein_id="EDL33648.1"
FT   gene            <8679455..8686182
FT                   /gene="D930048N14Rik"
FT                   /locus_tag="mCG_146301"
FT                   /note="gene_id=mCG146301.0"
FT   mRNA            join(<8679455..8679715,8682236..8682373,8682494..8682615,
FT                   8683275..8686182)
FT                   /gene="D930048N14Rik"
FT                   /locus_tag="mCG_146301"
FT                   /product="RIKEN cDNA D930048N14"
FT                   /note="gene_id=mCG146301.0 transcript_id=mCT186404.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<8679570..8679715,8682236..8682373,8682494..8682615,
FT                   8683275..8683462)
FT                   /codon_start=1
FT                   /gene="D930048N14Rik"
FT                   /locus_tag="mCG_146301"
FT                   /product="RIKEN cDNA D930048N14"
FT                   /note="gene_id=mCG146301.0 transcript_id=mCT186404.0
FT                   protein_id=mCP107649.0"
FT                   /protein_id="EDL33652.1"
FT   assembly_gap    8692288..8692307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8694642..8694661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8709358..8712851)
FT                   /locus_tag="mCG_6979"
FT                   /note="gene_id=mCG6979.2"
FT   mRNA            complement(join(8709358..8710069,8712525..8712611))
FT                   /locus_tag="mCG_6979"
FT                   /product="mCG6979, transcript variant mCT5639"
FT                   /note="gene_id=mCG6979.2 transcript_id=mCT5639.1 created on
FT                   05-FEB-2003"
FT   mRNA            complement(join(8709358..8710069,8712337..8712485))
FT                   /locus_tag="mCG_6979"
FT                   /product="mCG6979, transcript variant mCT170170"
FT                   /note="gene_id=mCG6979.2 transcript_id=mCT170170.0 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(8709362..8710069,8712667..8712851))
FT                   /locus_tag="mCG_6979"
FT                   /product="mCG6979, transcript variant mCT179888"
FT                   /note="gene_id=mCG6979.2 transcript_id=mCT179888.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(8709624..8710046)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6979"
FT                   /product="mCG6979, isoform CRA_a"
FT                   /note="gene_id=mCG6979.2 transcript_id=mCT170170.0
FT                   protein_id=mCP93001.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R3W2"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="MGI:MGI:1913300"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R3W2"
FT                   /protein_id="EDL33649.1"
FT   CDS             complement(8709624..8710046)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6979"
FT                   /product="mCG6979, isoform CRA_a"
FT                   /note="gene_id=mCG6979.2 transcript_id=mCT179888.0
FT                   protein_id=mCP102810.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R3W2"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="MGI:MGI:1913300"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R3W2"
FT                   /protein_id="EDL33650.1"
FT   CDS             complement(8709624..8710046)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6979"
FT                   /product="mCG6979, isoform CRA_a"
FT                   /note="gene_id=mCG6979.2 transcript_id=mCT5639.1
FT                   protein_id=mCP7932.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R3W2"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="MGI:MGI:1913300"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R3W2"
FT                   /protein_id="EDL33651.1"
FT   gene            complement(8718425..8787747)
FT                   /gene="Sec24a"
FT                   /locus_tag="mCG_6997"
FT                   /note="gene_id=mCG6997.2"
FT   mRNA            complement(join(8718425..8719218,8720626..8720729,
FT                   8724791..8724883,8725135..8725239,8728253..8728390,
FT                   8731177..8731352,8732992..8733102,8736246..8736419,
FT                   8737588..8737746,8739182..8739302,8740496..8740702,
FT                   8741781..8741836,8745872..8745990,8747641..8747753,
FT                   8750542..8750651,8753509..8753635,8755860..8755962,
FT                   8757449..8757621,8757827..8757984,8758641..8758718,
FT                   8760408..8760578,8767666..8768130,8780198..8780955,
FT                   8787674..8787747))
FT                   /gene="Sec24a"
FT                   /locus_tag="mCG_6997"
FT                   /product="SEC24 related gene family, member A (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG6997.2 transcript_id=mCT5626.2 created on
FT                   21-JUN-2002"
FT   CDS             complement(join(8719104..8719218,8720626..8720729,
FT                   8724791..8724883,8725135..8725239,8728253..8728390,
FT                   8731177..8731352,8732992..8733102,8736246..8736419,
FT                   8737588..8737746,8739182..8739302,8740496..8740702,
FT                   8741781..8741836,8745872..8745990,8747641..8747753,
FT                   8750542..8750651,8753509..8753635,8755860..8755962,
FT                   8757449..8757621,8757827..8757984,8758641..8758718,
FT                   8760408..8760578,8767666..8768130,8780198..8780294))
FT                   /codon_start=1
FT                   /gene="Sec24a"
FT                   /locus_tag="mCG_6997"
FT                   /product="SEC24 related gene family, member A (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG6997.2 transcript_id=mCT5626.2
FT                   protein_id=mCP7935.2"
FT                   /protein_id="EDL33645.1"
FT   assembly_gap    8729854..8729996
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    8761519..8761538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8787777..8816065
FT                   /gene="Sar1b"
FT                   /locus_tag="mCG_6993"
FT                   /note="gene_id=mCG6993.2"
FT   mRNA            join(8787777..8787906,8801600..8801674,8803802..8803921,
FT                   8806885..8806950,8812263..8812366,8813310..8813441,
FT                   8815440..8816065)
FT                   /gene="Sar1b"
FT                   /locus_tag="mCG_6993"
FT                   /product="SAR1 gene homolog B (S. cerevisiae)"
FT                   /note="gene_id=mCG6993.2 transcript_id=mCT5622.2 created on
FT                   21-JUN-2002"
FT   CDS             join(8801617..8801674,8803802..8803921,8806885..8806950,
FT                   8812263..8812366,8813310..8813441,8815440..8815556)
FT                   /codon_start=1
FT                   /gene="Sar1b"
FT                   /locus_tag="mCG_6993"
FT                   /product="SAR1 gene homolog B (S. cerevisiae)"
FT                   /note="gene_id=mCG6993.2 transcript_id=mCT5622.2
FT                   protein_id=mCP7925.2"
FT                   /db_xref="GOA:Q0VGU0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1913647"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VGU0"
FT                   /protein_id="EDL33644.1"
FT   gene            complement(8840873..8879027)
FT                   /gene="Phf15"
FT                   /locus_tag="mCG_6986"
FT                   /note="gene_id=mCG6986.2"
FT   mRNA            complement(join(8840873..8841811,8842608..8842739,
FT                   8845190..8845307,8849054..8849518,8850670..8850786,
FT                   8852377..8852544,8854527..8854738,8855364..8855524,
FT                   8859684..8859841,8870717..8870811,8873105..8873162,
FT                   8878936..8879027))
FT                   /gene="Phf15"
FT                   /locus_tag="mCG_6986"
FT                   /product="PHD finger protein 15, transcript variant
FT                   mCT5629"
FT                   /note="gene_id=mCG6986.2 transcript_id=mCT5629.2 created on
FT                   21-JUN-2002"
FT   mRNA            complement(join(8841005..8841811,8845190..8845307,
FT                   8849054..8849518,8850670..8850786,8852377..8852544,
FT                   8854527..8854738,8855364..8855587,8859684..8859841,
FT                   8870717..8870811,8873105..>8873162))
FT                   /gene="Phf15"
FT                   /locus_tag="mCG_6986"
FT                   /product="PHD finger protein 15, transcript variant
FT                   mCT193115"
FT                   /note="gene_id=mCG6986.2 transcript_id=mCT193115.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(8841114..8841811,8842608..8842739,
FT                   8845190..8845307,8849054..8849518,8850670..8850786,
FT                   8852377..8852544,8854527..8854738,8855364..8855524,
FT                   8859684..8859841,8870717..8870811,8873105..8873162))
FT                   /codon_start=1
FT                   /gene="Phf15"
FT                   /locus_tag="mCG_6986"
FT                   /product="PHD finger protein 15, isoform CRA_b"
FT                   /note="gene_id=mCG6986.2 transcript_id=mCT5629.2
FT                   protein_id=mCP7941.2 isoform=CRA_b"
FT                   /protein_id="EDL33643.1"
FT   CDS             complement(join(8841114..8841811,8845190..8845307,
FT                   8849054..8849518,8850670..8850786,8852377..8852544,
FT                   8854527..8854738,8855364..8855587,8859684..8859841,
FT                   8870717..8870811,8873105..8873162))
FT                   /codon_start=1
FT                   /gene="Phf15"
FT                   /locus_tag="mCG_6986"
FT                   /product="PHD finger protein 15, isoform CRA_a"
FT                   /note="gene_id=mCG6986.2 transcript_id=mCT193115.0
FT                   protein_id=mCP114106.0 isoform=CRA_a"
FT                   /protein_id="EDL33642.1"
FT                   RPKVSLHFDTEADGYFF"
FT   assembly_gap    8874350..8874373
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    8877519..8877625
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    8879492..8880030
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    8881080..8881930
FT                   /estimated_length=851
FT                   /gap_type="unknown"
FT   assembly_gap    8882644..8882663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8899525..8899573
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    8904960..8905133
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    8908252..8908559
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    8916132..8916151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8952330..8952776
FT                   /estimated_length=447
FT                   /gap_type="unknown"
FT   assembly_gap    8969075..8969181
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    8973692..8973714
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    8981247..8981266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8992948..9080343
FT                   /gene="D11Ertd497e"
FT                   /locus_tag="mCG_6991"
FT                   /note="gene_id=mCG6991.2"
FT   mRNA            join(<8992948..8993247,8995434..8995533,9001190..9002626,
FT                   9080320..9080343)
FT                   /gene="D11Ertd497e"
FT                   /locus_tag="mCG_6991"
FT                   /product="DNA segment, Chr 11, ERATO Doi 497, expressed,
FT                   transcript variant mCT5620"
FT                   /note="gene_id=mCG6991.2 transcript_id=mCT5620.2 created on
FT                   20-JUN-2002"
FT   CDS             join(<8992949..8993247,8995434..8995533,9001190..9001201)
FT                   /codon_start=1
FT                   /gene="D11Ertd497e"
FT                   /locus_tag="mCG_6991"
FT                   /product="DNA segment, Chr 11, ERATO Doi 497, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6991.2 transcript_id=mCT5620.2
FT                   protein_id=mCP7924.0 isoform=CRA_b"
FT                   /protein_id="EDL33637.1"
FT   mRNA            join(<8992953..8993247,8993516..8993641,8995434..8995533,
FT                   9001190..9001490,9002025..9002620)
FT                   /gene="D11Ertd497e"
FT                   /locus_tag="mCG_6991"
FT                   /product="DNA segment, Chr 11, ERATO Doi 497, expressed,
FT                   transcript variant mCT170184"
FT                   /note="gene_id=mCG6991.2 transcript_id=mCT170184.0 created
FT                   on 20-JUN-2002"
FT   CDS             join(<8992955..8993247,8993516..8993603)
FT                   /codon_start=1
FT                   /gene="D11Ertd497e"
FT                   /locus_tag="mCG_6991"
FT                   /product="DNA segment, Chr 11, ERATO Doi 497, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6991.2 transcript_id=mCT170184.0
FT                   protein_id=mCP93011.0 isoform=CRA_a"
FT                   /protein_id="EDL33636.1"
FT   gene            <9010437..9011923
FT                   /locus_tag="mCG_117942"
FT                   /note="gene_id=mCG117942.1"
FT   mRNA            join(<9010437..9011065,9011774..9011923)
FT                   /locus_tag="mCG_117942"
FT                   /product="mCG117942"
FT                   /note="gene_id=mCG117942.1 transcript_id=mCT119089.1
FT                   created on 20-JUN-2002"
FT   CDS             <9010491..9010790
FT                   /codon_start=1
FT                   /locus_tag="mCG_117942"
FT                   /product="mCG117942"
FT                   /note="gene_id=mCG117942.1 transcript_id=mCT119089.1
FT                   protein_id=mCP80951.0"
FT                   /protein_id="EDL33641.1"
FT   gene            complement(9010852..9026049)
FT                   /gene="Ube2b"
FT                   /locus_tag="mCG_6978"
FT                   /note="gene_id=mCG6978.2"
FT   mRNA            complement(join(9010852..9012100,9013902..9013990,
FT                   9016684..9016773,9020664..9020689,9023108..9023188,
FT                   9025582..9025650,9025966..9026049))
FT                   /gene="Ube2b"
FT                   /locus_tag="mCG_6978"
FT                   /product="ubiquitin-conjugating enzyme E2B, RAD6 homology
FT                   (S. cerevisiae), transcript variant mCT170168"
FT                   /note="gene_id=mCG6978.2 transcript_id=mCT170168.0 created
FT                   on 20-JUN-2002"
FT   mRNA            complement(join(9010852..9012100,9013902..9013990,
FT                   9016684..9016773,9023108..9023188,9025582..9025773))
FT                   /gene="Ube2b"
FT                   /locus_tag="mCG_6978"
FT                   /product="ubiquitin-conjugating enzyme E2B, RAD6 homology
FT                   (S. cerevisiae), transcript variant mCT170169"
FT                   /note="gene_id=mCG6978.2 transcript_id=mCT170169.0 created
FT                   on 20-JUN-2002"
FT   mRNA            complement(join(9010852..9012100,9013902..9013990,
FT                   9016684..9016773,9020664..9020689,9023108..9023188,
FT                   9025582..9025773))
FT                   /gene="Ube2b"
FT                   /locus_tag="mCG_6978"
FT                   /product="ubiquitin-conjugating enzyme E2B, RAD6 homology
FT                   (S. cerevisiae), transcript variant mCT5638"
FT                   /note="gene_id=mCG6978.2 transcript_id=mCT5638.2 created on
FT                   20-JUN-2002"
FT   CDS             complement(join(9011972..9012100,9013902..9013990,
FT                   9016684..9016773,9020664..9020689,9023108..9023188,
FT                   9025582..9025625))
FT                   /codon_start=1
FT                   /gene="Ube2b"
FT                   /locus_tag="mCG_6978"
FT                   /product="ubiquitin-conjugating enzyme E2B, RAD6 homology
FT                   (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG6978.2 transcript_id=mCT5638.2
FT                   protein_id=mCP7929.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2RSE4"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:102944"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSE4"
FT                   /protein_id="EDL33639.1"
FT   CDS             complement(join(9011972..9012100,9013902..9013990,
FT                   9016684..9016773,9020664..9020689,9023108..9023188,
FT                   9025582..9025625))
FT                   /codon_start=1
FT                   /gene="Ube2b"
FT                   /locus_tag="mCG_6978"
FT                   /product="ubiquitin-conjugating enzyme E2B, RAD6 homology
FT                   (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG6978.2 transcript_id=mCT170168.0
FT                   protein_id=mCP93022.0 isoform=CRA_b"
FT                   /db_xref="GOA:A2RSE4"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:102944"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSE4"
FT                   /protein_id="EDL33640.1"
FT   CDS             complement(join(9011972..9012100,9013902..9013990,
FT                   9016684..9016773,9023108..9023123))
FT                   /codon_start=1
FT                   /gene="Ube2b"
FT                   /locus_tag="mCG_6978"
FT                   /product="ubiquitin-conjugating enzyme E2B, RAD6 homology
FT                   (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG6978.2 transcript_id=mCT170169.0
FT                   protein_id=mCP93021.0 isoform=CRA_a"
FT                   /protein_id="EDL33638.1"
FT                   NDS"
FT   gene            <9029502..9115044
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /note="gene_id=mCG6987.2"
FT   mRNA            join(9029502..9029793,9030196..9030375,9036414..9036608,
FT                   9043544..9043722,9044997..9045109,9048001..9048140,
FT                   9051102..9051190,9052022..9052181,9052276..9052604,
FT                   9055105..9055198,9057175..9057337,9058327..9058424,
FT                   9060760..9060833,9109641..9109760,9114857..9115044)
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, transcript
FT                   variant mCT170179"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT170179.0 created
FT                   on 20-JUN-2002"
FT   mRNA            join(<9029502..9029793,9030196..9030375,9036414..9036608,
FT                   9043544..9043722,9044997..9045109,9048001..9048140,
FT                   9051102..9051190,9052022..9052181,9052276..9052604,
FT                   9055105..9055198,9057175..9057337,9058327..9058424,
FT                   9065333..9065392,9109641..9109937)
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, transcript
FT                   variant mCT193117"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT193117.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(9029523..9029700,9030193..9030375,9036414..9036608,
FT                   9043544..9043722,9044997..9045109,9048001..9048140,
FT                   9051102..9051190,9052022..9052181,9052276..9052604,
FT                   9055105..9055198,9057175..9057337,9058327..9058424,
FT                   9065333..9065392,9109641..9109760,9114857..9115044)
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, transcript
FT                   variant mCT170181"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT170181.0 created
FT                   on 20-JUN-2002"
FT   mRNA            join(9029523..9029700,9030196..9030375,9036414..9036608,
FT                   9043544..9043722,9044997..9045109,9048001..9048140,
FT                   9051102..9051190,9052022..9052181,9052276..9052604,
FT                   9055105..9055198,9057175..9057337,9058327..9058424,
FT                   9109641..9109760,9114857..9115044)
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, transcript
FT                   variant mCT5630"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT5630.2 created on
FT                   20-JUN-2002"
FT   mRNA            join(9029558..9029610,9030196..9030375,9036414..9036608,
FT                   9043544..9043722,9044997..9045109,9048001..9048140,
FT                   9051102..9051190,9052022..9052181,9052276..9052604,
FT                   9055105..9055198,9057175..9057337,9058327..9058424,
FT                   9109644..9109760,9114857..9115038)
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, transcript
FT                   variant mCT170180"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT170180.0 created
FT                   on 20-JUN-2002"
FT   CDS             join(<9029677..9029793,9030196..9030375,9036414..9036608,
FT                   9043544..9043722,9044997..9045109,9048001..9048140,
FT                   9051102..9051190,9052022..9052181,9052276..9052604,
FT                   9055105..9055198,9057175..9057337,9058327..9058424,
FT                   9065333..9065365)
FT                   /codon_start=1
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, isoform CRA_d"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT193117.0
FT                   protein_id=mCP114107.0 isoform=CRA_d"
FT                   /protein_id="EDL33634.1"
FT   CDS             join(9030211..9030375,9036414..9036608,9043544..9043722,
FT                   9044997..9045109,9048001..9048140,9051102..9051190,
FT                   9052022..9052181,9052276..9052604,9055105..9055198,
FT                   9057175..9057337,9058327..9058424,9060760..9060833,
FT                   9109641..9109758)
FT                   /codon_start=1
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, isoform CRA_a"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT170179.0
FT                   protein_id=mCP93020.0 isoform=CRA_a"
FT                   /protein_id="EDL33631.1"
FT                   LLL"
FT   CDS             join(9030211..9030375,9036414..9036608,9043544..9043722,
FT                   9044997..9045109,9048001..9048140,9051102..9051190,
FT                   9052022..9052181,9052276..9052604,9055105..9055198,
FT                   9057175..9057337,9058327..9058424,9109641..9109709)
FT                   /codon_start=1
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, isoform CRA_e"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT5630.2
FT                   protein_id=mCP7922.2 isoform=CRA_e"
FT                   /protein_id="EDL33635.1"
FT   CDS             join(9030211..9030375,9036414..9036608,9043544..9043722,
FT                   9044997..9045109,9048001..9048140,9051102..9051190,
FT                   9052022..9052181,9052276..9052604,9055105..9055198,
FT                   9057175..9057337,9058327..9058424,9109644..9109709)
FT                   /codon_start=1
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, isoform CRA_b"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT170180.0
FT                   protein_id=mCP93008.0 isoform=CRA_b"
FT                   /protein_id="EDL33632.1"
FT   CDS             join(9030211..9030375,9036414..9036608,9043544..9043722,
FT                   9044997..9045109,9048001..9048140,9051102..9051190,
FT                   9052022..9052181,9052276..9052604,9055105..9055198,
FT                   9057175..9057337,9058327..9058424,9065333..9065365)
FT                   /codon_start=1
FT                   /gene="Cdkl3"
FT                   /locus_tag="mCG_6987"
FT                   /product="cyclin-dependent kinase-like 3, isoform CRA_c"
FT                   /note="gene_id=mCG6987.2 transcript_id=mCT170181.0
FT                   protein_id=mCP93009.0 isoform=CRA_c"
FT                   /protein_id="EDL33633.1"
FT                   SARHLPGQC"
FT   assembly_gap    9042671..9042690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9069292..9069364
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    9091646..9091695
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    9096725..9097232
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    9098876..9098895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9100753..9100984
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    9120315..9120473
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            9124072..9148722
FT                   /gene="Ppp2ca"
FT                   /locus_tag="mCG_6990"
FT                   /note="gene_id=mCG6990.2"
FT   mRNA            join(9124072..9124531,9138435..9138644,9143302..9143475,
FT                   9143984..9144073,9144458..9144619,9146248..9146366,
FT                   9147217..9148722)
FT                   /gene="Ppp2ca"
FT                   /locus_tag="mCG_6990"
FT                   /product="protein phosphatase 2 (formerly 2A), catalytic
FT                   subunit, alpha isoform, transcript variant mCT5619"
FT                   /note="gene_id=mCG6990.2 transcript_id=mCT5619.1 created on
FT                   20-JUN-2002"
FT   mRNA            join(9124217..9124278,9124390..9124419,9146327..9146366,
FT                   9147217..9148722)
FT                   /gene="Ppp2ca"
FT                   /locus_tag="mCG_6990"
FT                   /product="protein phosphatase 2 (formerly 2A), catalytic
FT                   subunit, alpha isoform, transcript variant mCT170182"
FT                   /note="gene_id=mCG6990.2 transcript_id=mCT170182.0 created
FT                   on 20-JUN-2002"
FT   mRNA            join(9124221..9124268,9124393..9124531,9138435..9138644,
FT                   9143302..9143475,9143984..9144073,9144458..9144619,
FT                   9146248..9146366,9147217..9148722)
FT                   /gene="Ppp2ca"
FT                   /locus_tag="mCG_6990"
FT                   /product="protein phosphatase 2 (formerly 2A), catalytic
FT                   subunit, alpha isoform, transcript variant mCT170183"
FT                   /note="gene_id=mCG6990.2 transcript_id=mCT170183.0 created
FT                   on 20-JUN-2002"
FT   CDS             join(9124430..9124531,9138435..9138644,9143302..9143475,
FT                   9143984..9144073,9144458..9144619,9146248..9146366,
FT                   9147217..9147289)
FT                   /codon_start=1
FT                   /gene="Ppp2ca"
FT                   /locus_tag="mCG_6990"
FT                   /product="protein phosphatase 2 (formerly 2A), catalytic
FT                   subunit, alpha isoform, isoform CRA_b"
FT                   /note="gene_id=mCG6990.2 transcript_id=mCT170183.0
FT                   protein_id=mCP93010.0 isoform=CRA_b"
FT                   /protein_id="EDL33629.1"
FT   CDS             join(9124430..9124531,9138435..9138644,9143302..9143475,
FT                   9143984..9144073,9144458..9144619,9146248..9146366,
FT                   9147217..9147289)
FT                   /codon_start=1
FT                   /gene="Ppp2ca"
FT                   /locus_tag="mCG_6990"
FT                   /product="protein phosphatase 2 (formerly 2A), catalytic
FT                   subunit, alpha isoform, isoform CRA_b"
FT                   /note="gene_id=mCG6990.2 transcript_id=mCT5619.1
FT                   protein_id=mCP7926.0 isoform=CRA_b"
FT                   /protein_id="EDL33630.1"
FT   assembly_gap    9130797..9130816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9146335..9146366,9147217..9147289)
FT                   /codon_start=1
FT                   /gene="Ppp2ca"
FT                   /locus_tag="mCG_6990"
FT                   /product="protein phosphatase 2 (formerly 2A), catalytic
FT                   subunit, alpha isoform, isoform CRA_a"
FT                   /note="gene_id=mCG6990.2 transcript_id=mCT170182.0
FT                   protein_id=mCP92999.0 isoform=CRA_a"
FT                   /protein_id="EDL33628.1"
FT   gene            <9151740..9152536
FT                   /locus_tag="mCG_1037757"
FT                   /note="gene_id=mCG1037757.0"
FT   mRNA            join(<9151740..9152069,9152351..9152536)
FT                   /locus_tag="mCG_1037757"
FT                   /product="mCG1037757"
FT                   /note="gene_id=mCG1037757.0 transcript_id=mCT155461.1
FT                   created on 20-JUN-2002"
FT   CDS             <9151740..9152054
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037757"
FT                   /product="mCG1037757"
FT                   /note="gene_id=mCG1037757.0 transcript_id=mCT155461.1
FT                   protein_id=mCP81092.0"
FT                   /protein_id="EDL33627.1"
FT                   "
FT   assembly_gap    9152309..9152328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<9170087..>9171022)
FT                   /locus_tag="mCG_1037699"
FT                   /note="gene_id=mCG1037699.1"
FT   mRNA            complement(<9170087..>9171022)
FT                   /locus_tag="mCG_1037699"
FT                   /product="mCG1037699"
FT                   /note="gene_id=mCG1037699.1 transcript_id=mCT155403.1
FT                   created on 20-JUN-2002"
FT   CDS             complement(9170087..9171022)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037699"
FT                   /product="mCG1037699"
FT                   /note="gene_id=mCG1037699.1 transcript_id=mCT155403.1
FT                   protein_id=mCP80886.1"
FT                   /db_xref="GOA:Q7TQT6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031207"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQT6"
FT                   /protein_id="EDL33626.1"
FT   gene            complement(9180376..9183404)
FT                   /gene="NP_TR6JSE50FPA"
FT                   /locus_tag="mCG_117931"
FT                   /note="gene_id=mCG117931.1"
FT   mRNA            complement(join(9180376..9182006,9183271..9183404))
FT                   /gene="NP_TR6JSE50FPA"
FT                   /locus_tag="mCG_117931"
FT                   /product="olfactory receptor NP_TR6JSE50FPA"
FT                   /note="gene_id=mCG117931.1 transcript_id=mCT119078.1
FT                   created on 20-JUN-2002"
FT   CDS             complement(9180740..9181777)
FT                   /codon_start=1
FT                   /gene="NP_TR6JSE50FPA"
FT                   /locus_tag="mCG_117931"
FT                   /product="olfactory receptor NP_TR6JSE50FPA"
FT                   /note="gene_id=mCG117931.1 transcript_id=mCT119078.1
FT                   protein_id=mCP80953.1"
FT                   /protein_id="EDL33625.1"
FT                   EDIPQ"
FT   assembly_gap    9184540..9184559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9198352..9199574
FT                   /estimated_length=1223
FT                   /gap_type="unknown"
FT   assembly_gap    9212158..9215581
FT                   /estimated_length=3424
FT                   /gap_type="unknown"
FT   gene            complement(9215582..>9216911)
FT                   /locus_tag="mCG_1037756"
FT                   /note="gene_id=mCG1037756.0"
FT   mRNA            complement(join(9215582..9216310,9216354..>9216911))
FT                   /locus_tag="mCG_1037756"
FT                   /product="mCG1037756"
FT                   /note="gene_id=mCG1037756.0 transcript_id=mCT155460.1
FT                   created on 19-JUN-2002"
FT   CDS             complement(9215811..>9216023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037756"
FT                   /product="mCG1037756"
FT                   /note="gene_id=mCG1037756.0 transcript_id=mCT155460.1
FT                   protein_id=mCP81090.0"
FT                   /protein_id="EDL33624.1"
FT   gene            complement(<9239206..>9240141)
FT                   /locus_tag="mCG_117941"
FT                   /note="gene_id=mCG117941.1"
FT   mRNA            complement(<9239206..>9240141)
FT                   /locus_tag="mCG_117941"
FT                   /product="mCG117941"
FT                   /note="gene_id=mCG117941.1 transcript_id=mCT119088.1
FT                   created on 19-JUN-2002"
FT   CDS             complement(9239206..9240141)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117941"
FT                   /product="mCG117941"
FT                   /note="gene_id=mCG117941.1 transcript_id=mCT119088.1
FT                   protein_id=mCP80950.1"
FT                   /db_xref="GOA:Q7TQT7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031205"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TQT7"
FT                   /protein_id="EDL33623.1"
FT   assembly_gap    9248258..9248436
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            9258167..>9325566
FT                   /locus_tag="mCG_3634"
FT                   /note="gene_id=mCG3634.2"
FT   mRNA            join(9258167..9258276,9262995..9263091,9268745..9268818,
FT                   9269773..9269916,9271139..9271283,9325548..>9325566)
FT                   /locus_tag="mCG_3634"
FT                   /product="mCG3634, transcript variant mCT170163"
FT                   /note="gene_id=mCG3634.2 transcript_id=mCT170163.0 created
FT                   on 19-JUN-2002"
FT   mRNA            join(9258167..9258276,9262995..9263091,9268745..9268818,
FT                   9269773..9269916,9271139..9271279,9272143..9273016)
FT                   /locus_tag="mCG_3634"
FT                   /product="mCG3634, transcript variant mCT3091"
FT                   /note="gene_id=mCG3634.2 transcript_id=mCT3091.2 created on
FT                   19-JUN-2002"
FT   CDS             join(9262995..9263091,9268745..9268818,9269773..9269916,
FT                   9271139..9271283,9325548..>9325566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3634"
FT                   /product="mCG3634, isoform CRA_a"
FT                   /note="gene_id=mCG3634.2 transcript_id=mCT170163.0
FT                   protein_id=mCP93006.0 isoform=CRA_a"
FT                   /protein_id="EDL33617.1"
FT   CDS             join(9262995..9263091,9268745..9268818,9269773..9269916,
FT                   9271139..9271279,9272143..9272178)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3634"
FT                   /product="mCG3634, isoform CRA_b"
FT                   /note="gene_id=mCG3634.2 transcript_id=mCT3091.2
FT                   protein_id=mCP14233.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SUR3"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="MGI:MGI:103575"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUR3"
FT                   /protein_id="EDL33618.1"
FT                   "
FT   gene            complement(9264042..>9266460)
FT                   /locus_tag="mCG_1037755"
FT                   /note="gene_id=mCG1037755.0"
FT   mRNA            complement(join(9264042..9264527,9266397..>9266460))
FT                   /locus_tag="mCG_1037755"
FT                   /product="mCG1037755"
FT                   /note="gene_id=mCG1037755.0 transcript_id=mCT155459.0
FT                   created on 19-JUN-2002"
FT   CDS             complement(9264166..>9264453)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037755"
FT                   /product="mCG1037755"
FT                   /note="gene_id=mCG1037755.0 transcript_id=mCT155459.0
FT                   protein_id=mCP81085.0"
FT                   /protein_id="EDL33622.1"
FT   gene            complement(9278447..9309970)
FT                   /gene="Tcf7"
FT                   /locus_tag="mCG_3635"
FT                   /note="gene_id=mCG3635.2"
FT   mRNA            complement(join(9278447..9280120,9282416..9282464,
FT                   9282898..9283005,9283107..9283269,9283842..9283961,
FT                   9285011..9285103,9286689..9286779,9287671..9287782,
FT                   9308734..9308858,9309324..9309390,9309540..9309970))
FT                   /gene="Tcf7"
FT                   /locus_tag="mCG_3635"
FT                   /product="transcription factor 7, T-cell specific,
FT                   transcript variant mCT3092"
FT                   /note="gene_id=mCG3635.2 transcript_id=mCT3092.2 created on
FT                   19-JUN-2002"
FT   mRNA            complement(join(9278447..9280143,9282416..9282464,
FT                   9282898..9283005,9283107..9283269,9283842..9283961,
FT                   9285011..9285103,9286689..9286779,9287671..9287782,
FT                   9308734..9308858,9309324..9309390,9309540..9309970))
FT                   /gene="Tcf7"
FT                   /locus_tag="mCG_3635"
FT                   /product="transcription factor 7, T-cell specific,
FT                   transcript variant mCT170164"
FT                   /note="gene_id=mCG3635.2 transcript_id=mCT170164.0 created
FT                   on 19-JUN-2002"
FT   CDS             complement(join(9280041..9280120,9282416..9282464,
FT                   9282898..9283005,9283107..9283269,9283842..9283961,
FT                   9285011..9285103,9286689..9286779,9287671..9287782,
FT                   9308734..9308858,9309324..9309390,9309540..9309791))
FT                   /codon_start=1
FT                   /gene="Tcf7"
FT                   /locus_tag="mCG_3635"
FT                   /product="transcription factor 7, T-cell specific, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3635.2 transcript_id=mCT3092.2
FT                   protein_id=mCP14230.2 isoform=CRA_a"
FT                   /protein_id="EDL33620.1"
FT   CDS             complement(join(9280121..9280143,9282416..9282464,
FT                   9282898..9283005,9283107..9283269,9283842..9283961,
FT                   9285011..9285103,9286689..9286779,9287671..9287782,
FT                   9308734..9308858,9309324..9309390,9309540..9309791))
FT                   /codon_start=1
FT                   /gene="Tcf7"
FT                   /locus_tag="mCG_3635"
FT                   /product="transcription factor 7, T-cell specific, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3635.2 transcript_id=mCT170164.0
FT                   protein_id=mCP93004.0 isoform=CRA_b"
FT                   /protein_id="EDL33621.1"
FT                   S"
FT   assembly_gap    9297610..9297629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9302665..9312791
FT                   /locus_tag="mCG_148143"
FT                   /note="gene_id=mCG148143.0"
FT   mRNA            join(9302665..9303053,9310195..9312791)
FT                   /locus_tag="mCG_148143"
FT                   /product="mCG148143"
FT                   /note="gene_id=mCG148143.0 transcript_id=mCT188406.0
FT                   created on 13-JAN-2004"
FT   CDS             9311186..9311428
FT                   /codon_start=1
FT                   /locus_tag="mCG_148143"
FT                   /product="mCG148143"
FT                   /note="gene_id=mCG148143.0 transcript_id=mCT188406.0
FT                   protein_id=mCP108588.0"
FT                   /protein_id="EDL33619.1"
FT   assembly_gap    9314098..9314117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9329336..9330907
FT                   /estimated_length=1572
FT                   /gap_type="unknown"
FT   assembly_gap    9369809..9370164
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    9374610..9374629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9384532..9384551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9385865..9386302
FT                   /locus_tag="mCG_1037753"
FT                   /note="gene_id=mCG1037753.0"
FT   mRNA            join(<9385865..9386011,9386061..9386302)
FT                   /locus_tag="mCG_1037753"
FT                   /product="mCG1037753"
FT                   /note="gene_id=mCG1037753.0 transcript_id=mCT155457.0
FT                   created on 19-JUN-2002"
FT   CDS             join(<9385919..9386011,9386061..9386198)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037753"
FT                   /product="mCG1037753"
FT                   /note="gene_id=mCG1037753.0 transcript_id=mCT155457.0
FT                   protein_id=mCP81078.0"
FT                   /protein_id="EDL33616.1"
FT   gene            9389626..9454147
FT                   /gene="Vdac1"
FT                   /locus_tag="mCG_3636"
FT                   /note="gene_id=mCG3636.2"
FT   mRNA            join(9389626..9389870,9403075..9403144,9403694..9403743,
FT                   9405167..9405319,9405424..9405476,9412628..9412872,
FT                   9454127..9454147)
FT                   /gene="Vdac1"
FT                   /locus_tag="mCG_3636"
FT                   /product="voltage-dependent anion channel 1, transcript
FT                   variant mCT170165"
FT                   /note="gene_id=mCG3636.2 transcript_id=mCT170165.0 created
FT                   on 19-JUN-2002"
FT   mRNA            join(9389626..9389870,9403075..9403144,9403694..9403743,
FT                   9405167..9405319,9405424..9405476,9412628..9412855,
FT                   9414361..9414511,9416194..9416251,9417210..9418174)
FT                   /gene="Vdac1"
FT                   /locus_tag="mCG_3636"
FT                   /product="voltage-dependent anion channel 1, transcript
FT                   variant mCT3093"
FT                   /note="gene_id=mCG3636.2 transcript_id=mCT3093.2 created on
FT                   19-JUN-2002"
FT   mRNA            join(9389833..9389870,9403075..9403144,9403694..9403743,
FT                   9405167..9405319,9405424..9405476,9412628..9412855,
FT                   9414361..9414511,9416194..9416251,9417210..9417536,
FT                   9418042..9418175)
FT                   /gene="Vdac1"
FT                   /locus_tag="mCG_3636"
FT                   /product="voltage-dependent anion channel 1, transcript
FT                   variant mCT170166"
FT                   /note="gene_id=mCG3636.2 transcript_id=mCT170166.0 created
FT                   on 19-JUN-2002"
FT   CDS             join(9403078..9403144,9403694..9403743,9405167..9405319,
FT                   9405424..9405476,9412628..9412855,9414361..9414511,
FT                   9416194..9416251,9417210..9417301)
FT                   /codon_start=1
FT                   /gene="Vdac1"
FT                   /locus_tag="mCG_3636"
FT                   /product="voltage-dependent anion channel 1, isoform CRA_b"
FT                   /note="gene_id=mCG3636.2 transcript_id=mCT170166.0
FT                   protein_id=mCP93016.0 isoform=CRA_b"
FT                   /protein_id="EDL33612.1"
FT                   QA"
FT   CDS             join(9403078..9403144,9403694..9403743,9405167..9405319,
FT                   9405424..9405476,9412628..9412855,9414361..9414511,
FT                   9416194..9416251,9417210..9417301)
FT                   /codon_start=1
FT                   /gene="Vdac1"
FT                   /locus_tag="mCG_3636"
FT                   /product="voltage-dependent anion channel 1, isoform CRA_b"
FT                   /note="gene_id=mCG3636.2 transcript_id=mCT3093.2
FT                   protein_id=mCP14231.1 isoform=CRA_b"
FT                   /protein_id="EDL33613.1"
FT                   QA"
FT   CDS             join(9403078..9403144,9403694..9403743,9405167..9405319,
FT                   9405424..9405476,9412628..9412859)
FT                   /codon_start=1
FT                   /gene="Vdac1"
FT                   /locus_tag="mCG_3636"
FT                   /product="voltage-dependent anion channel 1, isoform CRA_a"
FT                   /note="gene_id=mCG3636.2 transcript_id=mCT170165.0
FT                   protein_id=mCP93017.0 isoform=CRA_a"
FT                   /protein_id="EDL33611.1"
FT   gene            9425220..9437696
FT                   /gene="9530068E07Rik"
FT                   /locus_tag="mCG_3637"
FT                   /note="gene_id=mCG3637.2"
FT   mRNA            join(9425220..9425381,9431824..9432335,9435916..9436326,
FT                   9436482..9437696)
FT                   /gene="9530068E07Rik"
FT                   /locus_tag="mCG_3637"
FT                   /product="RIKEN cDNA 9530068E07, transcript variant
FT                   mCT3094"
FT                   /note="gene_id=mCG3637.2 transcript_id=mCT3094.2 created on
FT                   19-JUN-2002"
FT   mRNA            join(9425220..9425381,9431824..9432335,9435916..9436694)
FT                   /gene="9530068E07Rik"
FT                   /locus_tag="mCG_3637"
FT                   /product="RIKEN cDNA 9530068E07, transcript variant
FT                   mCT170167"
FT                   /note="gene_id=mCG3637.2 transcript_id=mCT170167.0 created
FT                   on 19-JUN-2002"
FT   CDS             join(9425246..9425381,9431824..9432335,9435916..9436047)
FT                   /codon_start=1
FT                   /gene="9530068E07Rik"
FT                   /locus_tag="mCG_3637"
FT                   /product="RIKEN cDNA 9530068E07, isoform CRA_a"
FT                   /note="gene_id=mCG3637.2 transcript_id=mCT170167.0
FT                   protein_id=mCP92998.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U339"
FT                   /db_xref="MGI:MGI:2654705"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U339"
FT                   /protein_id="EDL33614.1"
FT   CDS             join(9425246..9425381,9431824..9432335,9435916..9436047)
FT                   /codon_start=1
FT                   /gene="9530068E07Rik"
FT                   /locus_tag="mCG_3637"
FT                   /product="RIKEN cDNA 9530068E07, isoform CRA_a"
FT                   /note="gene_id=mCG3637.2 transcript_id=mCT3094.2
FT                   protein_id=mCP14232.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U339"
FT                   /db_xref="MGI:MGI:2654705"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U339"
FT                   /protein_id="EDL33615.1"
FT   assembly_gap    9434837..9435188
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    9437959..9437978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9439028..9439047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9442341..9442360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9443667..9443686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9445048..9445067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9449260..9449776
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    9457365..9458714
FT                   /estimated_length=1350
FT                   /gap_type="unknown"
FT   assembly_gap    9488094..9488113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9492787..9493324
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   gene            9510859..9512700
FT                   /pseudo
FT                   /locus_tag="mCG_140595"
FT                   /note="gene_id=mCG140595.0"
FT   mRNA            9510859..9512700
FT                   /pseudo
FT                   /locus_tag="mCG_140595"
FT                   /note="gene_id=mCG140595.0 transcript_id=mCT170185.0
FT                   created on 18-JUN-2002"
FT   gene            complement(9511427..9512700)
FT                   /locus_tag="mCG_113607"
FT                   /note="gene_id=mCG113607.1"
FT   mRNA            complement(9511427..9512700)
FT                   /locus_tag="mCG_113607"
FT                   /product="mCG113607"
FT                   /note="gene_id=mCG113607.1 transcript_id=mCT114692.1
FT                   created on 14-AUG-2002"
FT   CDS             complement(9512320..9512649)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113607"
FT                   /product="mCG113607"
FT                   /note="gene_id=mCG113607.1 transcript_id=mCT114692.1
FT                   protein_id=mCP81069.1"
FT                   /protein_id="EDL33610.1"
FT                   QGKKL"
FT   gene            <9517111..9517421
FT                   /locus_tag="mCG_1037752"
FT                   /note="gene_id=mCG1037752.0"
FT   mRNA            join(<9517111..9517287,9517311..9517421)
FT                   /locus_tag="mCG_1037752"
FT                   /product="mCG1037752"
FT                   /note="gene_id=mCG1037752.0 transcript_id=mCT155456.0
FT                   created on 18-JUN-2002"
FT   CDS             <9517118..9517279
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037752"
FT                   /product="mCG1037752"
FT                   /note="gene_id=mCG1037752.0 transcript_id=mCT155456.0
FT                   protein_id=mCP80989.0"
FT                   /protein_id="EDL33609.1"
FT                   VHLPLRPL"
FT   assembly_gap    9534043..9535276
FT                   /estimated_length=1234
FT                   /gap_type="unknown"
FT   assembly_gap    9540656..9541229
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    9589265..9589639
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    9596122..9596428
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    9611716..9611925
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    9622943..9622962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9690826..9691166
FT                   /estimated_length=341
FT                   /gap_type="unknown"
FT   assembly_gap    9712787..9712806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9727057..9727203
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    9747314..9747333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9753545..9753584
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    9755128..9755270
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    9761123..9762412
FT                   /estimated_length=1290
FT                   /gap_type="unknown"
FT   assembly_gap    9771573..9773023
FT                   /estimated_length=1451
FT                   /gap_type="unknown"
FT   assembly_gap    9777245..9779691
FT                   /estimated_length=2447
FT                   /gap_type="unknown"
FT   assembly_gap    9781155..9781174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9790052..9790071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9796594..9796673
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   gene            <9799576..10223671
FT                   /gene="Fstl4"
FT                   /locus_tag="mCG_17296"
FT                   /note="gene_id=mCG17296.3"
FT   mRNA            join(<9799576..9799803,9808756..9808891,9849565..9849598,
FT                   10037465..10037710,10105820..10106013,10109673..10109796,
FT                   10171181..10171347,10186044..10186164,10199697..10199858,
FT                   10200179..10200313,10201573..10201599,10202916..10203034,
FT                   10205333..10205482,10213575..10213682,10221294..10221403,
FT                   10222899..10223671)
FT                   /gene="Fstl4"
FT                   /locus_tag="mCG_17296"
FT                   /product="follistatin-like 4, transcript variant mCT193114"
FT                   /note="gene_id=mCG17296.3 transcript_id=mCT193114.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<9799576..9799803,9808756..9808891,9849565..9849598,
FT                   10037465..10037710,10105820..10106013,10109673..10109796,
FT                   10171181..10171347,10186044..10186164,10199697..10199858,
FT                   10200179..10200313,10202916..10203034,10205333..10205482,
FT                   10213575..10213682,10221294..10221403,10222899..10223667)
FT                   /gene="Fstl4"
FT                   /locus_tag="mCG_17296"
FT                   /product="follistatin-like 4, transcript variant mCT17323"
FT                   /note="gene_id=mCG17296.3 transcript_id=mCT17323.2 created
FT                   on 18-JUN-2002"
FT   CDS             join(<9799658..9799803,9808756..9808891,9849565..9849598,
FT                   10037465..10037710,10105820..10106013,10109673..10109796,
FT                   10171181..10171347,10186044..10186164,10199697..10199858,
FT                   10200179..10200313,10201573..10201599,10202916..10203034,
FT                   10205333..10205482,10213575..10213682,10221294..10221403,
FT                   10222899..10223601)
FT                   /codon_start=1
FT                   /gene="Fstl4"
FT                   /locus_tag="mCG_17296"
FT                   /product="follistatin-like 4, isoform CRA_b"
FT                   /note="gene_id=mCG17296.3 transcript_id=mCT193114.0
FT                   protein_id=mCP114095.0 isoform=CRA_b"
FT                   /protein_id="EDL33607.1"
FT   CDS             join(<9799658..9799803,9808756..9808891,9849565..9849598,
FT                   10037465..10037710,10105820..10106013,10109673..10109796,
FT                   10171181..10171347,10186044..10186164,10199697..10199858,
FT                   10200179..10200313,10202916..10203034,10205333..10205482,
FT                   10213575..10213682,10221294..10221403,10222899..10223601)
FT                   /codon_start=1
FT                   /gene="Fstl4"
FT                   /locus_tag="mCG_17296"
FT                   /product="follistatin-like 4, isoform CRA_a"
FT                   /note="gene_id=mCG17296.3 transcript_id=mCT17323.2
FT                   protein_id=mCP14142.2 isoform=CRA_a"
FT                   /protein_id="EDL33606.1"
FT                   IKGAATVVWVGEV"
FT   assembly_gap    9814968..9815246
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    9875671..9875690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9920029..9920048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9921232..9921251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10025477..10025496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10148824..>10157210)
FT                   /locus_tag="mCG_145519"
FT                   /note="gene_id=mCG145519.0"
FT   mRNA            complement(join(10148824..10149566,10149896..10150025,
FT                   10156479..10156634,10157061..>10157210))
FT                   /locus_tag="mCG_145519"
FT                   /product="mCG145519"
FT                   /note="gene_id=mCG145519.0 transcript_id=mCT184943.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(10149344..10149566,10149896..10150025,
FT                   10156479..>10156479))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145519"
FT                   /product="mCG145519"
FT                   /note="gene_id=mCG145519.0 transcript_id=mCT184943.0
FT                   protein_id=mCP105978.0"
FT                   /protein_id="EDL33608.1"
FT                   CCWLQACLHFGFL"
FT   gene            10237319..10238609
FT                   /locus_tag="mCG_50932"
FT                   /note="gene_id=mCG50932.1"
FT   mRNA            10237319..10238609
FT                   /locus_tag="mCG_50932"
FT                   /product="mCG50932"
FT                   /note="gene_id=mCG50932.1 transcript_id=mCT51115.1 created
FT                   on 18-JUN-2002"
FT   CDS             10237342..10237716
FT                   /codon_start=1
FT                   /locus_tag="mCG_50932"
FT                   /product="mCG50932"
FT                   /note="gene_id=mCG50932.1 transcript_id=mCT51115.1
FT                   protein_id=mCP35327.0"
FT                   /protein_id="EDL33605.1"
FT   assembly_gap    10259713..10259959
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    10262239..10262434
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   gene            complement(10296542..>10337116)
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /note="gene_id=mCG113604.2"
FT   mRNA            complement(join(10296542..10296678,10302710..10302754,
FT                   10303671..10303823,10305194..10305271,10311843..10311923,
FT                   10317172..10317416,10320233..10320366,10320804..10320903,
FT                   10323557..10323679,10325728..10325868,10328961..10329018,
FT                   10336764..10337072))
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /product="heat shock protein 4, transcript variant
FT                   mCT170155"
FT                   /note="gene_id=mCG113604.2 transcript_id=mCT170155.0
FT                   created on 18-JUN-2002"
FT   mRNA            complement(join(10297129..10298520,10298969..10299130,
FT                   10299585..10299704,10301739..10301846,10302629..10302754,
FT                   10303671..10303823,10305194..10305289,10306392..10306573,
FT                   10307650..10307783,10308718..10308824,10309431..10309582,
FT                   10311847..10311923,10317172..10317416,10320233..10320366,
FT                   10320804..10320903,10323557..10323679,10325728..10325868,
FT                   10328961..10329018,10336764..10337078))
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /product="heat shock protein 4, transcript variant
FT                   mCT114689"
FT                   /note="gene_id=mCG113604.2 transcript_id=mCT114689.1
FT                   created on 18-JUN-2002"
FT   mRNA            complement(join(10297129..10298520,10298969..10299130,
FT                   10299585..10299704,10302629..10302754,10303671..10303823,
FT                   10305194..10305289,10306392..10306573,10307650..10307783,
FT                   10308718..10308824,10309431..10309582,10311847..10311923,
FT                   10317172..10317416,10320233..10320366,10320804..10320903,
FT                   10323557..10323679,10325728..10325868,10328961..10329018,
FT                   10336764..10337072))
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /product="heat shock protein 4, transcript variant
FT                   mCT170156"
FT                   /note="gene_id=mCG113604.2 transcript_id=mCT170156.0
FT                   created on 18-JUN-2002"
FT   CDS             complement(join(10298317..10298520,10298969..10299130,
FT                   10299585..10299704,10302629..10302754,10303671..10303823,
FT                   10305194..10305289,10306392..10306573,10307650..10307783,
FT                   10308718..10308824,10309431..10309582,10311847..10311923,
FT                   10317172..10317416,10320233..10320366,10320804..10320903,
FT                   10323557..10323679,10325728..10325868,10328961..10329018,
FT                   10336764..10336870))
FT                   /codon_start=1
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /product="heat shock protein 4, isoform CRA_c"
FT                   /note="gene_id=mCG113604.2 transcript_id=mCT170156.0
FT                   protein_id=mCP92997.0 isoform=CRA_c"
FT                   /protein_id="EDL33603.1"
FT   CDS             complement(join(10298317..10298520,10298969..10299130,
FT                   10299585..10299704,10301739..10301846,10302629..10302754,
FT                   10303671..10303823,10305194..10305289,10306392..10306573,
FT                   10307650..10307783,10308718..10308824,10309431..10309582,
FT                   10311847..10311923,10317172..10317416,10320233..10320366,
FT                   10320804..10320903,10323557..10323679,10325728..10325868,
FT                   10328961..10329018,10336764..10336870))
FT                   /codon_start=1
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /product="heat shock protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG113604.2 transcript_id=mCT114689.1
FT                   protein_id=mCP80957.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U2G2"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="MGI:MGI:1342292"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2G2"
FT                   /protein_id="EDL33601.1"
FT   mRNA            complement(join(10300954..10301846,10302629..10302754,
FT                   10303671..10303823,10305194..10305289,10306392..10306573,
FT                   10307650..10307783,10308718..10308824,10309431..10309582,
FT                   10311847..10311923,10317172..10317416,10320233..10320366,
FT                   10320804..10320903,10323557..10323679,10325728..10325868,
FT                   10328961..10329018,10336764..>10337116))
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /product="heat shock protein 4, transcript variant
FT                   mCT193122"
FT                   /note="gene_id=mCG113604.2 transcript_id=mCT193122.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(10301676..10301846,10302629..10302754,
FT                   10303671..10303823,10305194..10305289,10306392..10306573,
FT                   10307650..10307783,10308718..10308824,10309431..10309582,
FT                   10311847..10311923,10317172..10317416,10320233..10320366,
FT                   10320804..10320903,10323557..10323679,10325728..10325868,
FT                   10328961..10329018,10336764..>10337116))
FT                   /codon_start=1
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /product="heat shock protein 4, isoform CRA_d"
FT                   /note="gene_id=mCG113604.2 transcript_id=mCT193122.0
FT                   protein_id=mCP114078.0 isoform=CRA_d"
FT                   /protein_id="EDL33604.1"
FT   CDS             complement(join(10303757..10303823,10305194..10305271,
FT                   10311843..10311923,10317172..10317416,10320233..10320366,
FT                   10320804..10320903,10323557..10323679,10325728..10325868,
FT                   10328961..10329018,10336764..10336870))
FT                   /codon_start=1
FT                   /gene="Hspa4"
FT                   /locus_tag="mCG_113604"
FT                   /product="heat shock protein 4, isoform CRA_b"
FT                   /note="gene_id=mCG113604.2 transcript_id=mCT170155.0
FT                   protein_id=mCP93023.0 isoform=CRA_b"
FT                   /protein_id="EDL33602.1"
FT   gene            10361383..10370027
FT                   /gene="Zcchc10"
FT                   /locus_tag="mCG_17298"
FT                   /note="gene_id=mCG17298.1"
FT   mRNA            join(10361383..10361447,10363975..10364133,
FT                   10367393..10367437,10368354..10368477,10369008..10370027)
FT                   /gene="Zcchc10"
FT                   /locus_tag="mCG_17298"
FT                   /product="zinc finger, CCHC domain containing 10,
FT                   transcript variant mCT170159"
FT                   /note="gene_id=mCG17298.1 transcript_id=mCT170159.0 created
FT                   on 18-JUN-2002"
FT   mRNA            join(10361383..10361447,10363975..10364133,
FT                   10367393..10367437,10369008..10370027)
FT                   /gene="Zcchc10"
FT                   /locus_tag="mCG_17298"
FT                   /product="zinc finger, CCHC domain containing 10,
FT                   transcript variant mCT17325"
FT                   /note="gene_id=mCG17298.1 transcript_id=mCT17325.0 created
FT                   on 18-JUN-2002"
FT   CDS             join(10361407..10361447,10363975..10364133,
FT                   10367393..10367437,10369008..10369299)
FT                   /codon_start=1
FT                   /gene="Zcchc10"
FT                   /locus_tag="mCG_17298"
FT                   /product="zinc finger, CCHC domain containing 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17298.1 transcript_id=mCT17325.0
FT                   protein_id=mCP14151.1 isoform=CRA_a"
FT                   /protein_id="EDL33599.1"
FT                   SSSDDEPQKKKKKKK"
FT   CDS             join(10361407..10361447,10363975..10364133,
FT                   10367393..10367437,10368354..10368369)
FT                   /codon_start=1
FT                   /gene="Zcchc10"
FT                   /locus_tag="mCG_17298"
FT                   /product="zinc finger, CCHC domain containing 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17298.1 transcript_id=mCT170159.0
FT                   protein_id=mCP93019.0 isoform=CRA_b"
FT                   /protein_id="EDL33600.1"
FT   gene            10387539..10458548
FT                   /gene="Aff4"
FT                   /locus_tag="mCG_17295"
FT                   /note="gene_id=mCG17295.2"
FT   mRNA            join(10387539..10387835,10405366..10405492,
FT                   10408984..10409763,10412295..10412339,10417294..10417380,
FT                   10426463..10426499,10429479..10429524,10433247..10433301,
FT                   10434540..10434577,10434972..10435107,10436297..10437214,
FT                   10439186..10439274,10441064..10441310,10443289..10443383,
FT                   10444588..10444651,10444765..10444901,10445107..10445178,
FT                   10445976..10446069,10447624..10447667,10448544..10448764,
FT                   10452096..10458548)
FT                   /gene="Aff4"
FT                   /locus_tag="mCG_17295"
FT                   /product="AF4/FMR2 family, member 4"
FT                   /note="gene_id=mCG17295.2 transcript_id=mCT17321.2 created
FT                   on 17-JUN-2002"
FT   CDS             join(10405370..10405492,10408984..10409763,
FT                   10412295..10412339,10417294..10417380,10426463..10426499,
FT                   10429479..10429524,10433247..10433301,10434540..10434577,
FT                   10434972..10435107,10436297..10437214,10439186..10439274,
FT                   10441064..10441310,10443289..10443383,10444588..10444651,
FT                   10444765..10444901,10445107..10445178,10445976..10446069,
FT                   10447624..10447667,10448544..10448764,10452096..10452223)
FT                   /codon_start=1
FT                   /gene="Aff4"
FT                   /locus_tag="mCG_17295"
FT                   /product="AF4/FMR2 family, member 4"
FT                   /note="gene_id=mCG17295.2 transcript_id=mCT17321.2
FT                   protein_id=mCP14176.2"
FT                   /protein_id="EDL33598.1"
FT   gene            complement(10458759..>10459890)
FT                   /gene="Leap2"
FT                   /locus_tag="mCG_17300"
FT                   /note="gene_id=mCG17300.2"
FT   mRNA            complement(join(10458759..10459157,10459458..10459594,
FT                   10459754..>10459890))
FT                   /gene="Leap2"
FT                   /locus_tag="mCG_17300"
FT                   /product="liver-expressed antimicrobial peptide 2"
FT                   /note="gene_id=mCG17300.2 transcript_id=mCT17322.2 created
FT                   on 17-JUN-2002"
FT   CDS             complement(join(10459121..10459157,10459458..10459594,
FT                   10459754..>10459888))
FT                   /codon_start=1
FT                   /gene="Leap2"
FT                   /locus_tag="mCG_17300"
FT                   /product="liver-expressed antimicrobial peptide 2"
FT                   /note="gene_id=mCG17300.2 transcript_id=mCT17322.2
FT                   protein_id=mCP14160.1"
FT                   /protein_id="EDL33597.1"
FT   gene            complement(10459968..>10467536)
FT                   /gene="Uqcrq"
FT                   /locus_tag="mCG_17301"
FT                   /note="gene_id=mCG17301.2"
FT   mRNA            complement(join(10459968..10459983,10465694..10465858,
FT                   10467244..10467410,10467496..>10467536))
FT                   /gene="Uqcrq"
FT                   /locus_tag="mCG_17301"
FT                   /product="ubiquinol-cytochrome c reductase, complex III
FT                   subunit VII, transcript variant mCT17327"
FT                   /note="gene_id=mCG17301.2 transcript_id=mCT17327.2 created
FT                   on 17-JUN-2002"
FT   mRNA            complement(join(10459968..10459983,10465694..10465858,
FT                   10467244..>10467445))
FT                   /gene="Uqcrq"
FT                   /locus_tag="mCG_17301"
FT                   /product="ubiquinol-cytochrome c reductase, complex III
FT                   subunit VII, transcript variant mCT170161"
FT                   /note="gene_id=mCG17301.2 transcript_id=mCT170161.0 created
FT                   on 17-JUN-2002"
FT   mRNA            complement(join(10464630..10465858,10467244..>10467522))
FT                   /gene="Uqcrq"
FT                   /locus_tag="mCG_17301"
FT                   /product="ubiquinol-cytochrome c reductase, complex III
FT                   subunit VII, transcript variant mCT170160"
FT                   /note="gene_id=mCG17301.2 transcript_id=mCT170160.0 created
FT                   on 17-JUN-2002"
FT   CDS             complement(join(10465764..10465858,10467244..10467410,
FT                   10467496..>10467524))
FT                   /codon_start=1
FT                   /gene="Uqcrq"
FT                   /locus_tag="mCG_17301"
FT                   /product="ubiquinol-cytochrome c reductase, complex III
FT                   subunit VII, isoform CRA_b"
FT                   /note="gene_id=mCG17301.2 transcript_id=mCT17327.2
FT                   protein_id=mCP14164.1 isoform=CRA_b"
FT                   /protein_id="EDL33595.1"
FT   CDS             complement(join(10465764..10465858,10467244..>10467520))
FT                   /codon_start=1
FT                   /gene="Uqcrq"
FT                   /locus_tag="mCG_17301"
FT                   /product="ubiquinol-cytochrome c reductase, complex III
FT                   subunit VII, isoform CRA_c"
FT                   /note="gene_id=mCG17301.2 transcript_id=mCT170160.0
FT                   protein_id=mCP93000.0 isoform=CRA_c"
FT                   /protein_id="EDL33596.1"
FT   CDS             complement(join(10465764..10465858,10467244..>10467445))
FT                   /codon_start=1
FT                   /gene="Uqcrq"
FT                   /locus_tag="mCG_17301"
FT                   /product="ubiquinol-cytochrome c reductase, complex III
FT                   subunit VII, isoform CRA_a"
FT                   /note="gene_id=mCG17301.2 transcript_id=mCT170161.0
FT                   protein_id=mCP93005.0 isoform=CRA_a"
FT                   /protein_id="EDL33594.1"
FT   gene            10470086..10474608
FT                   /gene="Gdf9"
FT                   /locus_tag="mCG_17299"
FT                   /note="gene_id=mCG17299.1"
FT   mRNA            join(10470086..10470510,10473324..10474608)
FT                   /gene="Gdf9"
FT                   /locus_tag="mCG_17299"
FT                   /product="growth differentiation factor 9"
FT                   /note="gene_id=mCG17299.1 transcript_id=mCT17326.0 created
FT                   on 17-JUN-2002"
FT   CDS             join(10470114..10470510,10473324..10474252)
FT                   /codon_start=1
FT                   /gene="Gdf9"
FT                   /locus_tag="mCG_17299"
FT                   /product="growth differentiation factor 9"
FT                   /note="gene_id=mCG17299.1 transcript_id=mCT17326.0
FT                   protein_id=mCP14154.1"
FT                   /db_xref="GOA:Q3UWR9"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR015617"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:95692"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UWR9"
FT                   /protein_id="EDL33593.1"
FT   gene            10493913..10504463
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /note="gene_id=mCG17294.3"
FT   mRNA            join(10493913..10494049,10499931..10500901,
FT                   10500983..10501038,10501828..10502016,10502204..10502752,
FT                   10502832..10502964,10503086..10504010)
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /product="shroom family member 1, transcript variant
FT                   mCT17320"
FT                   /note="gene_id=mCG17294.3 transcript_id=mCT17320.2 created
FT                   on 17-JUN-2002"
FT   mRNA            join(<10493938..10494049,10499931..10500901,
FT                   10500983..10501038,10502204..10502752,10502832..10502964,
FT                   10503086..10503358,10503471..10504003)
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /product="shroom family member 1, transcript variant
FT                   mCT193108"
FT                   /note="gene_id=mCG17294.3 transcript_id=mCT193108.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<10493953..10494049,10499931..10500901,
FT                   10500983..10504463)
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /product="shroom family member 1, transcript variant
FT                   mCT193110"
FT                   /note="gene_id=mCG17294.3 transcript_id=mCT193110.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<10493957..10494049,10499931..10500901,
FT                   10500983..10501038,10502204..10502964,10503086..10503358,
FT                   10503471..10504209)
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /product="shroom family member 1, transcript variant
FT                   mCT193109"
FT                   /note="gene_id=mCG17294.3 transcript_id=mCT193109.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<10494025..10494049,10499931..10500901,
FT                   10500983..10501038,10502204..10502752,10502832..10502964,
FT                   10503086..10503358,10503471..10503803)
FT                   /codon_start=1
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /product="shroom family member 1, isoform CRA_b"
FT                   /note="gene_id=mCG17294.3 transcript_id=mCT193108.0
FT                   protein_id=mCP114092.0 isoform=CRA_b"
FT                   /protein_id="EDL33590.1"
FT   CDS             join(<10494025..10494049,10499931..10500901,
FT                   10500983..10501038,10502204..10502756)
FT                   /codon_start=1
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /product="shroom family member 1, isoform CRA_c"
FT                   /note="gene_id=mCG17294.3 transcript_id=mCT193109.0
FT                   protein_id=mCP114093.0 isoform=CRA_c"
FT                   /protein_id="EDL33591.1"
FT                   PALEEMGEKAAGASEEG"
FT   CDS             join(<10494025..10494049,10499931..10500901,
FT                   10500983..10501042)
FT                   /codon_start=1
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /product="shroom family member 1, isoform CRA_d"
FT                   /note="gene_id=mCG17294.3 transcript_id=mCT193110.0
FT                   protein_id=mCP114094.0 isoform=CRA_d"
FT                   /protein_id="EDL33592.1"
FT                   RRPLLHTKLSR"
FT   CDS             join(10499963..10500901,10500983..10501038,
FT                   10501828..10502016,10502204..10502752,10502832..10502964,
FT                   10503086..10503367)
FT                   /codon_start=1
FT                   /gene="Shroom1"
FT                   /locus_tag="mCG_17294"
FT                   /product="shroom family member 1, isoform CRA_a"
FT                   /note="gene_id=mCG17294.3 transcript_id=mCT17320.2
FT                   protein_id=mCP14171.2 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z3D5"
FT                   /db_xref="InterPro:IPR014799"
FT                   /db_xref="InterPro:IPR014800"
FT                   /db_xref="InterPro:IPR027685"
FT                   /db_xref="MGI:MGI:1919024"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3D5"
FT                   /protein_id="EDL33589.1"
FT   gene            complement(10513287..10516788)
FT                   /gene="Ankrd43"
FT                   /locus_tag="mCG_148144"
FT                   /note="gene_id=mCG148144.0"
FT   mRNA            complement(10513287..10516788)
FT                   /gene="Ankrd43"
FT                   /locus_tag="mCG_148144"
FT                   /product="ankyrin repeat domain 43"
FT                   /note="gene_id=mCG148144.0 transcript_id=mCT188407.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10514969..10516615)
FT                   /codon_start=1
FT                   /gene="Ankrd43"
FT                   /locus_tag="mCG_148144"
FT                   /product="ankyrin repeat domain 43"
FT                   /note="gene_id=mCG148144.0 transcript_id=mCT188407.0
FT                   protein_id=mCP108589.0"
FT                   /protein_id="EDL33588.1"
FT   gene            complement(10519833..>10524047)
FT                   /locus_tag="mCG_13778"
FT                   /note="gene_id=mCG13778.2"
FT   mRNA            complement(join(10519833..10520423,10523988..>10524047))
FT                   /locus_tag="mCG_13778"
FT                   /product="mCG13778"
FT                   /note="gene_id=mCG13778.2 transcript_id=mCT17589.2 created
FT                   on 14-JUN-2002"
FT   CDS             complement(join(10520196..10520423,10523988..>10524047))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13778"
FT                   /product="mCG13778"
FT                   /note="gene_id=mCG13778.2 transcript_id=mCT17589.2
FT                   protein_id=mCP14163.2"
FT                   /protein_id="EDL33587.1"
FT   gene            <10537897..>10538475
FT                   /locus_tag="mCG_50783"
FT                   /note="gene_id=mCG50783.0"
FT   mRNA            <10537897..>10538475
FT                   /locus_tag="mCG_50783"
FT                   /product="mCG50783"
FT                   /note="gene_id=mCG50783.0 transcript_id=mCT50966.0 created
FT                   on 14-JUN-2002"
FT   CDS             10537897..10538475
FT                   /codon_start=1
FT                   /locus_tag="mCG_50783"
FT                   /product="mCG50783"
FT                   /note="gene_id=mCG50783.0 transcript_id=mCT50966.0
FT                   protein_id=mCP35321.0"
FT                   /protein_id="EDL33586.1"
FT   assembly_gap    10550460..10550479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10556707..10580568
FT                   /gene="Sept8"
FT                   /locus_tag="mCG_13785"
FT                   /note="gene_id=mCG13785.4"
FT   mRNA            join(<10556707..10556945,10568914..10569034,
FT                   10571351..10571546,10571867..10572053,10572866..10573027,
FT                   10573570..10573666,10574072..10574240,10574405..10574537,
FT                   10574643..10574833,10577502..10580568)
FT                   /gene="Sept8"
FT                   /locus_tag="mCG_13785"
FT                   /product="septin 8, transcript variant mCT193106"
FT                   /note="gene_id=mCG13785.4 transcript_id=mCT193106.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<10556709..10556945,10568914..10569034,
FT                   10571351..10571546,10571867..10572053,10572866..10573027,
FT                   10573570..10573666,10574072..10574240,10574405..10574537,
FT                   10574643..10574833,10577502..10577508)
FT                   /codon_start=1
FT                   /gene="Sept8"
FT                   /locus_tag="mCG_13785"
FT                   /product="septin 8, isoform CRA_c"
FT                   /note="gene_id=mCG13785.4 transcript_id=mCT193106.0
FT                   protein_id=mCP114085.0 isoform=CRA_c"
FT                   /protein_id="EDL33585.1"
FT   mRNA            join(10556802..10556945,10568914..10569034,
FT                   10571351..10571546,10571873..10572053,10572866..10573027,
FT                   10573570..10573666,10574072..10574240,10574405..10574537,
FT                   10574643..10574833,10577682..10580560)
FT                   /gene="Sept8"
FT                   /locus_tag="mCG_13785"
FT                   /product="septin 8, transcript variant mCT17705"
FT                   /note="gene_id=mCG13785.4 transcript_id=mCT17705.2 created
FT                   on 07-MAR-2003"
FT   mRNA            join(10556863..10556945,10568914..10569034,
FT                   10571351..10571546,10571867..10572053,10572866..10573027,
FT                   10573570..10573666,10574072..10574240,10574405..10574537,
FT                   10574643..10574833,10577682..10580566)
FT                   /gene="Sept8"
FT                   /locus_tag="mCG_13785"
FT                   /product="septin 8, transcript variant mCT181020"
FT                   /note="gene_id=mCG13785.4 transcript_id=mCT181020.0 created
FT                   on 07-MAR-2003"
FT   CDS             join(10556916..10556945,10568914..10569034,
FT                   10571351..10571546,10571867..10572053,10572866..10573027,
FT                   10573570..10573666,10574072..10574240,10574405..10574537,
FT                   10574643..10574833,10577682..10577685)
FT                   /codon_start=1
FT                   /gene="Sept8"
FT                   /locus_tag="mCG_13785"
FT                   /product="septin 8, isoform CRA_b"
FT                   /note="gene_id=mCG13785.4 transcript_id=mCT181020.0
FT                   protein_id=mCP103942.0 isoform=CRA_b"
FT                   /protein_id="EDL33584.1"
FT   CDS             join(10556916..10556945,10568914..10569034,
FT                   10571351..10571546,10571873..10572053,10572866..10573027,
FT                   10573570..10573666,10574072..10574240,10574405..10574537,
FT                   10574643..10574833,10577682..10577685)
FT                   /codon_start=1
FT                   /gene="Sept8"
FT                   /locus_tag="mCG_13785"
FT                   /product="septin 8, isoform CRA_a"
FT                   /note="gene_id=mCG13785.4 transcript_id=mCT17705.2
FT                   protein_id=mCP14179.2 isoform=CRA_a"
FT                   /protein_id="EDL33583.1"
FT   assembly_gap    10591130..10593145
FT                   /estimated_length=2016
FT                   /gap_type="unknown"
FT   gene            complement(10601319..10603868)
FT                   /locus_tag="mCG_148146"
FT                   /note="gene_id=mCG148146.0"
FT   mRNA            complement(join(10601319..10602269,10603392..10603868))
FT                   /locus_tag="mCG_148146"
FT                   /product="mCG148146"
FT                   /note="gene_id=mCG148146.0 transcript_id=mCT188409.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10603597..10603782)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148146"
FT                   /product="mCG148146"
FT                   /note="gene_id=mCG148146.0 transcript_id=mCT188409.0
FT                   protein_id=mCP108591.0"
FT                   /protein_id="EDL33582.1"
FT                   QGLGSVYLYYLSAPKV"
FT   gene            10603948..10640748
FT                   /gene="Kif3a"
FT                   /locus_tag="mCG_13770"
FT                   /note="gene_id=mCG13770.2"
FT   mRNA            join(10603948..10604086,10607091..10607364,
FT                   10615399..10615543,10615655..10615739,10616283..10616388,
FT                   10619782..10619921,10620370..10620567,10620826..10621000,
FT                   10623390..10623485,10629929..10630085,10630474..10630654,
FT                   10630832..10630942,10631381..10631506,10634475..10634528,
FT                   10634810..10634878,10635223..10635347,10637527..10640748)
FT                   /gene="Kif3a"
FT                   /locus_tag="mCG_13770"
FT                   /product="kinesin family member 3A, transcript variant
FT                   mCT17581"
FT                   /note="gene_id=mCG13770.2 transcript_id=mCT17581.1 created
FT                   on 14-JUN-2002"
FT   CDS             join(10604081..10604086,10607091..10607364,
FT                   10615399..10615543,10615655..10615739,10616283..10616388,
FT                   10619782..10619921,10620370..10620567,10620826..10621000,
FT                   10623390..10623485,10629929..10630085,10630474..10630654,
FT                   10630832..10630942,10631381..10631506,10634475..10634528,
FT                   10634810..10634878,10635223..10635347,10637527..10637575)
FT                   /codon_start=1
FT                   /gene="Kif3a"
FT                   /locus_tag="mCG_13770"
FT                   /product="kinesin family member 3A, isoform CRA_b"
FT                   /note="gene_id=mCG13770.2 transcript_id=mCT17581.1
FT                   protein_id=mCP14132.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UI47"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="MGI:MGI:107689"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UI47"
FT                   /protein_id="EDL33580.1"
FT                   SLLQ"
FT   mRNA            join(10604271..10604429,10607091..10607364,
FT                   10615399..10615543,10615655..10615739,10616283..10616388,
FT                   10619782..10619921,10620370..10620567,10620826..10621000,
FT                   10623390..10623485,10629929..10630085,10630474..10630654,
FT                   10630832..10630942,10631381..10631506,10634475..10634528,
FT                   10634810..10634878,10635223..10635347,10637527..10640748)
FT                   /gene="Kif3a"
FT                   /locus_tag="mCG_13770"
FT                   /product="kinesin family member 3A, transcript variant
FT                   mCT170051"
FT                   /note="gene_id=mCG13770.2 transcript_id=mCT170051.0 created
FT                   on 14-JUN-2002"
FT   CDS             join(10607175..10607364,10615399..10615543,
FT                   10615655..10615739,10616283..10616388,10619782..10619921,
FT                   10620370..10620567,10620826..10621000,10623390..10623485,
FT                   10629929..10630085,10630474..10630654,10630832..10630942,
FT                   10631381..10631506,10634475..10634528,10634810..10634878,
FT                   10635223..10635347,10637527..10637575)
FT                   /codon_start=1
FT                   /gene="Kif3a"
FT                   /locus_tag="mCG_13770"
FT                   /product="kinesin family member 3A, isoform CRA_a"
FT                   /note="gene_id=mCG13770.2 transcript_id=mCT170051.0
FT                   protein_id=mCP92598.0 isoform=CRA_a"
FT                   /protein_id="EDL33579.1"
FT   gene            <10608273..>10639542
FT                   /locus_tag="mCG_140562"
FT                   /note="gene_id=mCG140562.0"
FT   mRNA            join(<10608273..10608309,10608673..10608685,
FT                   10639085..>10639542)
FT                   /locus_tag="mCG_140562"
FT                   /product="mCG140562"
FT                   /note="gene_id=mCG140562.0 transcript_id=mCT170050.0
FT                   created on 14-JUN-2002"
FT   CDS             <10639370..>10639542
FT                   /codon_start=1
FT                   /locus_tag="mCG_140562"
FT                   /product="mCG140562"
FT                   /note="gene_id=mCG140562.0 transcript_id=mCT170050.0
FT                   protein_id=mCP92596.0"
FT                   /protein_id="EDL33581.1"
FT                   SHMFIKALMLKL"
FT   gene            complement(10648980..10655183)
FT                   /gene="Il4"
FT                   /locus_tag="mCG_13773"
FT                   /note="gene_id=mCG13773.1"
FT   mRNA            complement(join(10648980..10649171,10650422..10650574,
FT                   10653599..10653854))
FT                   /gene="Il4"
FT                   /locus_tag="mCG_13773"
FT                   /product="interleukin 4, transcript variant mCT170053"
FT                   /note="gene_id=mCG13773.1 transcript_id=mCT170053.0 created
FT                   on 12-JUN-2002"
FT   mRNA            complement(join(10648986..10649171,10650422..10650574,
FT                   10654688..10654735,10654993..10655183))
FT                   /gene="Il4"
FT                   /locus_tag="mCG_13773"
FT                   /product="interleukin 4, transcript variant mCT17584"
FT                   /note="gene_id=mCG13773.1 transcript_id=mCT17584.0 created
FT                   on 12-JUN-2002"
FT   mRNA            complement(join(10649039..10649171,10650422..10650574,
FT                   10654688..10654877))
FT                   /gene="Il4"
FT                   /locus_tag="mCG_13773"
FT                   /product="interleukin 4, transcript variant mCT170052"
FT                   /note="gene_id=mCG13773.1 transcript_id=mCT170052.0 created
FT                   on 12-JUN-2002"
FT   CDS             complement(join(10649082..10649171,10650422..10650574,
FT                   10654688..10654735,10654993..10655124))
FT                   /codon_start=1
FT                   /gene="Il4"
FT                   /locus_tag="mCG_13773"
FT                   /product="interleukin 4, isoform CRA_c"
FT                   /note="gene_id=mCG13773.1 transcript_id=mCT17584.0
FT                   protein_id=mCP14144.1 isoform=CRA_c"
FT                   /protein_id="EDL33578.1"
FT   CDS             complement(join(10649082..10649171,10650422..10650574,
FT                   10654688..10654720))
FT                   /codon_start=1
FT                   /gene="Il4"
FT                   /locus_tag="mCG_13773"
FT                   /product="interleukin 4, isoform CRA_a"
FT                   /note="gene_id=mCG13773.1 transcript_id=mCT170052.0
FT                   protein_id=mCP92586.0 isoform=CRA_a"
FT                   /protein_id="EDL33576.1"
FT   CDS             complement(join(10649082..10649171,10650422..10650469))
FT                   /codon_start=1
FT                   /gene="Il4"
FT                   /locus_tag="mCG_13773"
FT                   /product="interleukin 4, isoform CRA_b"
FT                   /note="gene_id=mCG13773.1 transcript_id=mCT170053.0
FT                   protein_id=mCP92611.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UXB0"
FT                   /db_xref="InterPro:IPR002354"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:96556"
FT                   /db_xref="UniProtKB/TrEMBL:G3UXB0"
FT                   /protein_id="EDL33577.1"
FT                   "
FT   gene            complement(10667838..10671217)
FT                   /gene="Il13"
FT                   /locus_tag="mCG_13776"
FT                   /note="gene_id=mCG13776.0"
FT   mRNA            complement(join(10667838..10668674,10668991..10669095,
FT                   10669674..10669727,10671008..10671217))
FT                   /gene="Il13"
FT                   /locus_tag="mCG_13776"
FT                   /product="interleukin 13"
FT                   /note="gene_id=mCG13776.0 transcript_id=mCT17587.0 created
FT                   on 12-JUN-2002"
FT   CDS             complement(join(10668579..10668674,10668991..10669095,
FT                   10669674..10669727,10671008..10671148))
FT                   /codon_start=1
FT                   /gene="Il13"
FT                   /locus_tag="mCG_13776"
FT                   /product="interleukin 13"
FT                   /note="gene_id=mCG13776.0 transcript_id=mCT17587.0
FT                   protein_id=mCP14149.1"
FT                   /protein_id="EDL33575.1"
FT   gene            10682276..10682910
FT                   /pseudo
FT                   /locus_tag="mCG_49123"
FT                   /note="gene_id=mCG49123.1"
FT   mRNA            10682276..10682910
FT                   /pseudo
FT                   /locus_tag="mCG_49123"
FT                   /note="gene_id=mCG49123.1 transcript_id=mCT49306.1 created
FT                   on 12-JUN-2002"
FT   gene            complement(10685127..10743825)
FT                   /gene="Rad50"
FT                   /locus_tag="mCG_119249"
FT                   /note="gene_id=mCG119249.1"
FT   mRNA            complement(join(10685127..10687187,10688766..10688899,
FT                   10691409..10691551,10692065..10692150,10704553..10704777,
FT                   10706161..10706288,10711225..10711338,10711430..10711522,
FT                   10712429..10712539,10715392..10715585,10715917..10716043,
FT                   10716560..10716749,10719729..10719966,10720653..10720828,
FT                   10722677..10722834,10724622..10724804,10728640..10728846,
FT                   10729236..10729429,10731429..10731594,10731811..10731939,
FT                   10734642..10734846,10735350..10735535,10738485..10738636,
FT                   10742513..10742596,10743455..10743825))
FT                   /gene="Rad50"
FT                   /locus_tag="mCG_119249"
FT                   /product="RAD50 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG119249.1 transcript_id=mCT120419.1
FT                   created on 12-JUN-2002"
FT   CDS             complement(join(10687001..10687187,10688766..10688899,
FT                   10691409..10691551,10692065..10692150,10704553..10704777,
FT                   10706161..10706288,10711225..10711338,10711430..10711522,
FT                   10712429..10712539,10715392..10715585,10715917..10716043,
FT                   10716560..10716749,10719729..10719966,10720653..10720828,
FT                   10722677..10722834,10724622..10724804,10728640..10728846,
FT                   10729236..10729429,10731429..10731594,10731811..10731939,
FT                   10734642..10734846,10735350..10735535,10738485..10738636,
FT                   10742513..10742596,10743455..10743583))
FT                   /codon_start=1
FT                   /gene="Rad50"
FT                   /locus_tag="mCG_119249"
FT                   /product="RAD50 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG119249.1 transcript_id=mCT120419.1
FT                   protein_id=mCP81000.1"
FT                   /db_xref="GOA:Q5SV02"
FT                   /db_xref="InterPro:IPR004584"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:109292"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SV02"
FT                   /protein_id="EDL33574.1"
FT   gene            10757322..10761632
FT                   /gene="Il5"
FT                   /locus_tag="mCG_13786"
FT                   /note="gene_id=mCG13786.1"
FT   mRNA            join(10757322..10757505,10758335..10758367,
FT                   10760237..10760365,10760445..10761632)
FT                   /gene="Il5"
FT                   /locus_tag="mCG_13786"
FT                   /product="interleukin 5"
FT                   /note="gene_id=mCG13786.1 transcript_id=mCT17706.0 created
FT                   on 12-JUN-2002"
FT   CDS             join(10757365..10757505,10758335..10758367,
FT                   10760237..10760365,10760445..10760543)
FT                   /codon_start=1
FT                   /gene="Il5"
FT                   /locus_tag="mCG_13786"
FT                   /product="interleukin 5"
FT                   /note="gene_id=mCG13786.1 transcript_id=mCT17706.0
FT                   protein_id=mCP14173.1"
FT                   /db_xref="GOA:Q5SV01"
FT                   /db_xref="InterPro:IPR000186"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:96557"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SV01"
FT                   /protein_id="EDL33573.1"
FT   assembly_gap    10797552..10797571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10802102..10802329
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   gene            10806845..10814136
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /note="gene_id=mCG13768.1"
FT   mRNA            join(10806845..10807091,10808097..10808188,
FT                   10809652..10809751,10810469..10810645,10810739..10810788,
FT                   10810875..10811007,10811159..10811281,10811867..10811916,
FT                   10812731..10812866,10813126..10814136)
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, transcript
FT                   variant mCT17579"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT17579.1 created
FT                   on 12-JUN-2002"
FT   mRNA            join(10806884..10807091,10810469..10810645,
FT                   10810739..10810788,10810875..10811007,10811159..10811281,
FT                   10811867..10811916,10812731..10812866,10813126..10814136)
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, transcript
FT                   variant mCT170046"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT170046.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(10807335..10807570,10808097..10808188,
FT                   10809652..10809751,10810469..10810645,10810739..10810788,
FT                   10810875..10811007,10811159..10811281,10811867..10811916,
FT                   10812731..10812866,10813126..10814136)
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, transcript
FT                   variant mCT170047"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT170047.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(10807348..10807435,10808097..10808188,
FT                   10809652..10809751,10810469..10810645,10810739..10810788,
FT                   10810875..10811007,10811159..10811281,10811867..10811916,
FT                   10812731..10812866,10813126..10814136)
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, transcript
FT                   variant mCT170049"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT170049.0 created
FT                   on 12-JUN-2002"
FT   mRNA            join(10807371..10807504,10808097..10808188,
FT                   10809652..10809751,10810469..10810645,10810739..10810788,
FT                   10810875..10811007,10811159..10811281,10811867..10811916,
FT                   10812731..10812866,10813126..10814136)
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, transcript
FT                   variant mCT170048"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT170048.0 created
FT                   on 12-JUN-2002"
FT   CDS             join(10808102..10808188,10809652..10809751,
FT                   10810469..10810645,10810739..10810788,10810875..10811007,
FT                   10811159..10811281,10811867..10811916,10812731..10812866,
FT                   10813126..10813259)
FT                   /codon_start=1
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT170047.0
FT                   protein_id=mCP92607.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SX13"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017431"
FT                   /db_xref="InterPro:IPR019817"
FT                   /db_xref="InterPro:IPR031215"
FT                   /db_xref="MGI:MGI:96590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SX13"
FT                   /protein_id="EDL33569.1"
FT   CDS             join(10808102..10808188,10809652..10809751,
FT                   10810469..10810645,10810739..10810788,10810875..10811007,
FT                   10811159..10811281,10811867..10811916,10812731..10812866,
FT                   10813126..10813259)
FT                   /codon_start=1
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT170048.0
FT                   protein_id=mCP92606.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SX13"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017431"
FT                   /db_xref="InterPro:IPR019817"
FT                   /db_xref="InterPro:IPR031215"
FT                   /db_xref="MGI:MGI:96590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SX13"
FT                   /protein_id="EDL33570.1"
FT   CDS             join(10808102..10808188,10809652..10809751,
FT                   10810469..10810645,10810739..10810788,10810875..10811007,
FT                   10811159..10811281,10811867..10811916,10812731..10812866,
FT                   10813126..10813259)
FT                   /codon_start=1
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT170049.0
FT                   protein_id=mCP92608.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SX13"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017431"
FT                   /db_xref="InterPro:IPR019817"
FT                   /db_xref="InterPro:IPR031215"
FT                   /db_xref="MGI:MGI:96590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SX13"
FT                   /protein_id="EDL33571.1"
FT   CDS             join(10808102..10808188,10809652..10809751,
FT                   10810469..10810645,10810739..10810788,10810875..10811007,
FT                   10811159..10811281,10811867..10811916,10812731..10812866,
FT                   10813126..10813259)
FT                   /codon_start=1
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT17579.1
FT                   protein_id=mCP14128.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SX13"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017431"
FT                   /db_xref="InterPro:IPR019817"
FT                   /db_xref="InterPro:IPR031215"
FT                   /db_xref="MGI:MGI:96590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SX13"
FT                   /protein_id="EDL33572.1"
FT   CDS             join(10810534..10810645,10810739..10810788,
FT                   10810875..10811007,10811159..10811281,10811867..10811916,
FT                   10812731..10812866,10813126..10813259)
FT                   /codon_start=1
FT                   /gene="Irf1"
FT                   /locus_tag="mCG_13768"
FT                   /product="interferon regulatory factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG13768.1 transcript_id=mCT170046.0
FT                   protein_id=mCP92595.0 isoform=CRA_a"
FT                   /protein_id="EDL33568.1"
FT   gene            complement(10820231..>10895821)
FT                   /locus_tag="mCG_13775"
FT                   /note="gene_id=mCG13775.1"
FT   mRNA            complement(join(10820231..10820491,10821098..10821143,
FT                   10823085..10823163,10832624..>10832687))
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, transcript variant mCT170059"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170059.0 created
FT                   on 12-JUN-2002"
FT   CDS             complement(join(10820437..10820491,10821098..10821143,
FT                   10823085..10823163,10832624..>10832626))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, isoform CRA_d"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170059.0
FT                   protein_id=mCP92576.0 isoform=CRA_d"
FT                   /protein_id="EDL33565.1"
FT                   PLVPSPLHLPSLLPV"
FT   mRNA            complement(join(10821098..10821143,10823085..10823163,
FT                   10850167..10850207,10886596..10886701,10895704..>10895821))
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, transcript variant mCT17586"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT17586.2 created
FT                   on 12-JUN-2002"
FT   mRNA            complement(join(<10822735..10823163,10850167..10850207,
FT                   10886596..10886701,10895704..>10895735))
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, transcript variant mCT170056"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170056.0 created
FT                   on 12-JUN-2002"
FT   CDS             complement(<10822735..>10822968)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, isoform CRA_b"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170056.0
FT                   protein_id=mCP92592.0 isoform=CRA_b"
FT                   /protein_id="EDL33563.1"
FT   CDS             complement(join(10823124..10823163,10850167..10850207,
FT                   10886596..10886701,10895704..>10895723))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, isoform CRA_e"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT17586.2
FT                   protein_id=mCP14161.2 isoform=CRA_e"
FT                   /protein_id="EDL33566.1"
FT   mRNA            complement(join(10840266..10840386,10841574..10841700,
FT                   10850167..10850207,10886596..10886701,10895704..>10895820))
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, transcript variant mCT170057"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170057.0 created
FT                   on 12-JUN-2002"
FT   CDS             complement(join(10841597..10841700,10850167..10850207,
FT                   10886596..>10886672))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, isoform CRA_f"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170057.0
FT                   protein_id=mCP92585.0 isoform=CRA_f"
FT                   /protein_id="EDL33567.1"
FT   mRNA            complement(join(10845985..10846384,10850167..10850207,
FT                   10886596..10886701,10895704..>10895734))
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, transcript variant mCT170058"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170058.0 created
FT                   on 12-JUN-2002"
FT   CDS             complement(10846101..>10846367)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, isoform CRA_c"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170058.0
FT                   protein_id=mCP92590.0 isoform=CRA_c"
FT                   /protein_id="EDL33564.1"
FT   mRNA            complement(join(10849552..10849915,10850167..10850207,
FT                   10886596..>10886669))
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, transcript variant mCT170055"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170055.0 created
FT                   on 12-JUN-2002"
FT   CDS             complement(10849569..>10849802)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13775"
FT                   /product="mCG13775, isoform CRA_a"
FT                   /note="gene_id=mCG13775.1 transcript_id=mCT170055.0
FT                   protein_id=mCP92579.0 isoform=CRA_a"
FT                   /protein_id="EDL33562.1"
FT   gene            complement(10901144..10928382)
FT                   /locus_tag="mCG_13781"
FT                   /note="gene_id=mCG13781.2"
FT   mRNA            complement(join(10901144..10902487,10902828..10902906,
FT                   10928141..10928382))
FT                   /locus_tag="mCG_13781"
FT                   /product="mCG13781, transcript variant mCT170064"
FT                   /note="gene_id=mCG13781.2 transcript_id=mCT170064.0 created
FT                   on 12-JUN-2002"
FT   mRNA            complement(join(10901144..10902487,10902828..10902963,
FT                   10904114..10904296,10905813..10906027,10908159..10908259,
FT                   10910259..10910385,10911526..10911697,10927819..10928382))
FT                   /locus_tag="mCG_13781"
FT                   /product="mCG13781, transcript variant mCT170065"
FT                   /note="gene_id=mCG13781.2 transcript_id=mCT170065.0 created
FT                   on 12-JUN-2002"
FT   mRNA            complement(join(10901144..10902487,10902828..10902963,
FT                   10904114..10904296,10905813..10906027,10908159..10908259,
FT                   10910259..10910385,10911526..10911697,10912600..10912754,
FT                   10920252..10920355,10927819..10928373))
FT                   /locus_tag="mCG_13781"
FT                   /product="mCG13781, transcript variant mCT17702"
FT                   /note="gene_id=mCG13781.2 transcript_id=mCT17702.2 created
FT                   on 11-JUN-2002"
FT   CDS             complement(10901956..10902180)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13781"
FT                   /product="mCG13781, isoform CRA_a"
FT                   /note="gene_id=mCG13781.2 transcript_id=mCT170064.0
FT                   protein_id=mCP92610.0 isoform=CRA_a"
FT                   /protein_id="EDL33559.1"
FT   CDS             complement(join(10902400..10902487,10902828..10902963,
FT                   10904114..10904296,10905813..10906027,10908159..10908259,
FT                   10910259..10910385,10911526..10911697,10912600..10912754,
FT                   10920252..10920355,10927819..10928211))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13781"
FT                   /product="mCG13781, isoform CRA_b"
FT                   /note="gene_id=mCG13781.2 transcript_id=mCT17702.2
FT                   protein_id=mCP14178.2 isoform=CRA_b partial"
FT                   /db_xref="GOA:Q5SX17"
FT                   /db_xref="InterPro:IPR004749"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1329012"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SX17"
FT                   /protein_id="EDL33560.1"
FT   CDS             complement(join(10902400..10902487,10902828..10902963,
FT                   10904114..10904296,10905813..10906027,10908159..10908259,
FT                   10910259..10910385,10911526..10911620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13781"
FT                   /product="mCG13781, isoform CRA_c"
FT                   /note="gene_id=mCG13781.2 transcript_id=mCT170065.0
FT                   protein_id=mCP92599.0 isoform=CRA_c"
FT                   /protein_id="EDL33561.1"
FT   assembly_gap    10924309..10924328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10928216..10928235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10931819..10931838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10933302..10933399
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    10939415..10939434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10939503..10939982)
FT                   /pseudo
FT                   /locus_tag="mCG_1037679"
FT                   /note="gene_id=mCG1037679.1"
FT   mRNA            complement(10939503..10939982)
FT                   /pseudo
FT                   /locus_tag="mCG_1037679"
FT                   /note="gene_id=mCG1037679.1 transcript_id=mCT155383.1
FT                   created on 11-JUN-2002"
FT   assembly_gap    10946618..10946888
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    10951354..10951878
FT                   /estimated_length=525
FT                   /gap_type="unknown"
FT   assembly_gap    10959583..10959619
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    10962084..10962213
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   gene            complement(10987547..>11025023)
FT                   /locus_tag="mCG_13774"
FT                   /note="gene_id=mCG13774.2"
FT   mRNA            complement(join(10987547..10988396,10988748..10988883,
FT                   10990042..10990224,10991729..10991943,10993026..10993135,
FT                   10995017..10995143,10996247..10996418,10997326..10997480,
FT                   11014189..11014292,11024154..11025023))
FT                   /locus_tag="mCG_13774"
FT                   /product="mCG13774, transcript variant mCT17585"
FT                   /note="gene_id=mCG13774.2 transcript_id=mCT17585.2 created
FT                   on 11-JUN-2002"
FT   mRNA            complement(join(10987855..10988396,10990042..10990224,
FT                   10991729..10991943,10993026..10993135,10995017..10995143,
FT                   10996247..10996418,10997326..10997480,11014189..11014292,
FT                   11024154..11024716))
FT                   /locus_tag="mCG_13774"
FT                   /product="mCG13774, transcript variant mCT170054"
FT                   /note="gene_id=mCG13774.2 transcript_id=mCT170054.0 created
FT                   on 11-JUN-2002"
FT   mRNA            complement(join(10987859..10988396,10988748..10988883,
FT                   10990042..10990224,10991729..10991943,10993026..10993135,
FT                   10995017..10995143,10996247..10996418,10997326..10997480,
FT                   11024154..>11025023))
FT                   /locus_tag="mCG_13774"
FT                   /product="mCG13774, transcript variant mCT193132"
FT                   /note="gene_id=mCG13774.2 transcript_id=mCT193132.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(10988297..10988396,10988748..10988883,
FT                   10990042..10990224,10991729..10991943,10993026..10993135,
FT                   10995017..10995143,10996247..10996418,10997326..10997480,
FT                   11014189..11014292,11024154..11024546))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13774"
FT                   /product="mCG13774, isoform CRA_c"
FT                   /note="gene_id=mCG13774.2 transcript_id=mCT17585.2
FT                   protein_id=mCP14136.2 isoform=CRA_c"
FT                   /db_xref="GOA:A2RSK7"
FT                   /db_xref="InterPro:IPR004749"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1929481"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSK7"
FT                   /protein_id="EDL33558.1"
FT   CDS             complement(join(10988297..10988396,10988748..10988883,
FT                   10990042..10990224,10991729..10991943,10993026..10993135,
FT                   10995017..10995143,10996247..10996418,10997326..10997480,
FT                   11024154..>11024158))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13774"
FT                   /product="mCG13774, isoform CRA_b"
FT                   /note="gene_id=mCG13774.2 transcript_id=mCT193132.0
FT                   protein_id=mCP114081.0 isoform=CRA_b"
FT                   /protein_id="EDL33557.1"
FT                   F"
FT   CDS             complement(join(10988392..10988396,10990042..10990224,
FT                   10991729..10991943,10993026..10993135,10995017..10995143,
FT                   10996247..10996418,10997326..10997480,11014189..11014292,
FT                   11024154..11024546))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13774"
FT                   /product="mCG13774, isoform CRA_a"
FT                   /note="gene_id=mCG13774.2 transcript_id=mCT170054.0
FT                   protein_id=mCP92591.0 isoform=CRA_a"
FT                   /protein_id="EDL33556.1"
FT   assembly_gap    10999539..10999558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11002283..11002302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11005231..11005250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11010050..11010302
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   gene            complement(11027816..11073008)
FT                   /locus_tag="mCG_13777"
FT                   /note="gene_id=mCG13777.2"
FT   mRNA            complement(join(11027816..11028374,11031167..11031302,
FT                   11033471..11033653,11035313..11035527,11036674..11036774,
FT                   11040653..11040779,11042066..11042237,11049920..11050074,
FT                   11052142..11052184,11071978..11072652))
FT                   /locus_tag="mCG_13777"
FT                   /product="mCG13777, transcript variant mCT170061"
FT                   /note="gene_id=mCG13777.2 transcript_id=mCT170061.0 created
FT                   on 11-JUN-2002"
FT   mRNA            complement(join(11027816..11028374,11031167..11031302,
FT                   11033471..11033653,11035313..11035527,11036674..11036774,
FT                   11040653..11040779,11042066..11042237,11049920..11050074,
FT                   11052142..11052245,11071978..11072652))
FT                   /locus_tag="mCG_13777"
FT                   /product="mCG13777, transcript variant mCT17588"
FT                   /note="gene_id=mCG13777.2 transcript_id=mCT17588.1 created
FT                   on 11-JUN-2002"
FT   mRNA            complement(join(11027816..11028374,11031167..11031302,
FT                   11033471..11033653,11035313..11035527,11036674..11036774,
FT                   11040653..11040779,11042066..11042237,11049920..11050074,
FT                   11052142..11052341))
FT                   /locus_tag="mCG_13777"
FT                   /product="mCG13777, transcript variant mCT170062"
FT                   /note="gene_id=mCG13777.2 transcript_id=mCT170062.0 created
FT                   on 11-JUN-2002"
FT   CDS             complement(join(11028299..11028374,11031167..11031302,
FT                   11033471..11033653,11035313..11035527,11036674..11036774,
FT                   11040653..11040779,11042066..11042237,11049920..11050074,
FT                   11052142..11052245,11071978..11072370))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13777"
FT                   /product="mCG13777, isoform CRA_d"
FT                   /note="gene_id=mCG13777.2 transcript_id=mCT17588.1
FT                   protein_id=mCP14143.1 isoform=CRA_d"
FT                   /protein_id="EDL33555.1"
FT   CDS             complement(join(11028299..11028374,11031167..11031302,
FT                   11033471..11033653,11035313..11035527,11036674..11036774,
FT                   11040653..11040779,11042066..11042237,11049920..11050074,
FT                   11052142..11052263))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13777"
FT                   /product="mCG13777, isoform CRA_c"
FT                   /note="gene_id=mCG13777.2 transcript_id=mCT170062.0
FT                   protein_id=mCP92602.0 isoform=CRA_c"
FT                   /protein_id="EDL33554.1"
FT   CDS             complement(join(11028299..11028374,11031167..11031302,
FT                   11033471..11033653,11035313..11035527,11036674..11036774,
FT                   11040653..11040779,11042066..11042237,11049920..11050043))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13777"
FT                   /product="mCG13777, isoform CRA_b"
FT                   /note="gene_id=mCG13777.2 transcript_id=mCT170061.0
FT                   protein_id=mCP92582.0 isoform=CRA_b"
FT                   /protein_id="EDL33553.1"
FT   assembly_gap    11044214..11044233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11058632..11058830,11071978..11072052,
FT                   11072797..11073008))
FT                   /locus_tag="mCG_13777"
FT                   /product="mCG13777, transcript variant mCT170060"
FT                   /note="gene_id=mCG13777.2 transcript_id=mCT170060.0 created
FT                   on 11-JUN-2002"
FT   CDS             complement(11058729..11058830)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13777"
FT                   /product="mCG13777, isoform CRA_a"
FT                   /note="gene_id=mCG13777.2 transcript_id=mCT170060.0
FT                   protein_id=mCP92588.0 isoform=CRA_a"
FT                   /protein_id="EDL33552.1"
FT   assembly_gap    11062118..11062163
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    11076092..11076759
FT                   /estimated_length=668
FT                   /gap_type="unknown"
FT   gene            complement(11099609..11113688)
FT                   /gene="Pdlim4"
FT                   /locus_tag="mCG_13780"
FT                   /note="gene_id=mCG13780.2"
FT   mRNA            complement(join(11099609..11099919,11100037..11100154,
FT                   11100470..11100633,11100823..11101004,11104618..11104696,
FT                   11108315..11108466,11113520..11113688))
FT                   /gene="Pdlim4"
FT                   /locus_tag="mCG_13780"
FT                   /product="PDZ and LIM domain 4, transcript variant
FT                   mCT17590"
FT                   /note="gene_id=mCG13780.2 transcript_id=mCT17590.1 created
FT                   on 05-FEB-2003"
FT   mRNA            complement(join(11099687..11099919,11100037..11100154,
FT                   11100470..11100633,11100823..11101004,11104618..11104696,
FT                   11113520..11113640))
FT                   /gene="Pdlim4"
FT                   /locus_tag="mCG_13780"
FT                   /product="PDZ and LIM domain 4, transcript variant
FT                   mCT179856"
FT                   /note="gene_id=mCG13780.2 transcript_id=mCT179856.0 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(11099715..11099919,11100037..11100154,
FT                   11100470..11100633,11100823..11101004,11104618..11104696,
FT                   11108315..11108466,11113520..11113612))
FT                   /codon_start=1
FT                   /gene="Pdlim4"
FT                   /locus_tag="mCG_13780"
FT                   /product="PDZ and LIM domain 4, isoform CRA_b"
FT                   /note="gene_id=mCG13780.2 transcript_id=mCT17590.1
FT                   protein_id=mCP14153.1 isoform=CRA_b"
FT                   /db_xref="GOA:P70271"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR031847"
FT                   /db_xref="MGI:MGI:1353470"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70271"
FT                   /protein_id="EDL33550.1"
FT   mRNA            complement(join(11103631..11104696,11108315..11108466,
FT                   11113520..11113688))
FT                   /gene="Pdlim4"
FT                   /locus_tag="mCG_13780"
FT                   /product="PDZ and LIM domain 4, transcript variant
FT                   mCT170063"
FT                   /note="gene_id=mCG13780.2 transcript_id=mCT170063.1 created
FT                   on 05-FEB-2003"
FT   CDS             complement(join(11104519..11104696,11108315..11108466,
FT                   11113520..11113612))
FT                   /codon_start=1
FT                   /gene="Pdlim4"
FT                   /locus_tag="mCG_13780"
FT                   /product="PDZ and LIM domain 4, isoform CRA_a"
FT                   /note="gene_id=mCG13780.2 transcript_id=mCT170063.1
FT                   protein_id=mCP92577.0 isoform=CRA_a"
FT                   /protein_id="EDL33549.1"
FT   CDS             complement(join(11104691..11104696,11113520..11113612))
FT                   /codon_start=1
FT                   /gene="Pdlim4"
FT                   /locus_tag="mCG_13780"
FT                   /product="PDZ and LIM domain 4, isoform CRA_c"
FT                   /note="gene_id=mCG13780.2 transcript_id=mCT179856.0
FT                   protein_id=mCP102778.0 isoform=CRA_c"
FT                   /protein_id="EDL33551.1"
FT                   /translation="MTHSVTLRGPSPWGFRLVGGRDFSAPLTISRA"
FT   assembly_gap    11138064..11138083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11144533..11144633
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            11145539..11176273
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /note="gene_id=mCG13782.2"
FT   mRNA            join(11145539..11145658,11146138..11146265,
FT                   11154827..11154932,11155604..11155700,11156041..11156192,
FT                   11158755..11158892,11162062..11162301,11163752..11163945,
FT                   11164688..11164864,11169275..11169345,11169564..11169663,
FT                   11170381..11170434,11170964..11171029,11173666..11173734,
FT                   11174084..11174180,11175808..11176266)
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, transcript
FT                   variant mCT17703"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT17703.2 created
FT                   on 10-JUN-2002"
FT   mRNA            join(<11145581..11145658,11146138..11146265,
FT                   11154827..11154932,11155604..11155700,11156041..11156192,
FT                   11158755..11158892,11162062..11162301,11163752..11163945,
FT                   11164688..11164864,11169275..11169345,11169564..11169663,
FT                   11170381..11170434,11170856..11172380)
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, transcript
FT                   variant mCT193133"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT193133.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11145586..11145658,11146138..11146265,
FT                   11154827..11154932,11155604..11155700,11156041..11156192,
FT                   11158755..11158892,11162062..11162301,11163752..11163945,
FT                   11164688..11164864,11169275..11169345,11169564..11169663,
FT                   11170381..11170434,11170856..11170963)
FT                   /codon_start=1
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT193133.0
FT                   protein_id=mCP114082.0 isoform=CRA_d"
FT                   /protein_id="EDL33546.1"
FT   mRNA            join(11145622..11145658,11146138..11146265,
FT                   11154827..11154932,11155604..11155700,11156041..11156192,
FT                   11158755..11158892,11162062..11162301,11163752..11163945,
FT                   11164688..11164738,11175896..11176268)
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, transcript
FT                   variant mCT170066"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT170066.0 created
FT                   on 11-JUN-2002"
FT   mRNA            join(<11145630..11145658,11146138..11146265,
FT                   11154827..11154932,11155604..11155700,11156041..11156192,
FT                   11158755..11158892,11162062..11162301,11163752..11163945,
FT                   11164688..11164864,11169275..11169345,11169564..11169663,
FT                   11170381..11170434,11170856..11170915,11173666..11173734,
FT                   11174084..11174180,11175808..11176268)
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, transcript
FT                   variant mCT193134"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT193134.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11145631..11145658,11146138..11146265,
FT                   11154827..11154932,11155604..11155700,11156041..11156192,
FT                   11158755..11158892,11162062..11162301,11163752..11163945,
FT                   11164688..11164864,11169275..11169345,11169564..11169663,
FT                   11170381..11170434,11170856..11170915,11173666..11173734,
FT                   11174084..11174180,11175808..11175878)
FT                   /codon_start=1
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT193134.0
FT                   protein_id=mCP114083.0 isoform=CRA_e"
FT                   /protein_id="EDL33547.1"
FT                   HERGQEFLRPCGTTEVD"
FT   mRNA            join(11145686..11145852,11146138..11146265,
FT                   11154827..11154932,11155100..11155170,11155604..11155700,
FT                   11156041..11156192,11158755..11158892,11162062..11162301,
FT                   11163752..11163945,11164688..11164864,11169275..11169345,
FT                   11169564..11169663,11170381..11170434,11170964..11171029,
FT                   11173666..11173734,11174084..11174180,11175808..11176273)
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, transcript
FT                   variant mCT170067"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT170067.0 created
FT                   on 11-JUN-2002"
FT   mRNA            join(11146135..11146220,11164699..11164864,
FT                   11169275..11169345,11169564..11169663,11170381..11170434,
FT                   11170856..11170915,11173666..11173734,11174084..11174180,
FT                   11175808..11175953)
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, transcript
FT                   variant mCT170068"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT170068.0 created
FT                   on 11-JUN-2002"
FT   CDS             join(11154845..11154932,11155604..11155700,
FT                   11156041..11156192,11158755..11158892,11162062..11162301,
FT                   11163752..11163945,11164688..11164738,11175896..11176003)
FT                   /codon_start=1
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT170066.0
FT                   protein_id=mCP92580.0 isoform=CRA_a"
FT                   /protein_id="EDL33543.1"
FT                   SQLLSGRSLEEPVFD"
FT   CDS             join(11154845..11154932,11155604..11155700,
FT                   11156041..11156192,11158755..11158892,11162062..11162301,
FT                   11163752..11163945,11164688..11164864,11169275..11169345,
FT                   11169564..11169663,11170381..11170434,11170964..11171029,
FT                   11173666..11173734,11174084..11174180,11175808..11175878)
FT                   /codon_start=1
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT17703.2
FT                   protein_id=mCP14167.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q5SX75"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013547"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:894286"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SX75"
FT                   /protein_id="EDL33548.1"
FT   CDS             join(11155609..11155700,11156041..11156192,
FT                   11158755..11158892,11162062..11162301,11163752..11163945,
FT                   11164688..11164864,11169275..11169345,11169564..11169663,
FT                   11170381..11170434,11170964..11171029,11173666..11173734,
FT                   11174084..11174180,11175808..11175878)
FT                   /codon_start=1
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT170067.0
FT                   protein_id=mCP92597.0 isoform=CRA_b"
FT                   /protein_id="EDL33544.1"
FT   CDS             join(11164817..11164864,11169275..11169345,
FT                   11169564..11169663,11170381..11170434,11170856..11170915,
FT                   11173666..11173734,11174084..11174180,11175808..11175878)
FT                   /codon_start=1
FT                   /gene="P4ha2"
FT                   /locus_tag="mCG_13782"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha II polypeptide, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG13782.2 transcript_id=mCT170068.0
FT                   protein_id=mCP92584.0 isoform=CRA_c"
FT                   /protein_id="EDL33545.1"
FT   assembly_gap    11180293..11183441
FT                   /estimated_length=3149
FT                   /gap_type="unknown"
FT   assembly_gap    11184103..11184122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11203414..11204544
FT                   /pseudo
FT                   /locus_tag="mCG_50506"
FT                   /note="gene_id=mCG50506.1"
FT   mRNA            11203414..11204544
FT                   /pseudo
FT                   /locus_tag="mCG_50506"
FT                   /note="gene_id=mCG50506.1 transcript_id=mCT50689.2 created
FT                   on 10-JUN-2002"
FT   assembly_gap    11212590..11213124
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   gene            complement(11222286..>11257687)
FT                   /locus_tag="mCG_1037744"
FT                   /note="gene_id=mCG1037744.0"
FT   mRNA            complement(join(11222286..11222744,11253031..11253195,
FT                   11257226..>11257687))
FT                   /locus_tag="mCG_1037744"
FT                   /product="mCG1037744"
FT                   /note="gene_id=mCG1037744.0 transcript_id=mCT155448.0
FT                   created on 10-JUN-2002"
FT   gene            <11243795..11244192
FT                   /locus_tag="mCG_50785"
FT                   /note="gene_id=mCG50785.2"
FT   mRNA            <11243795..11244192
FT                   /locus_tag="mCG_50785"
FT                   /product="mCG50785"
FT                   /note="gene_id=mCG50785.2 transcript_id=mCT50968.2 created
FT                   on 10-JUN-2002"
FT   CDS             11243795..11244133
FT                   /codon_start=1
FT                   /locus_tag="mCG_50785"
FT                   /product="mCG50785"
FT                   /note="gene_id=mCG50785.2 transcript_id=mCT50968.2
FT                   protein_id=mCP35323.1"
FT                   /protein_id="EDL33542.1"
FT                   LKRNMEYK"
FT   CDS             complement(11257385..>11257648)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037744"
FT                   /product="mCG1037744"
FT                   /note="gene_id=mCG1037744.0 transcript_id=mCT155448.0
FT                   protein_id=mCP80958.0"
FT                   /protein_id="EDL33541.1"
FT   assembly_gap    11279568..11280058
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    11285018..11285037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11292787..11295443)
FT                   /gene="Csf2"
FT                   /locus_tag="mCG_13784"
FT                   /note="gene_id=mCG13784.2"
FT   mRNA            complement(join(11292787..11293218,11293954..11294079,
FT                   11294866..11294907,11295005..11295443))
FT                   /gene="Csf2"
FT                   /locus_tag="mCG_13784"
FT                   /product="colony stimulating factor 2
FT                   (granulocyte-macrophage)"
FT                   /note="gene_id=mCG13784.2 transcript_id=mCT17704.2 created
FT                   on 10-JUN-2002"
FT   CDS             complement(join(11293111..11293218,11293954..11294079,
FT                   11294866..11294907,11295005..11295154))
FT                   /codon_start=1
FT                   /gene="Csf2"
FT                   /locus_tag="mCG_13784"
FT                   /product="colony stimulating factor 2
FT                   (granulocyte-macrophage)"
FT                   /note="gene_id=mCG13784.2 transcript_id=mCT17704.2
FT                   protein_id=mCP14133.2"
FT                   /db_xref="GOA:Q5SX78"
FT                   /db_xref="InterPro:IPR000773"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:1339752"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SX78"
FT                   /protein_id="EDL33540.1"
FT   gene            complement(11311284..11313258)
FT                   /gene="Il3"
FT                   /locus_tag="mCG_13767"
FT                   /note="gene_id=mCG13767.2"
FT   mRNA            complement(join(11311284..11311540,11311663..11311704,
FT                   11311840..11311935,11312929..11312970,11313067..11313258))
FT                   /gene="Il3"
FT                   /locus_tag="mCG_13767"
FT                   /product="interleukin 3"
FT                   /note="gene_id=mCG13767.2 transcript_id=mCT17578.2 created
FT                   on 10-JUN-2002"
FT   CDS             complement(join(11311385..11311540,11311663..11311704,
FT                   11311840..11311935,11312929..11312970,11313067..11313231))
FT                   /codon_start=1
FT                   /gene="Il3"
FT                   /locus_tag="mCG_13767"
FT                   /product="interleukin 3"
FT                   /note="gene_id=mCG13767.2 transcript_id=mCT17578.2
FT                   protein_id=mCP14174.2"
FT                   /db_xref="GOA:Q5SX77"
FT                   /db_xref="InterPro:IPR002183"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:96552"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SX77"
FT                   /protein_id="EDL33539.1"
FT                   VEC"
FT   assembly_gap    11330575..11330594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11349923..11407037
FT                   /gene="Acsl6"
FT                   /locus_tag="mCG_13787"
FT                   /note="gene_id=mCG13787.2"
FT   mRNA            join(11349923..11350012,11366238..11366458,
FT                   11369407..11369521,11370156..11370220,11371232..11371333,
FT                   11371726..11371825,11372708..11372886,11373995..11374027,
FT                   11375513..11375564,11380610..11380683,11382494..11382571,
FT                   11383970..11384104,11384558..11384692,11386055..11386150,
FT                   11387321..11387393,11390779..11390867,11391481..11391598,
FT                   11397541..11397644,11398512..11398583,11406579..11407037)
FT                   /gene="Acsl6"
FT                   /locus_tag="mCG_13787"
FT                   /product="acyl-CoA synthetase long-chain family member 6,
FT                   transcript variant mCT170070"
FT                   /note="gene_id=mCG13787.2 transcript_id=mCT170070.0 created
FT                   on 10-JUN-2002"
FT   mRNA            join(11349923..11350012,11366238..11366458,
FT                   11369407..11369521,11370156..11370220,11371232..11371333,
FT                   11371726..11371825,11372708..11372886,11373995..11374027,
FT                   11375513..11375564,11380610..11380683,11382629..11382706,
FT                   11383970..11384104,11384558..11384692,11386055..11386150,
FT                   11387321..11387393,11390779..11390867,11391481..11391598,
FT                   11397541..11397644,11398512..11398583,11406579..11407037)
FT                   /gene="Acsl6"
FT                   /locus_tag="mCG_13787"
FT                   /product="acyl-CoA synthetase long-chain family member 6,
FT                   transcript variant mCT17707"
FT                   /note="gene_id=mCG13787.2 transcript_id=mCT17707.2 created
FT                   on 10-JUN-2002"
FT   mRNA            join(11349923..11350012,11366238..11366458,
FT                   11369407..11369521,11370156..11370220,11371232..11371333,
FT                   11371726..11371825,11372708..11372886,11373995..11374027,
FT                   11375513..11375564,11380610..11380683,11382629..11382706,
FT                   11383970..11384104,11384558..11384692,11386055..11386150,
FT                   11387321..11387393,11390779..11390867,11391481..11391598,
FT                   11397541..11397644,11406785..11406934)
FT                   /gene="Acsl6"
FT                   /locus_tag="mCG_13787"
FT                   /product="acyl-CoA synthetase long-chain family member 6,
FT                   transcript variant mCT170069"
FT                   /note="gene_id=mCG13787.2 transcript_id=mCT170069.0 created
FT                   on 10-JUN-2002"
FT   CDS             join(11366264..11366458,11369407..11369521,
FT                   11370156..11370220,11371232..11371333,11371726..11371825,
FT                   11372708..11372886,11373995..11374027,11375513..11375564,
FT                   11380610..11380683,11382629..11382706,11383970..11384104,
FT                   11384558..11384692,11386055..11386150,11387321..11387393,
FT                   11390779..11390867,11391481..11391598,11397541..11397644,
FT                   11406785..11406811)
FT                   /codon_start=1
FT                   /gene="Acsl6"
FT                   /locus_tag="mCG_13787"
FT                   /product="acyl-CoA synthetase long-chain family member 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13787.2 transcript_id=mCT170069.0
FT                   protein_id=mCP92603.0 isoform=CRA_a"
FT                   /protein_id="EDL33536.1"
FT                   LCMKKESECHSSK"
FT   CDS             join(11366264..11366458,11369407..11369521,
FT                   11370156..11370220,11371232..11371333,11371726..11371825,
FT                   11372708..11372886,11373995..11374027,11375513..11375564,
FT                   11380610..11380683,11382494..11382571,11383970..11384104,
FT                   11384558..11384692,11386055..11386150,11387321..11387393,
FT                   11390779..11390867,11391481..11391598,11397541..11397644,
FT                   11398512..11398583,11406579..11406716)
FT                   /codon_start=1
FT                   /gene="Acsl6"
FT                   /locus_tag="mCG_13787"
FT                   /product="acyl-CoA synthetase long-chain family member 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13787.2 transcript_id=mCT170070.0
FT                   protein_id=mCP92594.0 isoform=CRA_b"
FT                   /protein_id="EDL33537.1"
FT                   EYFKKQIEELYLVSV"
FT   CDS             join(11366264..11366458,11369407..11369521,
FT                   11370156..11370220,11371232..11371333,11371726..11371825,
FT                   11372708..11372886,11373995..11374027,11375513..11375564,
FT                   11380610..11380683,11382629..11382706,11383970..11384104,
FT                   11384558..11384692,11386055..11386150,11387321..11387393,
FT                   11390779..11390867,11391481..11391598,11397541..11397644,
FT                   11398512..11398583,11406579..11406716)
FT                   /codon_start=1
FT                   /gene="Acsl6"
FT                   /locus_tag="mCG_13787"
FT                   /product="acyl-CoA synthetase long-chain family member 6,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG13787.2 transcript_id=mCT17707.2
FT                   protein_id=mCP14152.2 isoform=CRA_c"
FT                   /protein_id="EDL33538.1"
FT                   EYFKKQIEELYLVSV"
FT   assembly_gap    11379671..11379816
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    11395059..11396739
FT                   /estimated_length=1681
FT                   /gap_type="unknown"
FT   assembly_gap    11412396..11412415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11416550..11471512
FT                   /locus_tag="mCG_13783"
FT                   /note="gene_id=mCG13783.2"
FT   mRNA            join(<11416550..11416691,11416783..11416876,
FT                   11417637..11417718,11419399..11419459,11435237..11435368,
FT                   11439402..11439521,11440316..11440355,11443226..11443290,
FT                   11444583..11444659,11450597..11450756,11454377..11454450,
FT                   11456516..11456635,11462452..11462572,11471370..11471512)
FT                   /locus_tag="mCG_13783"
FT                   /product="mCG13783, transcript variant mCT17591"
FT                   /note="gene_id=mCG13783.2 transcript_id=mCT17591.2 created
FT                   on 10-JUN-2002"
FT   mRNA            join(<11416550..11416691,11416783..11416876,
FT                   11417637..11417718,11419399..11419459,11435237..11435368,
FT                   11439402..11439521,11440316..11440355,11443226..11443290,
FT                   11444583..11444659,11450597..11450752,11454370..11454450,
FT                   11456516..11456635,11462452..11462572,11471370..11471512)
FT                   /locus_tag="mCG_13783"
FT                   /product="mCG13783, transcript variant mCT193135"
FT                   /note="gene_id=mCG13783.2 transcript_id=mCT193135.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11416550..11416691,11416783..11416876,
FT                   11417637..11417718,11419399..11419459,11435237..11435368,
FT                   11439402..11439521,11440316..11440355,11443226..11443290,
FT                   11444583..11444659,11450597..11450756,11454377..11454450,
FT                   11456516..11456635,11462452..11462572,11471370..11471401)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13783"
FT                   /product="mCG13783, isoform CRA_a"
FT                   /note="gene_id=mCG13783.2 transcript_id=mCT17591.2
FT                   protein_id=mCP14158.2 isoform=CRA_a"
FT                   /protein_id="EDL33534.1"
FT   CDS             join(<11416550..11416691,11416783..11416876,
FT                   11417637..11417718,11419399..11419459,11435237..11435368,
FT                   11439402..11439521,11440316..11440355,11443226..11443290,
FT                   11444583..11444659,11450597..11450752,11454370..11454450,
FT                   11456516..11456635,11462452..11462572,11471370..11471401)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13783"
FT                   /product="mCG13783, isoform CRA_b"
FT                   /note="gene_id=mCG13783.2 transcript_id=mCT193135.0
FT                   protein_id=mCP114084.0 isoform=CRA_b"
FT                   /protein_id="EDL33535.1"
FT   assembly_gap    11429504..11432234
FT                   /estimated_length=2731
FT                   /gap_type="unknown"
FT   gene            11445740..11447154
FT                   /pseudo
FT                   /locus_tag="mCG_119250"
FT                   /note="gene_id=mCG119250.0"
FT   mRNA            11445740..11447154
FT                   /pseudo
FT                   /locus_tag="mCG_119250"
FT                   /note="gene_id=mCG119250.0 transcript_id=mCT120420.0
FT                   created on 10-JUN-2002"
FT   assembly_gap    11446655..11446684
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    11476428..11476447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11482887..11560554
FT                   /gene="A730024A03Rik"
FT                   /locus_tag="mCG_140540"
FT                   /note="gene_id=mCG140540.0"
FT   mRNA            join(<11482887..11482978,11510666..11510792,
FT                   11520211..11520345,11524802..11524902,11525162..11525236,
FT                   11527047..11527138,11532275..11532358,11533832..11533903,
FT                   11535365..11535500,11537755..11537956,11541164..11541249,
FT                   11543973..11544119,11545082..11545251,11546821..11548237,
FT                   11549300..11549468,11554443..11554640,11557931..11558046,
FT                   11560059..11560554)
FT                   /gene="A730024A03Rik"
FT                   /locus_tag="mCG_140540"
FT                   /product="RIKEN cDNA A730024A03"
FT                   /note="gene_id=mCG140540.0 transcript_id=mCT169962.0
FT                   created on 07-JUN-2002"
FT   CDS             join(11482887..11482978,11510666..11510792,
FT                   11520211..11520345,11524802..11524902,11525162..11525236,
FT                   11527047..11527138,11532275..11532358,11533832..11533903,
FT                   11535365..11535500,11537755..11537956,11541164..11541249,
FT                   11543973..11544119,11545082..11545251,11546821..11548237,
FT                   11549300..11549468,11554443..11554640,11557931..11558046,
FT                   11560059..11560137)
FT                   /codon_start=1
FT                   /gene="A730024A03Rik"
FT                   /locus_tag="mCG_140540"
FT                   /product="RIKEN cDNA A730024A03"
FT                   /note="gene_id=mCG140540.0 transcript_id=mCT169962.0
FT                   protein_id=mCP92575.0"
FT                   /protein_id="EDL33533.1"
FT   assembly_gap    11529465..11529573
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   gene            11567446..11741404
FT                   /gene="Rapgef6"
FT                   /locus_tag="mCG_140539"
FT                   /note="gene_id=mCG140539.0"
FT   mRNA            join(11567446..11567675,11588143..11588213,
FT                   11590996..11591052,11597414..11597497,11605951..11606020,
FT                   11612980..11613123,11655381..11655512,11664478..11664655,
FT                   11666916..11667052,11670461..11670619,11671185..11671337,
FT                   11675792..11675956,11679360..11679467,11680612..11680815,
FT                   11684350..11684458,11687311..11687551,11693782..11693939,
FT                   11701845..11702085,11705402..11705785,11708602..11708813,
FT                   11713213..11713336,11720795..11721015,11723878..11724066,
FT                   11728141..11728275,11734426..11734654,11735487..11735989,
FT                   11738505..11738807,11740655..11740810)
FT                   /gene="Rapgef6"
FT                   /locus_tag="mCG_140539"
FT                   /product="Rap guanine nucleotide exchange factor (GEF) 6,
FT                   transcript variant mCT169960"
FT                   /note="gene_id=mCG140539.0 transcript_id=mCT169960.0
FT                   created on 07-JUN-2002"
FT   mRNA            join(11567640..11567675,11588143..11588213,
FT                   11590996..11591052,11597414..11597497,11605951..11606020,
FT                   11612980..11613123,11655381..11655512,11664478..11664655,
FT                   11666916..11667052,11670461..11670619,11671185..11671337,
FT                   11675792..11675956,11679360..11679467,11680612..11680815,
FT                   11684350..11684458,11687311..11687551,11693782..11693939,
FT                   11701845..11702085,11705402..11705785,11708602..11708813,
FT                   11713213..11713336,11720795..11721015,11723878..11724066,
FT                   11728141..11728275,11734426..11734654,11735487..11735989,
FT                   11738505..11738807,11740315..11741404)
FT                   /gene="Rapgef6"
FT                   /locus_tag="mCG_140539"
FT                   /product="Rap guanine nucleotide exchange factor (GEF) 6,
FT                   transcript variant mCT169961"
FT                   /note="gene_id=mCG140539.0 transcript_id=mCT169961.0
FT                   created on 07-JUN-2002"
FT   CDS             join(11588176..11588213,11590996..11591052,
FT                   11597414..11597497,11605951..11606020,11612980..11613123,
FT                   11655381..11655512,11664478..11664655,11666916..11667052,
FT                   11670461..11670619,11671185..11671337,11675792..11675956,
FT                   11679360..11679467,11680612..11680815,11684350..11684458,
FT                   11687311..11687551,11693782..11693939,11701845..11702085,
FT                   11705402..11705785,11708602..11708813,11713213..11713336,
FT                   11720795..11721015,11723878..11724066,11728141..11728275,
FT                   11734426..11734654,11735487..11735989,11738505..11738807,
FT                   11740655..11740692)
FT                   /codon_start=1
FT                   /gene="Rapgef6"
FT                   /locus_tag="mCG_140539"
FT                   /product="Rap guanine nucleotide exchange factor (GEF) 6,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG140539.0 transcript_id=mCT169960.0
FT                   protein_id=mCP92587.0 isoform=CRA_a"
FT                   /protein_id="EDL33531.1"
FT   CDS             join(11588176..11588213,11590996..11591052,
FT                   11597414..11597497,11605951..11606020,11612980..11613123,
FT                   11655381..11655512,11664478..11664655,11666916..11667052,
FT                   11670461..11670619,11671185..11671337,11675792..11675956,
FT                   11679360..11679467,11680612..11680815,11684350..11684458,
FT                   11687311..11687551,11693782..11693939,11701845..11702085,
FT                   11705402..11705785,11708602..11708813,11713213..11713336,
FT                   11720795..11721015,11723878..11724066,11728141..11728275,
FT                   11734426..11734654,11735487..11735989,11738505..11738807,
FT                   11740315..11740340)
FT                   /codon_start=1
FT                   /gene="Rapgef6"
FT                   /locus_tag="mCG_140539"
FT                   /product="Rap guanine nucleotide exchange factor (GEF) 6,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG140539.0 transcript_id=mCT169961.0
FT                   protein_id=mCP92604.0 isoform=CRA_b"
FT                   /protein_id="EDL33532.1"
FT   assembly_gap    11590742..11590761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11624157..11624489
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    11633078..11633097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11634487..11634599
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    11644158..11644177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11722368..11722387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11737544..11737939
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    11746646..11746713
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            complement(11761599..11831724)
FT                   /locus_tag="mCG_1437"
FT                   /note="gene_id=mCG1437.3"
FT   mRNA            complement(join(11761599..11763866,11764384..11764498,
FT                   11767715..11767816,11784378..11784690,11785393..11785474,
FT                   11800540..11800693,11831638..11831724))
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, transcript variant mCT180808"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT180808.0 created
FT                   on 26-FEB-2003"
FT   mRNA            complement(join(11761599..11763866,11764384..11764498,
FT                   11767715..11767816,11800540..11800693,11831638..11831706))
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, transcript variant mCT169901"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT169901.1 created
FT                   on 26-FEB-2003"
FT   mRNA            complement(join(11761599..11763866,11764384..11764498,
FT                   11767715..11767816,11784378..11784690,11800540..11800693,
FT                   11804315..11804473,11831638..11831704))
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, transcript variant mCT180809"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT180809.0 created
FT                   on 26-FEB-2003"
FT   mRNA            complement(join(11761599..11763866,11764384..11764498,
FT                   11767715..11767816,11784378..11784690,11799960..11800058,
FT                   11800540..11800693,11831638..11831703))
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, transcript variant mCT180810"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT180810.0 created
FT                   on 26-FEB-2003"
FT   mRNA            complement(join(11762327..11763866,11764384..11764498,
FT                   11767715..11767816,11784378..11784690,11800540..11800693,
FT                   11831638..11831721))
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, transcript variant mCT8593"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT8593.2 created on
FT                   26-FEB-2003"
FT   CDS             complement(join(11763639..11763866,11764384..11764458))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, isoform CRA_a"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT169901.1
FT                   protein_id=mCP92600.1 isoform=CRA_a"
FT                   /protein_id="EDL33525.1"
FT   CDS             complement(join(11763639..11763866,11764384..11764458))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, isoform CRA_a"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT180808.0
FT                   protein_id=mCP103732.0 isoform=CRA_a"
FT                   /protein_id="EDL33526.1"
FT   CDS             complement(join(11763639..11763866,11764384..11764458))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, isoform CRA_a"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT180809.0
FT                   protein_id=mCP103730.0 isoform=CRA_a"
FT                   /protein_id="EDL33527.1"
FT   CDS             complement(join(11763639..11763866,11764384..11764458))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, isoform CRA_a"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT180810.0
FT                   protein_id=mCP103731.0 isoform=CRA_a"
FT                   /protein_id="EDL33528.1"
FT   CDS             complement(join(11763639..11763866,11764384..11764458))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1437"
FT                   /product="mCG1437, isoform CRA_a"
FT                   /note="gene_id=mCG1437.3 transcript_id=mCT8593.2
FT                   protein_id=mCP14169.2 isoform=CRA_a"
FT                   /protein_id="EDL33529.1"
FT   gene            <11772822..11778612
FT                   /locus_tag="mCG_114561"
FT                   /note="gene_id=mCG114561.0"
FT   mRNA            join(<11772822..11773007,11773108..11773226,
FT                   11773792..11773866,11778281..11778612)
FT                   /locus_tag="mCG_114561"
FT                   /product="mCG114561"
FT                   /note="gene_id=mCG114561.0 transcript_id=mCT115654.1
FT                   created on 07-JUN-2002"
FT   CDS             join(<11772990..11773007,11773108..11773226,
FT                   11773792..11773866,11778281..11778476)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114561"
FT                   /product="mCG114561"
FT                   /note="gene_id=mCG114561.0 transcript_id=mCT115654.1
FT                   protein_id=mCP80912.1"
FT                   /protein_id="EDL33530.1"
FT   assembly_gap    11777243..11777262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11808525..11808544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11810946..11810965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11845368..11845387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<11846725..>11858779)
FT                   /locus_tag="mCG_1037742"
FT                   /note="gene_id=mCG1037742.0"
FT   mRNA            complement(join(<11846725..11846802,11858083..>11858779))
FT                   /locus_tag="mCG_1037742"
FT                   /product="mCG1037742"
FT                   /note="gene_id=mCG1037742.0 transcript_id=mCT155446.0
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(<11846725..11846802,11858083..>11858397))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037742"
FT                   /product="mCG1037742"
FT                   /note="gene_id=mCG1037742.0 transcript_id=mCT155446.0
FT                   protein_id=mCP80955.0"
FT                   /protein_id="EDL33524.1"
FT   assembly_gap    11852548..11852567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11855777..11855835
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            <11863919..11868967
FT                   /locus_tag="mCG_145518"
FT                   /note="gene_id=mCG145518.0"
FT   mRNA            join(<11863919..11864062,11865223..11865510,
FT                   11868471..11868967)
FT                   /locus_tag="mCG_145518"
FT                   /product="mCG145518"
FT                   /note="gene_id=mCG145518.0 transcript_id=mCT184942.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<11863919..11864062,11865223..11865357)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145518"
FT                   /product="mCG145518"
FT                   /note="gene_id=mCG145518.0 transcript_id=mCT184942.0
FT                   protein_id=mCP105976.0"
FT                   /protein_id="EDL33523.1"
FT   gene            complement(11870867..>11905171)
FT                   /gene="1700024C24Rik"
FT                   /locus_tag="mCG_1441"
FT                   /note="gene_id=mCG1441.1"
FT   mRNA            complement(join(11870867..11871064,11876781..11876934,
FT                   11878868..11879150,11885224..11885496,11892873..11892954,
FT                   11894643..11894713,11897478..11897550,11904806..>11905171))
FT                   /gene="1700024C24Rik"
FT                   /locus_tag="mCG_1441"
FT                   /product="RIKEN cDNA 1700024C24"
FT                   /note="gene_id=mCG1441.1 transcript_id=mCT8596.1 created on
FT                   07-JUN-2002"
FT   assembly_gap    11874883..11875308
FT                   /estimated_length=426
FT                   /gap_type="unknown"
FT   CDS             complement(join(11885426..11885496,11892873..11892954,
FT                   11894643..11894713,11897478..11897550,11904806..>11904919))
FT                   /codon_start=1
FT                   /gene="1700024C24Rik"
FT                   /locus_tag="mCG_1441"
FT                   /product="RIKEN cDNA 1700024C24"
FT                   /note="gene_id=mCG1441.1 transcript_id=mCT8596.1
FT                   protein_id=mCP14162.1"
FT                   /protein_id="EDL33522.1"
FT   assembly_gap    11895641..11895773
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    11910492..11910511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11910763..11914822
FT                   /locus_tag="mCG_1442"
FT                   /note="gene_id=mCG1442.2"
FT   mRNA            join(11910763..11910924,11914173..11914277,
FT                   11914514..11914822)
FT                   /locus_tag="mCG_1442"
FT                   /product="mCG1442, transcript variant mCT8597"
FT                   /note="gene_id=mCG1442.2 transcript_id=mCT8597.2 created on
FT                   07-JUN-2002"
FT   mRNA            join(11910763..11910924,11914173..11914818)
FT                   /locus_tag="mCG_1442"
FT                   /product="mCG1442, transcript variant mCT169903"
FT                   /note="gene_id=mCG1442.2 transcript_id=mCT169903.0 created
FT                   on 07-JUN-2002"
FT   CDS             join(11910814..11910924,11914173..11914277,
FT                   11914514..11914678)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1442"
FT                   /product="mCG1442, isoform CRA_b"
FT                   /note="gene_id=mCG1442.2 transcript_id=mCT8597.2
FT                   protein_id=mCP14129.2 isoform=CRA_b"
FT                   /protein_id="EDL33521.1"
FT   CDS             join(11910814..11910924,11914173..11914421)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1442"
FT                   /product="mCG1442, isoform CRA_a"
FT                   /note="gene_id=mCG1442.2 transcript_id=mCT169903.0
FT                   protein_id=mCP92601.0 isoform=CRA_a"
FT                   /protein_id="EDL33520.1"
FT                   NSMETGLSPSPECWD"
FT   assembly_gap    11936474..11938011
FT                   /estimated_length=1538
FT                   /gap_type="unknown"
FT   assembly_gap    11939956..11939975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11949162..11956785
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /note="gene_id=mCG1447.2"
FT   mRNA            join(11949162..11949442,11953535..11953688,
FT                   11954949..11955066,11955448..11955547,11955845..11956785)
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, transcript variant
FT                   mCT8602"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT8602.1 created on
FT                   19-JUN-2003"
FT   mRNA            join(11949315..11949446,11953539..11953688,
FT                   11954949..11955066,11955448..11955547,11955845..11956784)
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, transcript variant
FT                   mCT169904"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT169904.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(11949328..11949442,11953535..11953688,
FT                   11954172..11954267,11954949..11955066,11955448..11955547,
FT                   11955845..11955942)
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, transcript variant
FT                   mCT178269"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT178269.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(11949340..11949442,11953535..11953688,
FT                   11954949..11954989,11956490..11956784)
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, transcript variant
FT                   mCT179862"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT179862.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(11949355..11949442,11953535..11953688,
FT                   11954949..11955066,11955448..11955547,11956490..11956785)
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, transcript variant
FT                   mCT179861"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT179861.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(11949356..11949446,11953539..11953666)
FT                   /codon_start=1
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, isoform CRA_a"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT169904.0
FT                   protein_id=mCP92578.0 isoform=CRA_a"
FT                   /protein_id="EDL33515.1"
FT   CDS             join(11949356..11949442,11953535..11953666)
FT                   /codon_start=1
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT178269.0
FT                   protein_id=mCP101191.0 isoform=CRA_b"
FT                   /protein_id="EDL33516.1"
FT   CDS             join(11949356..11949442,11953535..11953666)
FT                   /codon_start=1
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT179861.0
FT                   protein_id=mCP102783.0 isoform=CRA_b"
FT                   /protein_id="EDL33517.1"
FT   CDS             join(11949356..11949442,11953535..11953666)
FT                   /codon_start=1
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT179862.0
FT                   protein_id=mCP102784.0 isoform=CRA_b"
FT                   /protein_id="EDL33518.1"
FT   CDS             join(11949356..11949442,11953535..11953666)
FT                   /codon_start=1
FT                   /gene="Gpx3"
FT                   /locus_tag="mCG_1447"
FT                   /product="glutathione peroxidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG1447.2 transcript_id=mCT8602.1
FT                   protein_id=mCP14165.1 isoform=CRA_b"
FT                   /protein_id="EDL33519.1"
FT   gene            complement(11957193..>12009284)
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /note="gene_id=mCG1430.1"
FT   mRNA            complement(join(11957193..11957979,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,12009205..>12009284))
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, transcript variant
FT                   mCT193125"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT193125.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(11957193..11957979,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,11987124..11987295,
FT                   12009205..12009284))
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, transcript variant
FT                   mCT8584"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT8584.2 created on
FT                   07-JUN-2002"
FT   mRNA            complement(join(11957193..11957979,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,11987124..11987295,
FT                   11998708..11998760,12009205..12009265))
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, transcript variant
FT                   mCT169897"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT169897.0 created
FT                   on 07-JUN-2002"
FT   mRNA            complement(join(11957197..11957979,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,11987124..11987295,
FT                   12002379..>12002403))
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, transcript variant
FT                   mCT193126"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT193126.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(11957415..11957905,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,11987124..11987295))
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, transcript variant
FT                   mCT169898"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT169898.0 created
FT                   on 07-JUN-2002"
FT   CDS             complement(join(11957874..11957905,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,11987124..11987259))
FT                   /codon_start=1
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT169898.0
FT                   protein_id=mCP92605.0 isoform=CRA_b"
FT                   /protein_id="EDL33511.1"
FT                   PEPADLRLPKV"
FT   CDS             complement(join(11957945..11957979,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,12009205..>12009220))
FT                   /codon_start=1
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT193125.0
FT                   protein_id=mCP114088.0 isoform=CRA_c"
FT                   /protein_id="EDL33512.1"
FT   CDS             complement(join(11957945..11957979,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,11987124..>11987268))
FT                   /codon_start=1
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, isoform CRA_d"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT193126.0
FT                   protein_id=mCP114089.0 isoform=CRA_d"
FT                   /protein_id="EDL33513.1"
FT                   PAEPESADNDCDGPQ"
FT   CDS             complement(join(11957945..11957979,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,11987124..11987259))
FT                   /codon_start=1
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT169897.0
FT                   protein_id=mCP92593.0 isoform=CRA_a"
FT                   /protein_id="EDL33510.1"
FT                   PESADNDCDGPQ"
FT   CDS             complement(join(11957945..11957979,11961906..11961996,
FT                   11963206..11963397,11963666..11963731,11964210..11964335,
FT                   11965016..11965147,11967171..11967299,11970508..11970639,
FT                   11970786..11970851,11973114..11973203,11975506..11975629,
FT                   11977177..11977271,11980401..11980592,11982873..11982953,
FT                   11984359..11984477,11986011..11986148,11987124..11987259))
FT                   /codon_start=1
FT                   /gene="Tnip1"
FT                   /locus_tag="mCG_1430"
FT                   /product="TNFAIP3 interacting protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG1430.1 transcript_id=mCT8584.2
FT                   protein_id=mCP14166.2 isoform=CRA_a"
FT                   /protein_id="EDL33514.1"
FT                   PESADNDCDGPQ"
FT   gene            11993849..11994299
FT                   /pseudo
FT                   /locus_tag="mCG_1446"
FT                   /note="gene_id=mCG1446.1"
FT   mRNA            11993849..11994299
FT                   /pseudo
FT                   /locus_tag="mCG_1446"
FT                   /note="gene_id=mCG1446.1 transcript_id=mCT8599.1 created on
FT                   07-JUN-2002"
FT   gene            complement(12025309..>12080289)
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /note="gene_id=mCG1432.3"
FT   mRNA            complement(join(12025309..12025875,12027970..12028092,
FT                   12029652..12029710,12031433..12031528,12032479..12032572,
FT                   12033408..12033425,12037752..12037805,12038648..12038727,
FT                   12040672..12040762,12040855..12040968,12041273..12041367,
FT                   12042716..12042797,12044938..12045016,12046198..12046256,
FT                   12047625..12047747,12050398..12050456,12051086..12051181,
FT                   12051532..12051625,12052204..12052260,12054276..12054355,
FT                   12055825..12055915,12057707..12057820,12058418..12058512,
FT                   12060540..12060630,12068258..12068301,12080201..12080271))
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /product="annexin A6, transcript variant mCT8588"
FT                   /note="gene_id=mCG1432.3 transcript_id=mCT8588.2 created on
FT                   07-JUN-2002"
FT   mRNA            complement(join(12025309..12025875,12027970..12028092,
FT                   12029652..12029710,12031433..12031528,12032479..12032572,
FT                   12037752..12037805,12038648..12038727,12040672..12040762,
FT                   12040855..12040968,12041273..12041367,12042716..12042797,
FT                   12044938..12045016,12046198..12046256,12047625..12047747,
FT                   12050398..12050456,12051086..12051181,12051532..12051625,
FT                   12052204..12052260,12054276..12054355,12055825..12055915,
FT                   12057707..12057820,12058418..12058512,12060540..12060635,
FT                   12080201..>12080255))
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /product="annexin A6, transcript variant mCT169899"
FT                   /note="gene_id=mCG1432.3 transcript_id=mCT169899.0 created
FT                   on 07-JUN-2002"
FT   mRNA            complement(join(12025468..12025875,12027970..12028092,
FT                   12029652..12029710,12031433..12031528,12032479..12032572,
FT                   12037752..12037805,12038648..12038727,12040672..12040762,
FT                   12040855..12040968,12041273..12041367,12042716..12042797,
FT                   12044938..12045016,12046198..12046256,12047625..12047747,
FT                   12050398..12050456,12051086..12051181,12051532..12051625,
FT                   12052204..12052260,12054276..12054355,12055825..12055915,
FT                   12057707..12057820,12058418..12058512,12060540..12060630,
FT                   12068258..12068301,12080201..>12080289))
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /product="annexin A6, transcript variant mCT193128"
FT                   /note="gene_id=mCG1432.3 transcript_id=mCT193128.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(12025816..12025875,12027970..12028092,
FT                   12029652..12029710,12031433..12031528,12032479..12032572,
FT                   12037752..12037805,12038648..12038727,12040672..12040762,
FT                   12040855..12040968,12041273..12041367,12042716..12042797,
FT                   12044938..12045016,12046198..12046256,12047625..12047747,
FT                   12050398..12050456,12051086..12051181,12051532..12051625,
FT                   12052204..12052260,12054276..12054355,12055825..12055915,
FT                   12057707..12057820,12058418..12058512,12060540..12060635,
FT                   12080201..>12080204))
FT                   /codon_start=1
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /product="annexin A6, isoform CRA_c"
FT                   /note="gene_id=mCG1432.3 transcript_id=mCT169899.0
FT                   protein_id=mCP92583.0 isoform=CRA_c"
FT                   /protein_id="EDL33508.1"
FT   CDS             complement(join(12025816..12025875,12027970..12028092,
FT                   12029652..12029710,12031433..12031528,12032479..12032572,
FT                   12037752..12037805,12038648..12038727,12040672..12040762,
FT                   12040855..12040968,12041273..12041367,12042716..12042797,
FT                   12044938..12045016,12046198..12046256,12047625..12047747,
FT                   12050398..12050456,12051086..12051181,12051532..12051625,
FT                   12052204..12052260,12054276..12054355,12055825..12055915,
FT                   12057707..12057820,12058418..12058512,12060540..12060630,
FT                   12068258..12068301,12080201..>12080204))
FT                   /codon_start=1
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /product="annexin A6, isoform CRA_b"
FT                   /note="gene_id=mCG1432.3 transcript_id=mCT193128.0
FT                   protein_id=mCP114090.0 isoform=CRA_b"
FT                   /protein_id="EDL33507.1"
FT   CDS             complement(join(12025816..12025875,12027970..12028092,
FT                   12029652..12029710,12031433..12031528,12032479..12032572,
FT                   12033408..12033425,12037752..12037805,12038648..12038727,
FT                   12040672..12040762,12040855..12040968,12041273..12041367,
FT                   12042716..12042797,12044938..12045016,12046198..12046256,
FT                   12047625..12047747,12050398..12050456,12051086..12051181,
FT                   12051532..12051625,12052204..12052260,12054276..12054355,
FT                   12055825..12055915,12057707..12057820,12058418..12058512,
FT                   12060540..12060630,12068258..12068275))
FT                   /codon_start=1
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /product="annexin A6, isoform CRA_d"
FT                   /note="gene_id=mCG1432.3 transcript_id=mCT8588.2
FT                   protein_id=mCP14127.2 isoform=CRA_d"
FT                   /protein_id="EDL33509.1"
FT   mRNA            complement(join(12037327..12037805,12038648..12038727,
FT                   12040672..12040762,12040855..12040968,12041273..12041367,
FT                   12042716..12042797,12044938..12045016,12046198..12046256,
FT                   12047625..12047747,12050398..12050456,12051086..12051181,
FT                   12051532..12051625,12052204..12052260,12054276..12054355,
FT                   12055825..12055915,12057707..12057820,12058418..12058512,
FT                   12060540..12060635,12080201..>12080257))
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /product="annexin A6, transcript variant mCT169900"
FT                   /note="gene_id=mCG1432.3 transcript_id=mCT169900.0 created
FT                   on 07-JUN-2002"
FT   CDS             complement(join(12037653..12037805,12038648..12038727,
FT                   12040672..12040762,12040855..12040968,12041273..12041367,
FT                   12042716..12042797,12044938..12045016,12046198..12046256,
FT                   12047625..12047747,12050398..12050456,12051086..12051181,
FT                   12051532..12051625,12052204..12052260,12054276..12054355,
FT                   12055825..12055915,12057707..12057820,12058418..12058512,
FT                   12060540..12060635,12080201..>12080204))
FT                   /codon_start=1
FT                   /gene="Anxa6"
FT                   /locus_tag="mCG_1432"
FT                   /product="annexin A6, isoform CRA_a"
FT                   /note="gene_id=mCG1432.3 transcript_id=mCT169900.0
FT                   protein_id=mCP92609.0 isoform=CRA_a"
FT                   /protein_id="EDL33506.1"
FT   assembly_gap    12075195..12079119
FT                   /estimated_length=3925
FT                   /gap_type="unknown"
FT   assembly_gap    12083376..12083700
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   gene            complement(12096665..12125036)
FT                   /gene="Ccdc69"
FT                   /locus_tag="mCG_1443"
FT                   /note="gene_id=mCG1443.3"
FT   mRNA            complement(join(12096665..12097492,12098086..12098183,
FT                   12099275..12099394,12099822..12099923,12101899..12101972,
FT                   12107387..12107471,12124917..12125013))
FT                   /gene="Ccdc69"
FT                   /locus_tag="mCG_1443"
FT                   /product="coiled-coil domain containing 69, transcript
FT                   variant mCT8600"
FT                   /note="gene_id=mCG1443.3 transcript_id=mCT8600.2 created on
FT                   26-FEB-2003"
FT   CDS             complement(join(12097411..12097492,12098086..12098183,
FT                   12099275..12099394,12099822..12099923,12101899..12101972,
FT                   12107387..12107471,12124917..12124964))
FT                   /codon_start=1
FT                   /gene="Ccdc69"
FT                   /locus_tag="mCG_1443"
FT                   /product="coiled-coil domain containing 69, isoform CRA_b"
FT                   /note="gene_id=mCG1443.3 transcript_id=mCT8600.2
FT                   protein_id=mCP14170.2 isoform=CRA_b"
FT                   /protein_id="EDL33505.1"
FT   mRNA            complement(join(12097664..12098183,12099275..12099394,
FT                   12099822..12099923,12101899..12101972,12107387..12107471,
FT                   12124917..12125036))
FT                   /gene="Ccdc69"
FT                   /locus_tag="mCG_1443"
FT                   /product="coiled-coil domain containing 69, transcript
FT                   variant mCT180811"
FT                   /note="gene_id=mCG1443.3 transcript_id=mCT180811.0 created
FT                   on 26-FEB-2003"
FT   CDS             complement(join(12098082..12098183,12099275..12099394,
FT                   12099822..12099923,12101899..12101972,12107387..12107471,
FT                   12124917..12124964))
FT                   /codon_start=1
FT                   /gene="Ccdc69"
FT                   /locus_tag="mCG_1443"
FT                   /product="coiled-coil domain containing 69, isoform CRA_a"
FT                   /note="gene_id=mCG1443.3 transcript_id=mCT180811.0
FT                   protein_id=mCP103733.0 isoform=CRA_a"
FT                   /protein_id="EDL33504.1"
FT                   LQFQAGNRLTMSR"
FT   assembly_gap    12143149..12143540
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   gene            12144902..12157814
FT                   /gene="Gm2a"
FT                   /locus_tag="mCG_1434"
FT                   /note="gene_id=mCG1434.2"
FT   mRNA            join(12144902..12145162,12150505..12150666,
FT                   12155814..12155996,12156294..12157814)
FT                   /gene="Gm2a"
FT                   /locus_tag="mCG_1434"
FT                   /product="GM2 ganglioside activator protein"
FT                   /note="gene_id=mCG1434.2 transcript_id=mCT8589.1 created on
FT                   07-JUN-2002"
FT   CDS             join(12145082..12145162,12150505..12150666,
FT                   12155814..12155996,12156294..12156449)
FT                   /codon_start=1
FT                   /gene="Gm2a"
FT                   /locus_tag="mCG_1434"
FT                   /product="GM2 ganglioside activator protein"
FT                   /note="gene_id=mCG1434.2 transcript_id=mCT8589.1
FT                   protein_id=mCP14147.1"
FT                   /db_xref="GOA:Q5F1Z8"
FT                   /db_xref="InterPro:IPR003172"
FT                   /db_xref="InterPro:IPR028996"
FT                   /db_xref="MGI:MGI:95762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F1Z8"
FT                   /protein_id="EDL33503.1"
FT   assembly_gap    12160930..12161001
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   gene            complement(12165018..12165810)
FT                   /pseudo
FT                   /locus_tag="mCG_1037676"
FT                   /note="gene_id=mCG1037676.1"
FT   mRNA            complement(12165018..12165810)
FT                   /pseudo
FT                   /locus_tag="mCG_1037676"
FT                   /note="gene_id=mCG1037676.1 transcript_id=mCT155380.1
FT                   created on 07-JUN-2002"
FT   gene            complement(12171766..>12196783)
FT                   /gene="Slc36a3"
FT                   /locus_tag="mCG_114555"
FT                   /note="gene_id=mCG114555.1"
FT   mRNA            complement(join(12171766..12172067,12172509..12172678,
FT                   12176453..12176619,12178432..12178527,12182156..12182374,
FT                   12184184..12184268,12189470..12189565,12192837..12192925,
FT                   12195249..12195339,12196725..>12196783))
FT                   /gene="Slc36a3"
FT                   /locus_tag="mCG_114555"
FT                   /product="solute carrier family 36 (proton/amino acid
FT                   symporter), member 3"
FT                   /note="gene_id=mCG114555.1 transcript_id=mCT115646.1
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(12171799..12172067,12172509..12172678,
FT                   12176453..12176619,12178432..12178527,12182156..12182374,
FT                   12184184..12184268,12189470..12189565,12192837..12192925,
FT                   12195249..12195339,12196725..12196783))
FT                   /codon_start=1
FT                   /gene="Slc36a3"
FT                   /locus_tag="mCG_114555"
FT                   /product="solute carrier family 36 (proton/amino acid
FT                   symporter), member 3"
FT                   /note="gene_id=mCG114555.1 transcript_id=mCT115646.1
FT                   protein_id=mCP80897.1"
FT                   /protein_id="EDL33501.1"
FT   gene            <12183932..12186899
FT                   /locus_tag="mCG_140541"
FT                   /note="gene_id=mCG140541.0"
FT   mRNA            join(<12183932..12184062,12186507..12186899)
FT                   /locus_tag="mCG_140541"
FT                   /product="mCG140541"
FT                   /note="gene_id=mCG140541.0 transcript_id=mCT169963.0
FT                   created on 07-JUN-2002"
FT   CDS             join(<12184061..12184062,12186507..12186819)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140541"
FT                   /product="mCG140541"
FT                   /note="gene_id=mCG140541.0 transcript_id=mCT169963.0
FT                   protein_id=mCP92581.0"
FT                   /protein_id="EDL33502.1"
FT                   "
FT   assembly_gap    12190392..12190543
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   gene            complement(12196179..12198395)
FT                   /locus_tag="mCG_148149"
FT                   /note="gene_id=mCG148149.0"
FT   mRNA            complement(join(12196179..12196640,12197857..12198127,
FT                   12198237..12198395))
FT                   /locus_tag="mCG_148149"
FT                   /product="mCG148149"
FT                   /note="gene_id=mCG148149.0 transcript_id=mCT188412.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(12196484..12196640,12197857..12198008))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148149"
FT                   /product="mCG148149"
FT                   /note="gene_id=mCG148149.0 transcript_id=mCT188412.0
FT                   protein_id=mCP108594.0"
FT                   /db_xref="MGI:MGI:2665001"
FT                   /db_xref="UniProtKB/TrEMBL:Q810P4"
FT                   /protein_id="EDL33500.1"
FT   assembly_gap    12200705..12200911
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    12202945..12202964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12205021..12232161)
FT                   /gene="Slc36a2"
FT                   /locus_tag="mCG_114554"
FT                   /note="gene_id=mCG114554.1"
FT   mRNA            complement(join(12205021..12206246,12209289..12209458,
FT                   12210876..12211042,12215565..12215663,12216589..12216807,
FT                   12221503..12221587,12226404..12226499,12227786..12227874,
FT                   12228628..12228718,12231894..12232161))
FT                   /gene="Slc36a2"
FT                   /locus_tag="mCG_114554"
FT                   /product="solute carrier family 36 (proton/amino acid
FT                   symporter), member 2"
FT                   /note="gene_id=mCG114554.1 transcript_id=mCT115645.1
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(12205975..12206246,12209289..12209458,
FT                   12210876..12211042,12215565..12215663,12216589..12216807,
FT                   12221503..12221587,12226404..12226499,12227786..12227874,
FT                   12228628..12228718,12231894..12232042))
FT                   /codon_start=1
FT                   /gene="Slc36a2"
FT                   /locus_tag="mCG_114554"
FT                   /product="solute carrier family 36 (proton/amino acid
FT                   symporter), member 2"
FT                   /note="gene_id=mCG114554.1 transcript_id=mCT115645.1
FT                   protein_id=mCP80889.1"
FT                   /protein_id="EDL33499.1"
FT   assembly_gap    12213134..12213461
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    12218109..12218173
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    12220315..12220994
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    12222527..12222751
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    12224217..12224572
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   gene            complement(12238755..>12244722)
FT                   /locus_tag="mCG_1037741"
FT                   /note="gene_id=mCG1037741.0"
FT   mRNA            complement(join(12238755..12240175,12242510..12242649,
FT                   12244493..>12244722))
FT                   /locus_tag="mCG_1037741"
FT                   /product="mCG1037741"
FT                   /note="gene_id=mCG1037741.0 transcript_id=mCT155445.0
FT                   created on 07-JUN-2002"
FT   CDS             complement(join(12239686..12240175,12242510..>12242562))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037741"
FT                   /product="mCG1037741"
FT                   /note="gene_id=mCG1037741.0 transcript_id=mCT155445.0
FT                   protein_id=mCP80949.0"
FT                   /protein_id="EDL33498.1"
FT                   CLPLRTQDVSAILQRRM"
FT   assembly_gap    12247205..12249553
FT                   /estimated_length=2349
FT                   /gap_type="unknown"
FT   gene            12250020..12282031
FT                   /gene="Slc36a1"
FT                   /locus_tag="mCG_145713"
FT                   /note="gene_id=mCG145713.0"
FT   mRNA            join(12250020..12250135,12258517..12258555,
FT                   12259583..12259727,12264571..12264661,12265143..12265231,
FT                   12265939..12266034,12267560..12267644,12269159..12269377,
FT                   12270517..12270615,12271528..12271694,12273799..12273968,
FT                   12278087..>12278358)
FT                   /gene="Slc36a1"
FT                   /locus_tag="mCG_145713"
FT                   /product="solute carrier family 36 (proton/amino acid
FT                   symporter), member 1, transcript variant mCT185277"
FT                   /note="gene_id=mCG145713.0 transcript_id=mCT185277.0
FT                   created on 10-JUN-2003"
FT   mRNA            join(12250021..12250135,12259583..12259727,
FT                   12264571..12264661,12265143..12265231,12265939..12266034,
FT                   12267560..12267644,12269159..12269377,12270517..12270615,
FT                   12271528..12271694,12273799..12273968,12278087..12278426,
FT                   12279208..12282031)
FT                   /gene="Slc36a1"
FT                   /locus_tag="mCG_145713"
FT                   /product="solute carrier family 36 (proton/amino acid
FT                   symporter), member 1, transcript variant mCT185276"
FT                   /note="gene_id=mCG145713.0 transcript_id=mCT185276.0
FT                   created on 10-JUN-2003"
FT   CDS             join(12259588..12259727,12264571..12264661,
FT                   12265143..12265231,12265939..12266034,12267560..12267644,
FT                   12269159..12269377,12270517..12270615,12271528..12271694,
FT                   12273799..12273968,12278087..12278358)
FT                   /codon_start=1
FT                   /gene="Slc36a1"
FT                   /locus_tag="mCG_145713"
FT                   /product="solute carrier family 36 (proton/amino acid
FT                   symporter), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG145713.0 transcript_id=mCT185276.0
FT                   protein_id=mCP106535.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5F227"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="MGI:MGI:2445299"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F227"
FT                   /protein_id="EDL33496.1"
FT                   IQPSHSDSSTNSTSAFI"
FT   CDS             join(12259588..12259727,12264571..12264661,
FT                   12265143..12265231,12265939..12266034,12267560..12267644,
FT                   12269159..12269377,12270517..12270615,12271528..12271694,
FT                   12273799..12273968,12278087..12278358)
FT                   /codon_start=1
FT                   /gene="Slc36a1"
FT                   /locus_tag="mCG_145713"
FT                   /product="solute carrier family 36 (proton/amino acid
FT                   symporter), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG145713.0 transcript_id=mCT185277.0
FT                   protein_id=mCP106534.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5F227"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="MGI:MGI:2445299"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F227"
FT                   /protein_id="EDL33497.1"
FT                   IQPSHSDSSTNSTSAFI"
FT   assembly_gap    12261704..12261999
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    12273091..12273254
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    12287394..12288328
FT                   /estimated_length=935
FT                   /gap_type="unknown"
FT   gene            complement(12297187..>12357043)
FT                   /locus_tag="mCG_1445"
FT                   /note="gene_id=mCG1445.2"
FT   mRNA            complement(join(12297187..12298099,12299125..12299582,
FT                   12301682..12301835,12302082..12302523,12306024..12306169,
FT                   12307640..12308450,12310974..12311171,12312268..12312411,
FT                   12312866..12313003,12313941..12314155,12314773..12315156,
FT                   12317679..12317912,12320670..12320823,12323573..12323769,
FT                   12325724..12329782,12330565..12330775,12332350..12332631,
FT                   12333905..12334044,12336561..12336771,12340797..12341108,
FT                   12343338..12343396,12348419..12348733,12353785..>12357043))
FT                   /locus_tag="mCG_1445"
FT                   /product="mCG1445"
FT                   /note="gene_id=mCG1445.2 transcript_id=mCT8598.2 created on
FT                   06-JUN-2002"
FT   CDS             complement(join(12297567..12298099,12299125..12299582,
FT                   12301682..12301835,12302082..12302523,12306024..12306169,
FT                   12307640..12308450,12310974..12311171,12312268..12312411,
FT                   12312866..12313003,12313941..12314155,12314773..12315156,
FT                   12317679..12317912,12320670..12320823,12323573..12323769,
FT                   12325724..12329782,12330565..12330775,12332350..12332631,
FT                   12333905..12334044,12336561..12336771,12340797..12341108,
FT                   12343338..12343396,12348419..12348733,12353785..12357043))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1445"
FT                   /product="mCG1445"
FT                   /note="gene_id=mCG1445.2 transcript_id=mCT8598.2
FT                   protein_id=mCP14141.2"
FT                   /db_xref="GOA:Q5F226"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:2685369"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5F226"
FT                   /protein_id="EDL33495.1"
FT   assembly_gap    12309958..12310236
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    12311517..12311536
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12341929..12342185
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    12364524..12364551
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    12368429..12368448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12382720..12382769
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    12404103..12404122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12411074..12411462
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    12413386..12413865
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    12418860..12419402
FT                   /estimated_length=543
FT                   /gap_type="unknown"
FT   assembly_gap    12420679..12420698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12436531..12436550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12438329..12438762
FT                   /locus_tag="mCG_1037739"
FT                   /note="gene_id=mCG1037739.0"
FT   mRNA            join(<12438329..12438677,12438747..12438762)
FT                   /locus_tag="mCG_1037739"
FT                   /product="mCG1037739"
FT                   /note="gene_id=mCG1037739.0 transcript_id=mCT155443.1
FT                   created on 06-JUN-2002"
FT   CDS             <12438466..12438657
FT                   /codon_start=1
FT                   /locus_tag="mCG_1037739"
FT                   /product="mCG1037739"
FT                   /note="gene_id=mCG1037739.0 transcript_id=mCT155443.1
FT                   protein_id=mCP80940.0"
FT                   /protein_id="EDL33494.1"
FT                   ITLVCLRGTSFIKCSVGF"
FT   gene            complement(12439908..>12453099)
FT                   /gene="Sparc"
FT                   /locus_tag="mCG_1436"
FT                   /note="gene_id=mCG1436.1"
FT   mRNA            complement(join(12439908..12441016,12441634..12441782,
FT                   12444049..12444197,12444693..12444826,12447452..12447572,
FT                   12450994..12451115,12452325..12452412,12453036..>12453099))
FT                   /gene="Sparc"
FT                   /locus_tag="mCG_1436"
FT                   /product="secreted acidic cysteine rich glycoprotein"
FT                   /note="gene_id=mCG1436.1 transcript_id=mCT8590.1 created on
FT                   06-JUN-2002"
FT   CDS             complement(join(12440988..12441016,12441634..12441782,
FT                   12444049..12444197,12444693..12444826,12447452..12447572,
FT                   12450994..12451115,12452325..12452412,12453036..>12453098))
FT                   /codon_start=1
FT                   /gene="Sparc"
FT                   /locus_tag="mCG_1436"
FT                   /product="secreted acidic cysteine rich glycoprotein"
FT                   /note="gene_id=mCG1436.1 transcript_id=mCT8590.1
FT                   protein_id=mCP14148.1"
FT                   /protein_id="EDL33493.1"
FT                   LVI"
FT   assembly_gap    12446145..12446539
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    12449462..12449755
FT                   /estimated_length=294
FT                   /gap_type="unknown"
CO   join(complement(AAHY01092806.1:1..5068),gap(4857),
CO   complement(AAHY01092807.1:1..8923),gap(696),AAHY01092808.1:1..1264,
CO   gap(23396),complement(AAHY01092809.1:1..12656),gap(20),
CO   complement(AAHY01092810.1:1..11667),gap(495),
CO   complement(AAHY01092811.1:1..16789),gap(20),
CO   complement(AAHY01092812.1:1..36340),gap(20),
CO   complement(AAHY01092813.1:1..5469),gap(20),
CO   complement(AAHY01092814.1:1..1929),gap(364),
CO   complement(AAHY01092815.1:1..10055),gap(20),
CO   complement(AAHY01092816.1:1..1673),gap(20),AAHY01092817.1:1..815,gap(895),
CO   complement(AAHY01092818.1:1..1122),gap(2048),
CO   complement(AAHY01092819.1:1..4196),gap(20),
CO   complement(AAHY01092820.1:1..1093),gap(20),AAHY01092821.1:1..1264,gap(51),
CO   complement(AAHY01092822.1:1..11406),gap(20),
CO   complement(AAHY01092823.1:1..1203),gap(2680),
CO   complement(AAHY01092824.1:1..1211),gap(20),
CO   complement(AAHY01092825.1:1..13884),gap(316),
CO   complement(AAHY01092826.1:1..9935),gap(117),
CO   complement(AAHY01092827.1:1..17828),gap(456),
CO   complement(AAHY01092828.1:1..18577),gap(158),
CO   complement(AAHY01092829.1:1..14038),gap(55),
CO   complement(AAHY01092830.1:1..36260),gap(434),
CO   complement(AAHY01092831.1:1..36820),gap(20),
CO   complement(AAHY01092832.1:1..51509),gap(20),
CO   complement(AAHY01092833.1:1..9459),gap(193),
CO   complement(AAHY01092834.1:1..1573),gap(20),
CO   complement(AAHY01092835.1:1..9981),gap(1177),
CO   complement(AAHY01092836.1:1..21308),gap(20),
CO   complement(AAHY01092837.1:1..3717),gap(20),AAHY01092838.1:1..11726,gap(23),
CO   complement(AAHY01092839.1:1..34722),gap(20),
CO   complement(AAHY01092840.1:1..15622),gap(239),AAHY01092841.1:1..8098,
CO   gap(446),complement(AAHY01092842.1:1..6717),gap(91),AAHY01092843.1:1..1045,
CO   gap(113),complement(AAHY01092844.1:1..2770),gap(88),
CO   complement(AAHY01092845.1:1..19539),gap(20),
CO   complement(AAHY01092846.1:1..18237),gap(2635),AAHY01092847.1:1..2175,
CO   gap(20),complement(AAHY01092848.1:1..2835),gap(20),AAHY01092849.1:1..2256,
CO   gap(463),complement(AAHY01092850.1:1..6792),gap(114),
CO   complement(AAHY01092851.1:1..7757),gap(217),
CO   complement(AAHY01092852.1:1..609),gap(348),
CO   complement(AAHY01092853.1:1..3266),gap(54),
CO   complement(AAHY01092854.1:1..2928),gap(66),
CO   complement(AAHY01092855.1:1..1284),gap(415),
CO   complement(AAHY01092856.1:1..34309),gap(98),
CO   complement(AAHY01092857.1:1..9373),gap(55),
CO   complement(AAHY01092858.1:1..5806),gap(368),
CO   complement(AAHY01092859.1:1..832),gap(1212),
CO   complement(AAHY01092860.1:1..32358),gap(610),
CO   complement(AAHY01092861.1:1..3404),gap(158),AAHY01092862.1:1..30591,
CO   gap(354),complement(AAHY01092863.1:1..11128),gap(525),
CO   complement(AAHY01092864.1:1..9666),gap(20),
CO   complement(AAHY01092865.1:1..1845),gap(20),AAHY01092866.1:1..1491,gap(20),
CO   complement(AAHY01092867.1:1..17010),gap(90),AAHY01092868.1:1..7304,gap(39),
CO   complement(AAHY01092869.1:1..25073),gap(124),
CO   complement(AAHY01092870.1:1..24176),gap(61),
CO   complement(AAHY01092871.1:1..16675),gap(184),
CO   complement(AAHY01092872.1:1..33168),gap(873),
CO   complement(AAHY01092873.1:1..3366),gap(20),
CO   complement(AAHY01092874.1:1..31494),gap(129),
CO   complement(AAHY01092875.1:1..20620),gap(613),
CO   complement(AAHY01092876.1:1..7527),gap(432),
CO   complement(AAHY01092877.1:1..5655),gap(20),AAHY01092878.1:1..4067,gap(239),
CO   complement(AAHY01092879.1:1..1926),gap(20),
CO   complement(AAHY01092880.1:1..5468),gap(175),
CO   complement(AAHY01092881.1:1..10428),gap(35),
CO   complement(AAHY01092882.1:1..43503),gap(188),
CO   complement(AAHY01092883.1:1..10633),gap(130),
CO   complement(AAHY01092884.1:1..9855),gap(20),
CO   complement(AAHY01092885.1:1..15640),gap(96),
CO   complement(AAHY01092886.1:1..6872),gap(782),
CO   complement(AAHY01092887.1:1..2686),gap(154),
CO   complement(AAHY01092888.1:1..24697),gap(125),
CO   complement(AAHY01092889.1:1..6688),gap(493),
CO   complement(AAHY01092890.1:1..1055),gap(20),
CO   complement(AAHY01092891.1:1..8569),gap(20),
CO   complement(AAHY01092892.1:1..19568),gap(146),AAHY01092893.1:1..1854,
CO   gap(20),complement(AAHY01092894.1:1..1297),gap(117),
CO   complement(AAHY01092895.1:1..1008),gap(20),
CO   complement(AAHY01092896.1:1..16449),gap(20),
CO   complement(AAHY01092897.1:1..1193),gap(20),AAHY01092898.1:1..3483,gap(20),
CO   AAHY01092899.1:1..51432,gap(20),AAHY01092900.1:1..14358,gap(20),
CO   complement(AAHY01092901.1:1..1482),gap(20),AAHY01092902.1:1..21310,gap(20),
CO   AAHY01092903.1:1..17502,gap(20),AAHY01092904.1:1..11494,gap(595),
CO   complement(AAHY01092905.1:1..1099),gap(1371),AAHY01092906.1:1..7024,
CO   gap(20),complement(AAHY01092907.1:1..18953),gap(294),
CO   complement(AAHY01092908.1:1..6299),gap(9336),
CO   complement(AAHY01092909.1:1..5460),gap(600),
CO   complement(AAHY01092910.1:1..21374),gap(20),
CO   complement(AAHY01092911.1:1..14690),gap(528),
CO   complement(AAHY01092912.1:1..30685),gap(60),AAHY01092913.1:1..12415,
CO   gap(49),complement(AAHY01092914.1:1..1522),gap(441),
CO   complement(AAHY01092915.1:1..11121),gap(233),
CO   complement(AAHY01092916.1:1..26267),gap(5618),
CO   complement(AAHY01092917.1:1..27148),gap(20),
CO   complement(AAHY01092918.1:1..6637),gap(27),
CO   complement(AAHY01092919.1:1..6948),gap(485),
CO   complement(AAHY01092920.1:1..6651),gap(2338),
CO   complement(AAHY01092921.1:1..72703),gap(20),
CO   complement(AAHY01092922.1:1..1554),gap(20),
CO   complement(AAHY01092923.1:1..5465),gap(4360),
CO   complement(AAHY01092924.1:1..4562),gap(3559),
CO   complement(AAHY01092925.1:1..46129),gap(2224),
CO   complement(AAHY01092926.1:1..4513),gap(20),
CO   complement(AAHY01092927.1:1..92852),gap(20),
CO   complement(AAHY01092928.1:1..14168),gap(319),
CO   complement(AAHY01092929.1:1..40698),gap(4630),
CO   complement(AAHY01092930.1:1..3737),gap(20),
CO   complement(AAHY01092931.1:1..4304),gap(20),
CO   complement(AAHY01092932.1:1..38545),gap(20),
CO   complement(AAHY01092933.1:1..135168),gap(20),
CO   complement(AAHY01092934.1:1..44899),gap(20),AAHY01092935.1:1..21917,
CO   gap(196),AAHY01092936.1:1..1518,gap(418),AAHY01092937.1:1..21172,gap(311),
CO   complement(AAHY01092938.1:1..1027),gap(230),
CO   complement(AAHY01092939.1:1..60745),gap(20),AAHY01092940.1:1..2697,gap(20),
CO   complement(AAHY01092941.1:1..6106),gap(20),AAHY01092942.1:1..5705,gap(146),
CO   complement(AAHY01092943.1:1..25335),gap(382),
CO   complement(AAHY01092944.1:1..30441),gap(20),
CO   complement(AAHY01092945.1:1..27463),gap(152),AAHY01092946.1:1..3803,
CO   gap(20),complement(AAHY01092947.1:1..72443),gap(351),
CO   complement(AAHY01092948.1:1..9485),gap(146),
CO   complement(AAHY01092949.1:1..107903),gap(894),
CO   complement(AAHY01092950.1:1..49546),gap(210),AAHY01092951.1:1..10700,
CO   gap(134),complement(AAHY01092952.1:1..2917),gap(20),
CO   complement(AAHY01092953.1:1..44113),gap(20),
CO   complement(AAHY01092954.1:1..28003),gap(20),
CO   complement(AAHY01092955.1:1..32744),gap(20),AAHY01092956.1:1..9476,gap(20),
CO   AAHY01092957.1:1..18828,gap(20),AAHY01092958.1:1..7138,gap(385),
CO   complement(AAHY01092959.1:1..47188),gap(20),
CO   complement(AAHY01092960.1:1..8195),gap(189),AAHY01092961.1:1..5035,
CO   gap(749),AAHY01092962.1:1..5838,gap(290),
CO   complement(AAHY01092963.1:1..1482),gap(20),AAHY01092964.1:1..2369,gap(251),
CO   complement(AAHY01092965.1:1..5669),gap(513),
CO   complement(AAHY01092966.1:1..4920),gap(20),
CO   complement(AAHY01092967.1:1..1538),gap(20),
CO   complement(AAHY01092968.1:1..23928),gap(20),
CO   complement(AAHY01092969.1:1..32011),gap(20),AAHY01092970.1:1..9538,gap(20),
CO   complement(AAHY01092971.1:1..1101),gap(2388),
CO   complement(AAHY01092972.1:1..32129),gap(2495),
CO   complement(AAHY01092973.1:1..1125),gap(4608),
CO   complement(AAHY01092974.1:1..1089),gap(64207),
CO   complement(AAHY01092975.1:1..28764),gap(3397),
CO   complement(AAHY01092976.1:1..27534),gap(7998),AAHY01092977.1:1..2238,
CO   gap(20),complement(AAHY01092978.1:1..47519),gap(20),
CO   complement(AAHY01092979.1:1..4460),gap(460),
CO   complement(AAHY01092980.1:1..45653),gap(56),
CO   complement(AAHY01092981.1:1..14674),gap(228),
CO   complement(AAHY01092982.1:1..27222),gap(20541),
CO   complement(AAHY01092983.1:1..2410),gap(20),
CO   complement(AAHY01092984.1:1..7300),gap(1291),
CO   complement(AAHY01092985.1:1..3389),gap(2944),
CO   complement(AAHY01092986.1:1..2787),gap(20),
CO   complement(AAHY01092987.1:1..2328),gap(146),
CO   complement(AAHY01092988.1:1..11756),gap(20),
CO   complement(AAHY01092989.1:1..3906),gap(306),AAHY01092990.1:1..3995,gap(20),
CO   complement(AAHY01092991.1:1..2449),gap(495),
CO   complement(AAHY01092992.1:1..2146),gap(55),
CO   complement(AAHY01092993.1:1..21318),gap(137),
CO   complement(AAHY01092994.1:1..48137),gap(186),
CO   complement(AAHY01092995.1:1..11797),gap(20),AAHY01092996.1:1..3954,
CO   gap(596),AAHY01092997.1:1..4618,gap(20),AAHY01092998.1:1..12121,gap(20),
CO   AAHY01092999.1:1..3118,gap(531),complement(AAHY01093000.1:1..1050),gap(20),
CO   complement(AAHY01093001.1:1..1559),gap(419),
CO   complement(AAHY01093002.1:1..53329),gap(210),
CO   complement(AAHY01093003.1:1..15446),gap(20),
CO   complement(AAHY01093004.1:1..11240),gap(20),
CO   complement(AAHY01093005.1:1..2065),gap(202),AAHY01093006.1:1..1103,
CO   gap(285),complement(AAHY01093007.1:1..3252),gap(20),
CO   AAHY01093008.1:1..30040,gap(179),complement(AAHY01093009.1:1..6547),
CO   gap(160),complement(AAHY01093010.1:1..6213),gap(135),
CO   complement(AAHY01093011.1:1..18822),gap(20),AAHY01093012.1:1..23233,
CO   gap(273),AAHY01093013.1:1..32907,gap(20),
CO   complement(AAHY01093014.1:1..18815),gap(20),
CO   complement(AAHY01093015.1:1..2464),gap(20),
CO   complement(AAHY01093016.1:1..38125),gap(116),
CO   complement(AAHY01093017.1:1..9927),gap(20),
CO   complement(AAHY01093018.1:1..1142),gap(20),AAHY01093019.1:1..1214,gap(20),
CO   AAHY01093020.1:1..5847,gap(41),complement(AAHY01093021.1:1..12392),gap(20),
CO   AAHY01093022.1:1..5681,gap(20),complement(AAHY01093023.1:1..3179),
CO   gap(3110),complement(AAHY01093024.1:1..3503),gap(360),
CO   AAHY01093025.1:1..7107,gap(698),complement(AAHY01093026.1:1..18303),
CO   gap(292),AAHY01093027.1:1..599,gap(133),complement(AAHY01093028.1:1..9991),
CO   gap(347),complement(AAHY01093029.1:1..35437),gap(20),
CO   complement(AAHY01093030.1:1..3196),gap(20),AAHY01093031.1:1..1467,gap(438),
CO   AAHY01093032.1:1..7157,gap(20),complement(AAHY01093033.1:1..1049),gap(20),
CO   AAHY01093034.1:1..8947,gap(20),AAHY01093035.1:1..1769,gap(1505),
CO   complement(AAHY01093036.1:1..29893),gap(20),
CO   complement(AAHY01093037.1:1..21008),gap(20),
CO   complement(AAHY01093038.1:1..2789),gap(101),
CO   complement(AAHY01093039.1:1..1310),gap(20),
CO   complement(AAHY01093040.1:1..2988),gap(10552),
CO   complement(AAHY01093041.1:1..31164),gap(20),
CO   complement(AAHY01093042.1:1..2418),gap(20),
CO   complement(AAHY01093043.1:1..1049),gap(20),
CO   complement(AAHY01093044.1:1..18085),gap(92),
CO   complement(AAHY01093045.1:1..4290),gap(1176),
CO   complement(AAHY01093046.1:1..28794),gap(20),AAHY01093047.1:1..1107,gap(20),
CO   AAHY01093048.1:1..17067,gap(20),complement(AAHY01093049.1:1..18362),
CO   gap(114),AAHY01093050.1:1..30921,gap(20),
CO   complement(AAHY01093051.1:1..5015),gap(20),
CO   complement(AAHY01093052.1:1..1282),gap(20),AAHY01093053.1:1..1168,gap(20),
CO   AAHY01093054.1:1..1169,gap(20),AAHY01093055.1:1..1169,gap(20),
CO   AAHY01093056.1:1..16322,gap(67),complement(AAHY01093057.1:1..5187),
CO   gap(157),complement(AAHY01093058.1:1..7335),gap(163),
CO   AAHY01093059.1:1..1616,gap(20),complement(AAHY01093060.1:1..2062),gap(20),
CO   AAHY01093061.1:1..1585,gap(2679),AAHY01093062.1:1..6606,gap(21),
CO   complement(AAHY01093063.1:1..16732),gap(20),
CO   complement(AAHY01093064.1:1..8658),gap(5092),
CO   complement(AAHY01093065.1:1..1525),gap(20),
CO   complement(AAHY01093066.1:1..1113),gap(1557),
CO   complement(AAHY01093067.1:1..28721),gap(20),AAHY01093068.1:1..6965,gap(36),
CO   AAHY01093069.1:1..5025,gap(75),complement(AAHY01093070.1:1..4445),gap(62),
CO   complement(AAHY01093071.1:1..2923),gap(345),
CO   complement(AAHY01093072.1:1..9907),gap(20),
CO   complement(AAHY01093073.1:1..3699),gap(20),
CO   complement(AAHY01093074.1:1..69894),gap(23),
CO   complement(AAHY01093075.1:1..30626),gap(346),
CO   complement(AAHY01093076.1:1..18380),gap(282),
CO   complement(AAHY01093077.1:1..22973),gap(927),
CO   complement(AAHY01093078.1:1..7711),gap(683),AAHY01093079.1:1..1591,gap(20),
CO   complement(AAHY01093080.1:1..9489),gap(20),
CO   complement(AAHY01093081.1:1..3258),gap(20),
CO   complement(AAHY01093082.1:1..89143),gap(166),
CO   complement(AAHY01093083.1:1..27767),gap(20),
CO   complement(AAHY01093084.1:1..2046),gap(20),
CO   complement(AAHY01093085.1:1..33619),gap(20),
CO   complement(AAHY01093086.1:1..123937),gap(286),
CO   complement(AAHY01093087.1:1..3824),gap(591),
CO   complement(AAHY01093088.1:1..4373),gap(10428),
CO   complement(AAHY01093089.1:1..2326),gap(20),AAHY01093090.1:1..17182,
CO   gap(350),complement(AAHY01093091.1:1..6556),gap(6356),
CO   complement(AAHY01093092.1:1..29799),gap(20),
CO   complement(AAHY01093093.1:1..13736),gap(563),
CO   complement(AAHY01093094.1:1..18419),gap(20),AAHY01093095.1:1..11024,
CO   gap(20),complement(AAHY01093096.1:1..80872),gap(20),
CO   complement(AAHY01093097.1:1..81991),gap(20),
CO   complement(AAHY01093098.1:1..22820),gap(20),
CO   complement(AAHY01093099.1:1..4549),gap(472),
CO   complement(AAHY01093100.1:1..15663),gap(72),AAHY01093101.1:1..14271,
CO   gap(20),complement(AAHY01093102.1:1..3579),gap(20),
CO   complement(AAHY01093103.1:1..7964),gap(189),
CO   complement(AAHY01093104.1:1..5672),gap(20),
CO   complement(AAHY01093105.1:1..17265),gap(2305),
CO   complement(AAHY01093106.1:1..37109),gap(51),
CO   complement(AAHY01093107.1:1..17475),gap(3650),
CO   complement(AAHY01093108.1:1..2004),gap(20),AAHY01093109.1:1..35690,gap(55),
CO   complement(AAHY01093110.1:1..120747),gap(20),AAHY01093111.1:1..35011,
CO   gap(20),AAHY01093112.1:1..43372,gap(71),AAHY01093113.1:1..5882,gap(20),
CO   AAHY01093114.1:1..19585,gap(40),AAHY01093115.1:1..58208,gap(20),
CO   complement(AAHY01093116.1:1..17771),gap(520),
CO   complement(AAHY01093117.1:1..56462),gap(20),
CO   complement(AAHY01093118.1:1..12617),gap(20),
CO   complement(AAHY01093119.1:1..23993),gap(278),AAHY01093120.1:1..24806,
CO   gap(6461),complement(AAHY01093121.1:1..5132),gap(20),
CO   complement(AAHY01093122.1:1..33716),gap(20),AAHY01093123.1:1..8680,
CO   gap(3761),AAHY01093124.1:1..21708,gap(26),AAHY01093125.1:1..1206,gap(20),
CO   AAHY01093126.1:1..13174,gap(20),AAHY01093127.1:1..8041,gap(244),
CO   AAHY01093128.1:1..13251,gap(103),complement(AAHY01093129.1:1..4832),
CO   gap(159),complement(AAHY01093130.1:1..17714),gap(20),
CO   complement(AAHY01093131.1:1..14641),gap(20),
CO   complement(AAHY01093132.1:1..4306),gap(2561),
CO   complement(AAHY01093133.1:1..46940),gap(69),
CO   complement(AAHY01093134.1:1..5596),gap(425),
CO   complement(AAHY01093135.1:1..31129),gap(147),
CO   complement(AAHY01093136.1:1..65102),gap(734),
CO   complement(AAHY01093137.1:1..7011),gap(20),
CO   complement(AAHY01093138.1:1..30175),gap(20),
CO   complement(AAHY01093139.1:1..2342),gap(20),
CO   complement(AAHY01093140.1:1..23463),gap(1066),
CO   complement(AAHY01093141.1:1..17297),gap(20),
CO   complement(AAHY01093142.1:1..10162),gap(1095),
CO   complement(AAHY01093143.1:1..22610),gap(478),
CO   complement(AAHY01093144.1:1..30457),gap(20),
CO   complement(AAHY01093145.1:1..41623),gap(29),
CO   complement(AAHY01093146.1:1..9140),gap(194),AAHY01093147.1:1..2585,gap(20),
CO   complement(AAHY01093148.1:1..4882),gap(20),
CO   complement(AAHY01093149.1:1..1153),gap(20),
CO   complement(AAHY01093150.1:1..33482),gap(20),AAHY01093151.1:1..7586,
CO   gap(413),complement(AAHY01093152.1:1..4353),gap(20),
CO   complement(AAHY01093153.1:1..20391),gap(20),
CO   complement(AAHY01093154.1:1..27775),gap(218),
CO   complement(AAHY01093155.1:1..3106),gap(2483),
CO   complement(AAHY01093156.1:1..2661),gap(76367),
CO   complement(AAHY01093157.1:1..4095),gap(320),
CO   complement(AAHY01093158.1:1..11488),gap(117),AAHY01093159.1:1..15122,
CO   gap(20),AAHY01093160.1:1..16469,gap(127),AAHY01093161.1:1..11926,gap(107),
CO   AAHY01093162.1:1..23866,gap(20),AAHY01093163.1:1..7863,gap(1021),
CO   complement(AAHY01093164.1:1..15309),gap(20),AAHY01093165.1:1..54246,
CO   gap(1197),AAHY01093166.1:1..1283,gap(217),AAHY01093167.1:1..30088,
CO   gap(2029),AAHY01093168.1:1..15134,gap(319),
CO   complement(AAHY01093169.1:1..19885),gap(290),AAHY01093170.1:1..21642,
CO   gap(241),complement(AAHY01093171.1:1..56973),gap(2751),
CO   complement(AAHY01093172.1:1..1355),gap(403),
CO   complement(AAHY01093173.1:1..15966),gap(20),
CO   complement(AAHY01093174.1:1..18576),gap(157),
CO   complement(AAHY01093175.1:1..7125),gap(20),
CO   complement(AAHY01093176.1:1..56130),gap(3120),
CO   complement(AAHY01093177.1:1..15054),gap(1276),
CO   complement(AAHY01093178.1:1..22659),gap(95),
CO   complement(AAHY01093179.1:1..56866),gap(85),
CO   complement(AAHY01093180.1:1..13030),gap(111),
CO   complement(AAHY01093181.1:1..26984),gap(111),AAHY01093182.1:1..1480,
CO   gap(6181),AAHY01093183.1:1..9228,gap(20),
CO   complement(AAHY01093184.1:1..14570),gap(20),AAHY01093185.1:1..12081,
CO   gap(325),complement(AAHY01093186.1:1..3490),gap(298),
CO   complement(AAHY01093187.1:1..60785),gap(98),AAHY01093188.1:1..9749,gap(89),
CO   complement(AAHY01093189.1:1..5919),gap(911),AAHY01093190.1:1..19041,
CO   gap(317),AAHY01093191.1:1..8777,gap(61),
CO   complement(AAHY01093192.1:1..11429),gap(119),
CO   complement(AAHY01093193.1:1..1838),gap(20),AAHY01093194.1:1..21748,
CO   gap(233),AAHY01093195.1:1..63121,gap(20),AAHY01093196.1:1..7856,gap(118),
CO   complement(AAHY01093197.1:1..51067),gap(180),
CO   complement(AAHY01093198.1:1..8851),gap(3887),AAHY01093199.1:1..27042,
CO   gap(20),complement(AAHY01093200.1:1..2116),gap(20),
CO   complement(AAHY01093201.1:1..21991),gap(143),AAHY01093202.1:1..6279,
CO   gap(40),AAHY01093203.1:1..15235,gap(111),AAHY01093204.1:1..6570,gap(20),
CO   complement(AAHY01093205.1:1..35393),gap(716),
CO   complement(AAHY01093206.1:1..17820),gap(427),AAHY01093207.1:1..8077,
CO   gap(66),AAHY01093208.1:1..62403,gap(20),AAHY01093209.1:1..27979,gap(267),
CO   AAHY01093210.1:1..24863,gap(21),AAHY01093211.1:1..13424,gap(20),
CO   AAHY01093212.1:1..11760,gap(185),complement(AAHY01093213.1:1..15780),
CO   gap(2450),complement(AAHY01093214.1:1..33074),gap(198),
CO   complement(AAHY01093215.1:1..25417),gap(33),
CO   complement(AAHY01093216.1:1..63966),gap(41),
CO   complement(AAHY01093217.1:1..4476),gap(20),
CO   complement(AAHY01093218.1:1..12028),gap(43),AAHY01093219.1:1..8751,gap(53),
CO   complement(AAHY01093220.1:1..26975),gap(173),
CO   complement(AAHY01093221.1:1..98844),gap(1872),
CO   complement(AAHY01093222.1:1..24185),gap(37),
CO   complement(AAHY01093223.1:1..41242),gap(20),AAHY01093224.1:1..27141,
CO   gap(20),AAHY01093225.1:1..18714,gap(891),AAHY01093226.1:1..10534,gap(20),
CO   AAHY01093227.1:1..2207,gap(88),AAHY01093228.1:1..36937,gap(760),
CO   complement(AAHY01093229.1:1..1612),gap(20),AAHY01093230.1:1..3749,gap(20),
CO   AAHY01093231.1:1..53560,gap(29),complement(AAHY01093232.1:1..1164),
CO   gap(387),AAHY01093233.1:1..22973,gap(20),
CO   complement(AAHY01093234.1:1..45939),gap(604),
CO   complement(AAHY01093235.1:1..1851),gap(36),AAHY01093236.1:1..10587,gap(80),
CO   AAHY01093237.1:1..6068,gap(419),complement(AAHY01093238.1:1..51991),
CO   gap(8797),complement(AAHY01093239.1:1..30826),gap(62673),
CO   AAHY01093240.1:1..34706,gap(2056),complement(AAHY01093241.1:1..22845),
CO   gap(171),complement(AAHY01093242.1:1..683),gap(6129),
CO   complement(AAHY01093243.1:1..9337),gap(169),
CO   complement(AAHY01093244.1:1..34719),gap(209),
CO   complement(AAHY01093245.1:1..18488),gap(297),
CO   complement(AAHY01093246.1:1..15127),gap(563),
CO   complement(AAHY01093247.1:1..5945),gap(361),
CO   complement(AAHY01093248.1:1..2739),gap(33),
CO   complement(AAHY01093249.1:1..5654),gap(20),
CO   complement(AAHY01093250.1:1..1283),gap(20),AAHY01093251.1:1..1086,
CO   gap(3320),complement(AAHY01093252.1:1..1706),gap(20),
CO   complement(AAHY01093253.1:1..57084),gap(742),
CO   complement(AAHY01093254.1:1..4646),gap(954),
CO   complement(AAHY01093255.1:1..101934),gap(363),
CO   complement(AAHY01093256.1:1..7868),gap(20),
CO   complement(AAHY01093257.1:1..11613),gap(20),
CO   complement(AAHY01093258.1:1..5951),gap(22),
CO   complement(AAHY01093259.1:1..3360),gap(123),
CO   complement(AAHY01093260.1:1..6161),gap(118),AAHY01093261.1:1..2499,
CO   gap(376),complement(AAHY01093262.1:1..5313),gap(20),
CO   complement(AAHY01093263.1:1..16188),gap(20),AAHY01093264.1:1..1018,gap(20),
CO   AAHY01093265.1:1..1674,gap(20),complement(AAHY01093266.1:1..14138),gap(20),
CO   complement(AAHY01093267.1:1..1702),gap(20),
CO   complement(AAHY01093268.1:1..4356),gap(20),
CO   complement(AAHY01093269.1:1..19138),gap(213),
CO   complement(AAHY01093270.1:1..20118),gap(224),AAHY01093271.1:1..20927,
CO   gap(20),complement(AAHY01093272.1:1..1717),gap(415),
CO   complement(AAHY01093273.1:1..1971),gap(20),AAHY01093274.1:1..1113,gap(20),
CO   complement(AAHY01093275.1:1..8187),gap(2556),
CO   complement(AAHY01093276.1:1..19718),gap(232),
CO   complement(AAHY01093277.1:1..19582),gap(20),
CO   complement(AAHY01093278.1:1..4413),gap(20),AAHY01093279.1:1..1916,gap(20),
CO   complement(AAHY01093280.1:1..1275),gap(129),
CO   complement(AAHY01093281.1:1..2184),gap(188),
CO   complement(AAHY01093282.1:1..11784),gap(20),
CO   complement(AAHY01093283.1:1..23514),gap(163),
CO   complement(AAHY01093284.1:1..8492),gap(41),
CO   complement(AAHY01093285.1:1..6407),gap(63),
CO   complement(AAHY01093286.1:1..11109),gap(332),
CO   complement(AAHY01093287.1:1..10390),gap(20),
CO   complement(AAHY01093288.1:1..9238),gap(20),
CO   complement(AAHY01093289.1:1..5900),gap(20),
CO   complement(AAHY01093290.1:1..88813),gap(20),
CO   complement(AAHY01093291.1:1..2334),gap(20),
CO   complement(AAHY01093292.1:1..35192),gap(143),
CO   complement(AAHY01093293.1:1..31522),gap(20),
CO   complement(AAHY01093294.1:1..112811),gap(24),
CO   complement(AAHY01093295.1:1..3145),gap(107),AAHY01093296.1:1..1866,
CO   gap(539),AAHY01093297.1:1..1049,gap(851),AAHY01093298.1:1..713,gap(20),
CO   complement(AAHY01093299.1:1..16861),gap(49),AAHY01093300.1:1..5386,
CO   gap(174),AAHY01093301.1:1..3118,gap(308),
CO   complement(AAHY01093302.1:1..7572),gap(20),
CO   complement(AAHY01093303.1:1..36178),gap(447),
CO   complement(AAHY01093304.1:1..16298),gap(107),
CO   complement(AAHY01093305.1:1..4510),gap(23),
CO   complement(AAHY01093306.1:1..7532),gap(20),
CO   complement(AAHY01093307.1:1..61404),gap(20),
CO   complement(AAHY01093308.1:1..26601),gap(73),
CO   complement(AAHY01093309.1:1..22281),gap(50),AAHY01093310.1:1..5029,
CO   gap(508),complement(AAHY01093311.1:1..1643),gap(20),
CO   complement(AAHY01093312.1:1..1857),gap(232),
CO   complement(AAHY01093313.1:1..19330),gap(159),AAHY01093314.1:1..10323,
CO   gap(20),complement(AAHY01093315.1:1..21492),gap(20),
CO   AAHY01093316.1:1..32211,gap(20),complement(AAHY01093317.1:1..13792),
CO   gap(1223),complement(AAHY01093318.1:1..12583),gap(3424),
CO   complement(AAHY01093319.1:1..32676),gap(179),
CO   complement(AAHY01093320.1:1..49173),gap(20),
CO   complement(AAHY01093321.1:1..16468),gap(20),
CO   complement(AAHY01093322.1:1..15218),gap(1572),
CO   complement(AAHY01093323.1:1..38901),gap(356),
CO   complement(AAHY01093324.1:1..4445),gap(20),AAHY01093325.1:1..9902,gap(20),
CO   complement(AAHY01093326.1:1..50285),gap(352),
CO   complement(AAHY01093327.1:1..2770),gap(20),AAHY01093328.1:1..1049,gap(20),
CO   complement(AAHY01093329.1:1..3293),gap(20),AAHY01093330.1:1..1306,gap(20),
CO   AAHY01093331.1:1..1361,gap(20),complement(AAHY01093332.1:1..4192),gap(517),
CO   complement(AAHY01093333.1:1..7588),gap(1350),
CO   complement(AAHY01093334.1:1..29379),gap(20),
CO   complement(AAHY01093335.1:1..4673),gap(538),
CO   complement(AAHY01093336.1:1..40718),gap(1234),
CO   complement(AAHY01093337.1:1..5379),gap(574),
CO   complement(AAHY01093338.1:1..48035),gap(375),
CO   complement(AAHY01093339.1:1..6482),gap(307),
CO   complement(AAHY01093340.1:1..15287),gap(210),
CO   complement(AAHY01093341.1:1..11017),gap(20),
CO   complement(AAHY01093342.1:1..67863),gap(341),
CO   complement(AAHY01093343.1:1..21620),gap(20),
CO   complement(AAHY01093344.1:1..14250),gap(147),AAHY01093345.1:1..20110,
CO   gap(20),complement(AAHY01093346.1:1..6211),gap(40),
CO   complement(AAHY01093347.1:1..1543),gap(143),
CO   complement(AAHY01093348.1:1..5852),gap(1290),
CO   complement(AAHY01093349.1:1..9160),gap(1451),
CO   complement(AAHY01093350.1:1..4221),gap(2447),AAHY01093351.1:1..1463,
CO   gap(20),complement(AAHY01093352.1:1..8877),gap(20),AAHY01093353.1:1..6522,
CO   gap(80),complement(AAHY01093354.1:1..18294),gap(279),
CO   complement(AAHY01093355.1:1..60424),gap(20),
CO   complement(AAHY01093356.1:1..44338),gap(20),AAHY01093357.1:1..1183,gap(20),
CO   complement(AAHY01093358.1:1..104225),gap(20),
CO   complement(AAHY01093359.1:1..234216),gap(247),
CO   complement(AAHY01093360.1:1..2279),gap(196),
CO   complement(AAHY01093361.1:1..288025),gap(20),
CO   complement(AAHY01093362.1:1..40650),gap(2016),
CO   complement(AAHY01093363.1:1..204406),gap(20),
CO   complement(AAHY01093364.1:1..4530),gap(228),
CO   complement(AAHY01093365.1:1..121979),gap(20),
CO   complement(AAHY01093366.1:1..3887),gap(20),
CO   complement(AAHY01093367.1:1..3583),gap(20),
CO   complement(AAHY01093368.1:1..1463),gap(98),
CO   complement(AAHY01093369.1:1..6015),gap(20),AAHY01093370.1:1..7183,gap(271),
CO   complement(AAHY01093371.1:1..4465),gap(525),
CO   complement(AAHY01093372.1:1..7704),gap(37),
CO   complement(AAHY01093373.1:1..2464),gap(130),
CO   complement(AAHY01093374.1:1..37325),gap(20),AAHY01093375.1:1..2724,gap(20),
CO   complement(AAHY01093376.1:1..2928),gap(20),
CO   complement(AAHY01093377.1:1..4799),gap(253),
CO   complement(AAHY01093378.1:1..33911),gap(20),AAHY01093379.1:1..17884,
CO   gap(46),complement(AAHY01093380.1:1..13928),gap(668),
CO   complement(AAHY01093381.1:1..61304),gap(20),AAHY01093382.1:1..6449,
CO   gap(101),complement(AAHY01093383.1:1..35659),gap(3149),
CO   complement(AAHY01093384.1:1..661),gap(20),AAHY01093385.1:1..28467,gap(535),
CO   complement(AAHY01093386.1:1..66443),gap(491),
CO   complement(AAHY01093387.1:1..4959),gap(20),
CO   complement(AAHY01093388.1:1..45537),gap(20),
CO   complement(AAHY01093389.1:1..49076),gap(146),AAHY01093390.1:1..15242,
CO   gap(1681),complement(AAHY01093391.1:1..15656),gap(20),
CO   complement(AAHY01093392.1:1..17088),gap(2731),
CO   complement(AAHY01093393.1:1..14420),gap(30),
CO   complement(AAHY01093394.1:1..29743),gap(20),AAHY01093395.1:1..53017,
CO   gap(109),AAHY01093396.1:1..61168,gap(20),
CO   complement(AAHY01093397.1:1..33395),gap(333),
CO   complement(AAHY01093398.1:1..8588),gap(20),
CO   complement(AAHY01093399.1:1..1389),gap(113),
CO   complement(AAHY01093400.1:1..9558),gap(20),
CO   complement(AAHY01093401.1:1..78190),gap(20),
CO   complement(AAHY01093402.1:1..15156),gap(396),AAHY01093403.1:1..8706,
CO   gap(68),AAHY01093404.1:1..30529,gap(20),AAHY01093405.1:1..31262,gap(20),
CO   AAHY01093406.1:1..2401,gap(20),complement(AAHY01093407.1:1..34402),gap(20),
CO   complement(AAHY01093408.1:1..7160),gap(20),
CO   complement(AAHY01093409.1:1..3209),gap(59),
CO   complement(AAHY01093410.1:1..19047),gap(426),AAHY01093411.1:1..20332,
CO   gap(133),complement(AAHY01093412.1:1..14718),gap(20),
CO   AAHY01093413.1:1..25962,gap(1538),complement(AAHY01093414.1:1..1944),
CO   gap(20),complement(AAHY01093415.1:1..135219),gap(3925),
CO   AAHY01093416.1:1..4256,gap(325),complement(AAHY01093417.1:1..59448),
CO   gap(392),complement(AAHY01093418.1:1..17389),gap(72),
CO   complement(AAHY01093419.1:1..29390),gap(152),AAHY01093420.1:1..10161,
CO   gap(207),AAHY01093421.1:1..2033,gap(20),
CO   complement(AAHY01093422.1:1..10169),gap(328),AAHY01093423.1:1..4647,
CO   gap(65),complement(AAHY01093424.1:1..2141),gap(680),
CO   complement(AAHY01093425.1:1..1532),gap(225),
CO   complement(AAHY01093426.1:1..1465),gap(356),
CO   complement(AAHY01093427.1:1..22632),gap(2349),
CO   complement(AAHY01093428.1:1..12150),gap(296),
CO   complement(AAHY01093429.1:1..11091),gap(164),
CO   complement(AAHY01093430.1:1..14139),gap(935),
CO   complement(AAHY01093431.1:1..21629),gap(279),
CO   complement(AAHY01093432.1:1..1280),gap(20),AAHY01093433.1:1..30392,
CO   gap(257),AAHY01093434.1:1..22338,gap(28),AAHY01093435.1:1..3877,gap(20),
CO   AAHY01093436.1:1..14271,gap(50),complement(AAHY01093437.1:1..21333),
CO   gap(20),AAHY01093438.1:1..6951,gap(389),complement(AAHY01093439.1:1..1923),
CO   gap(480),AAHY01093440.1:1..4994,gap(543),AAHY01093441.1:1..1276,gap(20),
CO   AAHY01093442.1:1..15832,gap(20),complement(AAHY01093443.1:1..9594),
CO   gap(395),complement(AAHY01093444.1:1..2922),gap(294),
CO   complement(AAHY01093445.1:1..4420))