Dbfetch

ID   CH466574; SV 1; linear; genomic DNA; CON; MUS; 14573150 BP.
XX
AC   CH466574;
XX
PR   Project:PRJNA11785;
XX
DT   20-JUL-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009842133 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-14573150
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-14573150
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 911244bdfcf06a7ed813d7746cc04163.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000219.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000004393; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009079; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009090; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018654; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020120; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020122; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020193; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020407; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020429; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020432; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020447; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020453; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020454; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020471; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020474; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020475; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020481; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034164; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034175; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034285; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034354; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034570; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034579; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040978; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041126; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041798; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044629; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048834; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050830; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053838; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057897; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059534; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071866; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004505; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004507; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020677; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020710; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040448; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044507; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044682; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066496; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093346; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101525; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101610; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102881; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102921; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109642; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109647; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109681; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109822; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109855; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109878; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109988; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109989; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109990; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110048; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110049; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129670; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131515; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132846; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164791; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178855; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179770; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..14573150
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    15245..16211
FT                   /estimated_length=967
FT                   /gap_type="unknown"
FT   assembly_gap    27615..30687
FT                   /estimated_length=3073
FT                   /gap_type="unknown"
FT   assembly_gap    31634..32088
FT                   /estimated_length=455
FT                   /gap_type="unknown"
FT   assembly_gap    48591..48610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            54216..62643
FT                   /locus_tag="mCG_125120"
FT                   /note="gene_id=mCG125120.2"
FT   mRNA            join(54216..54405,56069..56339,57412..57500,57760..57925,
FT                   59210..59490)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT169069"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT169069.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(54224..54405,56069..56339,57760..57925,59210..59399,
FT                   59663..59801,60046..60192,60434..60594,61074..61362,
FT                   62530..62643)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT126373"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT126373.1
FT                   created on 19-JUN-2003"
FT   mRNA            join(<54296..54405,56069..56339,57760..59175)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT175246"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT175246.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(54310..54405,56069..56339,59663..59801,60046..>60108)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT175249"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT175249.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(<54334..54405,59210..59399,59663..59801,60046..60192,
FT                   60434..60535)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT175248"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT175248.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<54334..54405,59210..59399,59663..59715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_e"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT175248.0
FT                   protein_id=mCP98166.0 isoform=CRA_e"
FT                   /protein_id="EDL40387.1"
FT                   /translation="GPGTTDWKQAVTGRGQEDSLRPSQVFLYKTVPTSLLSCACGRLNK
FT                   VELPYWLWRPVYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRHQPIRWQDPHLWAGEEL
FT                   "
FT   mRNA            join(55869..56339,57760..57925,59210..59446,59663..59801,
FT                   60046..60427)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT169073"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT169073.0
FT                   created on 19-JUN-2003"
FT   mRNA            join(55887..56339,57760..57925,59210..59758)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT169072"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT169072.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<56110..56339,57760..57964)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_c"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT175246.0
FT                   protein_id=mCP98168.0 isoform=CRA_c"
FT                   /protein_id="EDL40385.1"
FT                   /translation="TETRSIATNNWSSDHTEVSLSRGKGSKEKKKKKRQVSKQASKHRS
FT                   TLSWRPTPSLCLPKMCQSEKHPGPELQAAAKWLYFPQLALWRRLGQLSCMSRPALNLRS
FT                   WLLTILHYLLPFRVLGPHSQVGWRPLSRVSVNRPPGHDPP"
FT   mRNA            join(56122..56339,59210..59399,59663..59801,60046..60192,
FT                   60434..60599)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT175247"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT175247.0
FT                   created on 19-JUN-2003"
FT   CDS             join(56287..56339,57760..57925,59210..59399,59663..59715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_f"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT126373.1
FT                   protein_id=mCP59341.1 isoform=CRA_f"
FT                   /protein_id="EDL40388.1"
FT                   /translation="MCQSEKHPGPELQAAAKWLYFPQLALWRRLGQLSCMSRPALNLRS
FT                   WLLTILHYLLPFRVLGPHSQVGWRPLSRVFLYKTVPTSLLSCACGRLNKVELPYWLWRP
FT                   VYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRHQPIRWQDPHLWAGEEL"
FT   CDS             join(56287..56339,57760..57925,59210..59431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_b"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT169072.0
FT                   protein_id=mCP91795.0 isoform=CRA_b"
FT                   /protein_id="EDL40383.1"
FT                   /translation="MCQSEKHPGPELQAAAKWLYFPQLALWRRLGQLSCMSRPALNLRS
FT                   WLLTILHYLLPFRVLGPHSQVGWRPLSRVFLYKTVPTSLLSCACGRLNKVELPYWLWRP
FT                   VYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKLKPQAQPV"
FT   CDS             join(56287..56339,57760..57925,59210..59431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_b"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT169073.0
FT                   protein_id=mCP91809.0 isoform=CRA_b"
FT                   /protein_id="EDL40384.1"
FT                   /translation="MCQSEKHPGPELQAAAKWLYFPQLALWRRLGQLSCMSRPALNLRS
FT                   WLLTILHYLLPFRVLGPHSQVGWRPLSRVFLYKTVPTSLLSCACGRLNKVELPYWLWRP
FT                   VYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKLKPQAQPV"
FT   CDS             join(56337..56339,59663..59801,60046..>60108)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_h"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT175249.0
FT                   protein_id=mCP98165.0 isoform=CRA_h"
FT                   /protein_id="EDL40390.1"
FT                   /translation="MTSPSDGKILTFGQVKNSEVEQVKGETYSLESFLGPRTSTEDLPF
FT                   PPASSSDSFRNQLVPQEGNALYH"
FT   CDS             join(56337..56339,59210..59399,59663..59715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_d"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT175247.0
FT                   protein_id=mCP98167.0 isoform=CRA_d"
FT                   /protein_id="EDL40386.1"
FT                   /translation="MVFLYKTVPTSLLSCACGRLNKVELPYWLWRPVYSLYIWTFGVNM
FT                   TEAAVEDLHHYRNLSEFFRHQPIRWQDPHLWAGEEL"
FT   mRNA            join(56459..56493,57760..57925,59210..59399,59663..59801,
FT                   60046..60247)
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, transcript variant mCT169070"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT169070.0
FT                   created on 19-JUN-2003"
FT   CDS             join(57812..57925,59210..59399,59663..59715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_g"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT169070.0
FT                   protein_id=mCP91775.0 isoform=CRA_g"
FT                   /protein_id="EDL40389.1"
FT                   /translation="MSRPALNLRSWLLTILHYLLPFRVLGPHSQVGWRPLSRVFLYKTV
FT                   PTSLLSCACGRLNKVELPYWLWRPVYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRHQP
FT                   IRWQDPHLWAGEEL"
FT   CDS             join(57812..57925,59210..59431)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125120"
FT                   /product="mCG125120, isoform CRA_a"
FT                   /note="gene_id=mCG125120.2 transcript_id=mCT169069.0
FT                   protein_id=mCP91804.0 isoform=CRA_a"
FT                   /protein_id="EDL40382.1"
FT                   /translation="MSRPALNLRSWLLTILHYLLPFRVLGPHSQVGWRPLSRVFLYKTV
FT                   PTSLLSCACGRLNKVELPYWLWRPVYSLYIWTFGVNMTEAAVEDLHHYRNLSEFFRRKL
FT                   KPQAQPV"
FT   gene            complement(62170..>73365)
FT                   /locus_tag="mCG_125118"
FT                   /note="gene_id=mCG125118.2"
FT   mRNA            complement(join(62170..62412,62497..62608,63168..63246,
FT                   63353..63488,64601..64784,66792..66871,67118..67278,
FT                   70892..70988,71779..71928,72045..72221,72334..72408,
FT                   73016..73090,73337..>73365))
FT                   /locus_tag="mCG_125118"
FT                   /product="mCG125118"
FT                   /note="gene_id=mCG125118.2 transcript_id=mCT126371.2
FT                   created on 29-SEP-2004"
FT   CDS             complement(join(62308..62412,62497..62608,63168..63246,
FT                   63353..63488,64601..64784,66792..66871,67118..67278,
FT                   70892..70988,71779..71928,72045..72221,72334..72408,
FT                   73016..73090,73337..>73363))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125118"
FT                   /product="mCG125118"
FT                   /note="gene_id=mCG125118.2 transcript_id=mCT126371.2
FT                   protein_id=mCP59327.2"
FT                   /protein_id="EDL40391.1"
FT                   /translation="HHLGCIRKKFLQRQAAQLLAQRLSRACFCQWRKQLAVRKQEQWGT
FT                   ARALWLWAFSLQAKVWTAWLGFVLERRRKKARLERAMQAYQQQLLQEGATRLLRFTAGT
FT                   KAFRQQLQAQQQVQAAHSLHCAVRHCAELWKKKVLGPGKTSQPPAPTTFSKRVTFKDSF
FT                   LSGHAVLVQWREVTSVQIYYRQKEAAALREARKALDRGRLQNWFQHWRFCSQRAAQQRF
FT                   QLGQAAQHHHWQLLMEAMARWKAHHLGCIRKKFLQRQAAQLLAQRLSRACFCQWRKQVR
FT                   LEKPPEEESTALLGGSSLTRPFLPGVLPNVPGPKLPPTASPGLELLPPSSIMPHAAGGT
FT                   ARVSAKPSIPGPQPWGCPSLPRDLDPHLLPGDSISTRTRPVYGSEATGHTELEAELEGI
FT                   QQQLQHYQTTKQNLWSCQRQANSLRRWLELSQEEPKSEDLHLEEQVKTELEEVELQVQQ
FT                   LAKELEAQRQPVGTCIARVRALRRALC"
FT   assembly_gap    64820..66692
FT                   /estimated_length=1873
FT                   /gap_type="unknown"
FT   assembly_gap    67924..68616
FT                   /estimated_length=693
FT                   /gap_type="unknown"
FT   gene            <68941..>69735
FT                   /locus_tag="mCG_1041168"
FT                   /note="gene_id=mCG1041168.1"
FT   mRNA            join(<68941..68976,69016..69454,69644..>69735)
FT                   /locus_tag="mCG_1041168"
FT                   /product="mCG1041168"
FT                   /note="gene_id=mCG1041168.1 transcript_id=mCT158872.1
FT                   created on 15-MAY-2002"
FT   CDS             join(<69152..69454,69644..>69735)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041168"
FT                   /product="mCG1041168"
FT                   /note="gene_id=mCG1041168.1 transcript_id=mCT158872.1
FT                   protein_id=mCP59425.0"
FT                   /protein_id="EDL40392.1"
FT                   /translation="KGVAETLKSNIRQDNEYRPLTPALRRQRQKHFCELEASLVYIVSS
FT                   RTAGAIEKPPSQKKKKNKKGTKPQWYCILPTDGILCLPTKFLVPRTCPVPLSPLRKFFM
FT                   SWRDGSAVKSTDCSSRGPEFKFQKPHNG"
FT   assembly_gap    71759..71778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    73366..92841
FT                   /estimated_length=19476
FT                   /gap_type="unknown"
FT   gene            complement(<94689..>111384)
FT                   /locus_tag="mCG_125114"
FT                   /note="gene_id=mCG125114.1"
FT   mRNA            complement(join(<94689..94852,95283..95329,
FT                   111190..>111374))
FT                   /locus_tag="mCG_125114"
FT                   /product="mCG125114, transcript variant mCT169065"
FT                   /note="gene_id=mCG125114.1 transcript_id=mCT169065.0
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(<94689..94852,95283..95329,
FT                   111190..>111310))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125114"
FT                   /product="mCG125114, isoform CRA_a"
FT                   /note="gene_id=mCG125114.1 transcript_id=mCT169065.0
FT                   protein_id=mCP91810.0 isoform=CRA_a"
FT                   /protein_id="EDL40393.1"
FT                   /translation="APFAFWLLRYYLYNLIFQNWKTFVHQQREMRKRFRIAEHHDTKQK
FT                   MCQAWKSWLIYGWLRWQEQLLISQRDRRKEATAVQHYQHWQKQRSLKAWLKYLQICRVK
FT                   RWQNGES"
FT   assembly_gap    95064..95083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    97184..97203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<97273..97436,104217..104273,
FT                   111190..>111384))
FT                   /locus_tag="mCG_125114"
FT                   /product="mCG125114, transcript variant mCT126366"
FT                   /note="gene_id=mCG125114.1 transcript_id=mCT126366.1
FT                   created on 15-MAY-2002"
FT   CDS             complement(join(<97273..97436,104217..>104234))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125114"
FT                   /product="mCG125114, isoform CRA_b"
FT                   /note="gene_id=mCG125114.1 transcript_id=mCT126366.1
FT                   protein_id=mCP59457.1 isoform=CRA_b"
FT                   /protein_id="EDL40394.1"
FT                   /translation="EAECLMGWLRWQEQLLISQRDRRKEATAVQHYQHWQKQRSLKAWL
FT                   KYLQICRVKRWQNGES"
FT   mRNA            complement(join(<97851..98401,104217..104273,
FT                   111190..>111374))
FT                   /locus_tag="mCG_125114"
FT                   /product="mCG125114, transcript variant mCT169066"
FT                   /note="gene_id=mCG125114.1 transcript_id=mCT169066.0
FT                   created on 15-MAY-2002"
FT   CDS             complement(<97851..>98118)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125114"
FT                   /product="mCG125114, isoform CRA_c"
FT                   /note="gene_id=mCG125114.1 transcript_id=mCT169066.0
FT                   protein_id=mCP91785.0 isoform=CRA_c"
FT                   /protein_id="EDL40395.1"
FT                   /translation="FPFAFTKFIINCEKYVLISLFFLCSKLENNAGQNQDWKENPAALS
FT                   LQGVWVLIFLFFFKRFIYVLYIYMNECFVFKKKRFICLFVFSRQ"
FT   gene            <98997..100552
FT                   /locus_tag="mCG_1041169"
FT                   /note="gene_id=mCG1041169.0"
FT   mRNA            join(<98997..99574,100472..100552)
FT                   /locus_tag="mCG_1041169"
FT                   /product="mCG1041169"
FT                   /note="gene_id=mCG1041169.0 transcript_id=mCT158873.1
FT                   created on 15-MAY-2002"
FT   CDS             join(<99325..99574,100472..100497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041169"
FT                   /product="mCG1041169"
FT                   /note="gene_id=mCG1041169.0 transcript_id=mCT158873.1
FT                   protein_id=mCP59427.1"
FT                   /protein_id="EDL40396.1"
FT                   /translation="LVSYFWLENSREEQQHSAVRNNLHAFRESSEVNIHGYSTKGPRFE
FT                   SQHPLVGSQAYETSVPGDPVSTSGLYRHQAHTVVCKHTCKIPIHIK"
FT   assembly_gap    99579..100449
FT                   /estimated_length=871
FT                   /gap_type="unknown"
FT   assembly_gap    104309..106787
FT                   /estimated_length=2479
FT                   /gap_type="unknown"
FT   assembly_gap    109219..110995
FT                   /estimated_length=1777
FT                   /gap_type="unknown"
FT   assembly_gap    113012..115239
FT                   /estimated_length=2228
FT                   /gap_type="unknown"
FT   assembly_gap    117618..127014
FT                   /estimated_length=9397
FT                   /gap_type="unknown"
FT   assembly_gap    130140..130580
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   gene            131260..172212
FT                   /gene="Eif4enif1"
FT                   /locus_tag="mCG_14708"
FT                   /note="gene_id=mCG14708.1"
FT   mRNA            join(131260..131381,140912..140985,143243..143370,
FT                   147872..148158,148721..148922,152263..152438,
FT                   155026..155161,155337..155516,157500..157732,
FT                   161619..161690,162093..162276,163212..163291,
FT                   163845..163984,167032..167116,168526..168658,
FT                   170008..170349,170814..170981,171482..172212)
FT                   /gene="Eif4enif1"
FT                   /locus_tag="mCG_14708"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   nuclear import factor 1, transcript variant mCT19868"
FT                   /note="gene_id=mCG14708.1 transcript_id=mCT19868.0 created
FT                   on 15-MAY-2002"
FT   mRNA            join(131260..131381,140912..140985,143243..143370,
FT                   147872..148158,148721..148922,152263..152438,
FT                   155026..155161,155337..155516,157500..157732,
FT                   162093..162276,163212..163291,163845..163984,
FT                   167032..167116,168526..168658,170008..170349,
FT                   170814..170981,171482..172212)
FT                   /gene="Eif4enif1"
FT                   /locus_tag="mCG_14708"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   nuclear import factor 1, transcript variant mCT169076"
FT                   /note="gene_id=mCG14708.1 transcript_id=mCT169076.0 created
FT                   on 15-MAY-2002"
FT   CDS             join(131289..131381,140912..140985,143243..143370,
FT                   147872..148158,148721..148922,152263..152438,
FT                   155026..155161,155337..155516,157500..157732,
FT                   161619..161690,162093..162276,163212..163291,
FT                   163845..163984,167032..167116,168526..168658,
FT                   170008..170349,170814..170981,171482..171720)
FT                   /codon_start=1
FT                   /gene="Eif4enif1"
FT                   /locus_tag="mCG_14708"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   nuclear import factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG14708.1 transcript_id=mCT19868.0
FT                   protein_id=mCP7785.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9EST3"
FT                   /db_xref="InterPro:IPR018862"
FT                   /db_xref="MGI:MGI:1921453"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EST3"
FT                   /protein_id="EDL40398.1"
FT                   /translation="MEKSVAETENGDAFLELKKLPTSKSPHRYTKEELLDIKERPYSKQ
FT                   RPSCLSEKYDSDGVWDPEKWHASLYPASGRSSPVESLKKESESDRPSLVRRIADPRERV
FT                   KEDDLDVVLSPQRRSFGGGCHVTAAVSSRRSGSPLEKDSDGLRLLGGRRIGSGRIISAR
FT                   AFEKDHRLSDKDLRDLRDRDRERDYKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFS
FT                   AGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGIVECNGGVAEEDEVEVILA
FT                   QEPSADQEVPRDVILPEQSPGEFDFNEFFNLDKVPCLASMIEDVLGEGSVSASRFSRWF
FT                   SNPSRSGSRSSSLGSTPHEELERLAGLEQAVLSPGQNSGNYFAPIPSEDHAENKVDILE
FT                   MLQKAKVDLKPLLSSLSANKEKLKESSHSGVVLSVEEVEAGLKGLKVDQQMKNSTPFMA
FT                   EHLEETLSAASSNRQLKKDGDMTAFNKLVNTMKASGTLPTQPKVSRNVESHLLAPAEIP
FT                   GQPVSKNILQELLGQPVQRPASSNLLSGLMGSLEATASLLSQRAPSPPMSQVFRTQAAS
FT                   ADYLHPRIPSPIGFPSGPQQLLGDPFQGMRKPMSPVSAQMSQLELQQAALEGLALPHDL
FT                   AVQTAPFYQPGFSKPQVDRTRDGLRNRQQRMSKSPAPMHGGNSSSPAPAASITSMLSPS
FT                   FTPTSVIRKMYESREKTKEEMAPGMVVPGDGKEDTQKTSEENLLSSNPIPNTDQDSSTT
FT                   NPKLSTLQRSSCSTPLSQTSRYTKEQDYRPKTAGRKTPTLASPVPGTPFLRPTHQVPLV
FT                   PHVPIVRPAHQLHPGLVQRLIAQGVHPQHLPSLLQAGVLPPGIDMAPLQGLSGPLLGQP
FT                   LYPLVSAASHPLLNPRPGTPLHLAVMQQQLQRSVLHPPGSSSQAAAISVQTPQNVPSRS
FT                   GMPHMHSQLEHRTSQRSSSPVGLAKWFGSDVLQQPLPSMPTKVISVDELEYRQ"
FT   CDS             join(131289..131381,140912..140985,143243..143370,
FT                   147872..148158,148721..148922,152263..152438,
FT                   155026..155161,155337..155516,157500..157732,
FT                   162093..162276,163212..163291,163845..163984,
FT                   167032..167116,168526..168658,170008..170349,
FT                   170814..170981,171482..171720)
FT                   /codon_start=1
FT                   /gene="Eif4enif1"
FT                   /locus_tag="mCG_14708"
FT                   /product="eukaryotic translation initiation factor 4E
FT                   nuclear import factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG14708.1 transcript_id=mCT169076.0
FT                   protein_id=mCP91811.0 isoform=CRA_a"
FT                   /protein_id="EDL40397.1"
FT                   /translation="MEKSVAETENGDAFLELKKLPTSKSPHRYTKEELLDIKERPYSKQ
FT                   RPSCLSEKYDSDGVWDPEKWHASLYPASGRSSPVESLKKESESDRPSLVRRIADPRERV
FT                   KEDDLDVVLSPQRRSFGGGCHVTAAVSSRRSGSPLEKDSDGLRLLGGRRIGSGRIISAR
FT                   AFEKDHRLSDKDLRDLRDRDRERDYKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFS
FT                   AGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGIVECNGGVAEEDEVEVILA
FT                   QEPSADQEVPRDVILPEQSPGEFDFNEFFNLDKVPCLASMIEDVLGEGSVSASRFSRWF
FT                   SNPSRSGSRSSSLGSTPHEELERLAGLEQAVLSPGQNSGNYFAPIPSEDHAENKVDILE
FT                   MLQKAKVDLKPLLSSLSANKEKLKESSHSGVVLSVEEVEAGLKGLKVDQQMKNSTPFMA
FT                   EHLEETLSAASSNRQLKKDGDMTAFNKLVNTMKASGTLPTQPKVSELLGQPVQRPASSN
FT                   LLSGLMGSLEATASLLSQRAPSPPMSQVFRTQAASADYLHPRIPSPIGFPSGPQQLLGD
FT                   PFQGMRKPMSPVSAQMSQLELQQAALEGLALPHDLAVQTAPFYQPGFSKPQVDRTRDGL
FT                   RNRQQRMSKSPAPMHGGNSSSPAPAASITSMLSPSFTPTSVIRKMYESREKTKEEMAPG
FT                   MVVPGDGKEDTQKTSEENLLSSNPIPNTDQDSSTTNPKLSTLQRSSCSTPLSQTSRYTK
FT                   EQDYRPKTAGRKTPTLASPVPGTPFLRPTHQVPLVPHVPIVRPAHQLHPGLVQRLIAQG
FT                   VHPQHLPSLLQAGVLPPGIDMAPLQGLSGPLLGQPLYPLVSAASHPLLNPRPGTPLHLA
FT                   VMQQQLQRSVLHPPGSSSQAAAISVQTPQNVPSRSGMPHMHSQLEHRTSQRSSSPVGLA
FT                   KWFGSDVLQQPLPSMPTKVISVDELEYRQ"
FT   assembly_gap    135857..136137
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    144893..145085
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   gene            <176068..176895
FT                   /locus_tag="mCG_1041170"
FT                   /note="gene_id=mCG1041170.1"
FT   mRNA            join(<176068..176613,176809..176895)
FT                   /locus_tag="mCG_1041170"
FT                   /product="mCG1041170"
FT                   /note="gene_id=mCG1041170.1 transcript_id=mCT158874.1
FT                   created on 15-MAY-2002"
FT   CDS             <176375..176551
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041170"
FT                   /product="mCG1041170"
FT                   /note="gene_id=mCG1041170.1 transcript_id=mCT158874.1
FT                   protein_id=mCP59257.0"
FT                   /protein_id="EDL40399.1"
FT                   /translation="GSRRSPEGRVVCGKAHSFPQTSEGSSSSPLKTEEAKSVLLQRRSC
FT                   LSQGLLYHHCRPH"
FT   gene            complement(177532..193897)
FT                   /gene="Drg1"
FT                   /locus_tag="mCG_14720"
FT                   /note="gene_id=mCG14720.2"
FT   mRNA            complement(join(177532..177976,179752..179874,
FT                   180235..180402,182103..182233,184134..184303,
FT                   190000..190175,192278..192401,193780..193897))
FT                   /gene="Drg1"
FT                   /locus_tag="mCG_14720"
FT                   /product="developmentally regulated GTP binding protein 1"
FT                   /note="gene_id=mCG14720.2 transcript_id=mCT19879.2 created
FT                   on 15-MAY-2002"
FT   assembly_gap    178727..178933
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   CDS             complement(join(184283..184303,190000..190175,
FT                   192278..192401,193780..193821))
FT                   /codon_start=1
FT                   /gene="Drg1"
FT                   /locus_tag="mCG_14720"
FT                   /product="developmentally regulated GTP binding protein 1"
FT                   /note="gene_id=mCG14720.2 transcript_id=mCT19879.2
FT                   protein_id=mCP7767.2"
FT                   /protein_id="EDL40400.1"
FT                   /translation="MSGTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITP
FT                   KGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPG
FT                   VIRYKGAKIQWPERVI"
FT   assembly_gap    185429..187466
FT                   /estimated_length=2038
FT                   /gap_type="unknown"
FT   assembly_gap    197299..197356
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    202435..203180
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   gene            <216653..248042
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /note="gene_id=mCG14719.4"
FT   mRNA            join(<216653..216835,220594..220657,226348..226519,
FT                   234962..236637,238308..238454,239850..239943,
FT                   244600..244668,246557..246666,247918..248042)
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, transcript variant
FT                   mCT181023"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT181023.1 created
FT                   on 10-JUN-2003"
FT   CDS             join(<216684..216835,220594..220657,226348..226519,
FT                   234962..235380)
FT                   /codon_start=1
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, isoform CRA_g"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT181023.1
FT                   protein_id=mCP103944.1 isoform=CRA_g"
FT                   /protein_id="EDL40407.1"
FT                   /translation="GRQKVPPASDRDPVSFLGQQSGRSQPTSRDFGHQRRTRQGADARP
FT                   TCGCARPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYL
FT                   RAAYMADHLKKHSEGPSNFCSICNREGQKCSHQDLIESSDSYGDLSDASDLKTPEKQSA
FT                   NGSFSCDVAVPKNKMESDGEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGP
FT                   ALGSPFSPQQNMSLLESFGFQIVQSAFASSLVDPEVDQQPMGPEGK"
FT   mRNA            join(<216690..216835,220594..220657,221770..222403)
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, transcript variant
FT                   mCT181022"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT181022.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(<216690..216835,220594..220657,221770..222048)
FT                   /codon_start=1
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, isoform CRA_c"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT181022.0
FT                   protein_id=mCP103945.1 isoform=CRA_c"
FT                   /protein_id="EDL40403.1"
FT                   /translation="QKVPPASDRDPVSFLGQQSGRSQPTSRDFGHQRRTRQGADARPTC
FT                   GCARPDHLNGHIKQVHTSERPHKCQVWVGSSSGLPPLEPLPSDLPSWDFAQPALWRSSH
FT                   SVPDTAFSLSLKKSFPALENLSPAHSSNALFCSAPPGYLRQGWTAPEGSLAFTQWPVG"
FT   mRNA            join(<216692..216835,220594..220657,226348..226519,
FT                   233537..233674,234962..236394)
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, transcript variant
FT                   mCT169091"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT169091.1 created
FT                   on 10-JUN-2003"
FT   CDS             join(<216693..216835,220594..220657,226348..226519,
FT                   233537..233674,234962..235380)
FT                   /codon_start=1
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, isoform CRA_a"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT169091.1
FT                   protein_id=mCP91794.2 isoform=CRA_a"
FT                   /protein_id="EDL40401.1"
FT                   /translation="KVPPASDRDPVSFLGQQSGRSQPTSRDFGHQRRTRQGADARPTCG
FT                   CARPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
FT                   YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGAAF
FT                   HCARTYGNKEGQKCSHQDLIESSDSYGDLSDASDLKTPEKQSANGSFSCDVAVPKNKME
FT                   SDGEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLE
FT                   SFGFQIVQSAFASSLVDPEVDQQPMGPEGK"
FT   mRNA            join(<216770..216835,220594..220657,221770..221861,
FT                   226348..226519,233602..233674,234962..236471)
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, transcript variant
FT                   mCT169090"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT169090.0 created
FT                   on 10-JUN-2003"
FT   assembly_gap    216973..217528
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   mRNA            join(217648..219198,220594..220657,226348..226519,
FT                   234962..236637,238308..238454,239850..239943,
FT                   244600..244668,246557..246666,247918..248042)
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, transcript variant
FT                   mCT19878"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT19878.3 created
FT                   on 10-JUN-2003"
FT   mRNA            join(217648..219198,220594..220657,226348..226519,
FT                   233602..233674,234962..236471)
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, transcript variant
FT                   mCT169092"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT169092.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(217928..219198,220594..220657,226348..226519,
FT                   234962..235380)
FT                   /codon_start=1
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, isoform CRA_d"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT19878.3
FT                   protein_id=mCP7874.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q9JMG9"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1891832"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JMG9"
FT                   /protein_id="EDL40404.1"
FT                   /translation="MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLL
FT                   RVGDESFPAHRAVLAACSEYFESVFSAQLGDGGAADGGPADVGGAAAAPGGGAGGSREL
FT                   EMHTISSKVFGDILDFAYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQI
FT                   LVPPARADIMLFRPPGTSDLGFPLDMTNGAAMAANSNGIAGSMQPEEEAARATGAAIAG
FT                   QASLPVLPGVDRLPMVAGPLSPQLLTSPFPNVASSAPPLTSKRGRGRPRKANLLDSMFG
FT                   SPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISE
FT                   DPDGPRKRSRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMS
FT                   YHVRSHDGSVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLR
FT                   SHLACHEDKVPCQVCGKYLRAAYMADHLKKHSEGPSNFCSICNREGQKCSHQDLIESSD
FT                   SYGDLSDASDLKTPEKQSANGSFSCDVAVPKNKMESDGEKKYPCPECGSFFRSKSYLNK
FT                   HIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFGFQIVQSAFASSLVDPEVDQQP
FT                   MGPEGK"
FT   CDS             join(217928..219198,220594..220657,226348..226519,
FT                   233602..233674,234962..234995)
FT                   /codon_start=1
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, isoform CRA_b"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT169092.0
FT                   protein_id=mCP91777.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5NBZ1"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1891832"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NBZ1"
FT                   /protein_id="EDL40402.1"
FT                   /translation="MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLL
FT                   RVGDESFPAHRAVLAACSEYFESVFSAQLGDGGAADGGPADVGGAAAAPGGGAGGSREL
FT                   EMHTISSKVFGDILDFAYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQI
FT                   LVPPARADIMLFRPPGTSDLGFPLDMTNGAAMAANSNGIAGSMQPEEEAARATGAAIAG
FT                   QASLPVLPGVDRLPMVAGPLSPQLLTSPFPNVASSAPPLTSKRGRGRPRKANLLDSMFG
FT                   SPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISE
FT                   DPDGPRKRSRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMS
FT                   YHVRSHDGSVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLR
FT                   SHLACHEDKVPCQVCGKYLRAAYMADHLKKHSEGPSNFCSICNRGLQAPGTHPEWGSSV
FT                   PLRQDLWQQRRPEMLTSGSD"
FT   mRNA            join(<218773..219198,220594..220657,221770..221861,
FT                   226348..226519,234962..235380)
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, transcript variant
FT                   mCT181021"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT181021.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(<218774..219198,220594..220657,221770..221861,
FT                   226348..226471)
FT                   /codon_start=1
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, isoform CRA_f"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT181021.0
FT                   protein_id=mCP103943.1 isoform=CRA_f"
FT                   /protein_id="EDL40406.1"
FT                   /translation="PGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLP
FT                   PPRLGENGLPISEDPDGPRKRSRTRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSCP
FT                   VCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQ
FT                   VWVGSSSGLPPLEPLPSDLPSWDFAQPALWRPAMPPLRLETACAPTWPVMKTRCPARCV
FT                   ESTCGPHTWQTT"
FT   CDS             join(<226472..226519,233602..233674,234962..235380)
FT                   /codon_start=1
FT                   /gene="Zfp278"
FT                   /locus_tag="mCG_14719"
FT                   /product="zinc finger protein 278, isoform CRA_e"
FT                   /note="gene_id=mCG14719.4 transcript_id=mCT169090.0
FT                   protein_id=mCP91781.1 isoform=CRA_e"
FT                   /protein_id="EDL40405.1"
FT                   /translation="RSTVRGPATSVASVTEVSRHQEPILNGGAAFHCARTYGNKEGQKC
FT                   SHQDLIESSDSYGDLSDASDLKTPEKQSANGSFSCDVAVPKNKMESDGEKKYPCPECGS
FT                   FFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFGFQIVQSAFASS
FT                   LVDPEVDQQPMGPEGK"
FT   gene            <257701..270317
FT                   /gene="1500004A08Rik"
FT                   /locus_tag="mCG_14709"
FT                   /note="gene_id=mCG14709.2"
FT   mRNA            join(<257701..258326,259237..259353,259431..259550,
FT                   260531..260734,260827..260905,263041..263153,
FT                   268871..270317)
FT                   /gene="1500004A08Rik"
FT                   /locus_tag="mCG_14709"
FT                   /product="RIKEN cDNA 1500004A08, transcript variant
FT                   mCT169077"
FT                   /note="gene_id=mCG14709.2 transcript_id=mCT169077.0 created
FT                   on 16-MAY-2002"
FT   mRNA            join(<257701..258326,259237..259353,259431..259550,
FT                   260531..260734,260827..260905,268871..270317)
FT                   /gene="1500004A08Rik"
FT                   /locus_tag="mCG_14709"
FT                   /product="RIKEN cDNA 1500004A08, transcript variant
FT                   mCT19869"
FT                   /note="gene_id=mCG14709.2 transcript_id=mCT19869.2 created
FT                   on 16-MAY-2002"
FT   mRNA            join(<257701..258326,259237..259353,259431..259550,
FT                   260531..260734,260827..261286)
FT                   /gene="1500004A08Rik"
FT                   /locus_tag="mCG_14709"
FT                   /product="RIKEN cDNA 1500004A08, transcript variant
FT                   mCT169078"
FT                   /note="gene_id=mCG14709.2 transcript_id=mCT169078.0 created
FT                   on 16-MAY-2002"
FT   CDS             join(<258146..258326,259237..259353,259431..259550,
FT                   260531..260734,260827..260905,268871..269075)
FT                   /codon_start=1
FT                   /gene="1500004A08Rik"
FT                   /locus_tag="mCG_14709"
FT                   /product="RIKEN cDNA 1500004A08, isoform CRA_c"
FT                   /note="gene_id=mCG14709.2 transcript_id=mCT19869.2
FT                   protein_id=mCP7766.1 isoform=CRA_c"
FT                   /protein_id="EDL40410.1"
FT                   /translation="QGPASLTARRQNCCQGGPPPPPFGHWLLSHLRAEETRMLLAWVHT
FT                   FLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPSPGNH
FT                   NYCRNPDQDPRGPWCYISSETGVPEKRPCEDVSCPETTSQAPPPSSAMELEEKSGAPGD
FT                   KEAQVFPPANALPARSEAAEVQPVIGISQLVRMNSKEKKDLGTLGYVLGITMMVIILAI
FT                   GAGIIVGYTYKRGKDLKEQHEKKACEREMQRITLPLSAFTNPTCETVDENTIIVHSNQT
FT                   PADVQEGSTLLTGQAGTPGA"
FT   CDS             join(<258146..258326,259237..259353,259431..259550,
FT                   260531..260734,260827..260905,263041..263153,
FT                   268871..268884)
FT                   /codon_start=1
FT                   /gene="1500004A08Rik"
FT                   /locus_tag="mCG_14709"
FT                   /product="RIKEN cDNA 1500004A08, isoform CRA_a"
FT                   /note="gene_id=mCG14709.2 transcript_id=mCT169077.0
FT                   protein_id=mCP91788.0 isoform=CRA_a"
FT                   /protein_id="EDL40408.1"
FT                   /translation="QGPASLTARRQNCCQGGPPPPPFGHWLLSHLRAEETRMLLAWVHT
FT                   FLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPSPGNH
FT                   NYCRNPDQDPRGPWCYISSETGVPEKRPCEDVSCPETTSQAPPPSSAMELEEKSGAPGD
FT                   KEAQVFPPANALPARSEAAEVQPVIGISQLVRMNSKEKKDLGTLGYVLGITMMVIILAI
FT                   GAGIIVGYTYKSLRTAFGRLPILGQFPDLQELDLAALNSKLSGCPVQKPGGRT"
FT   CDS             join(<258146..258326,259237..259353,259431..259550,
FT                   260531..260734,260827..260957)
FT                   /codon_start=1
FT                   /gene="1500004A08Rik"
FT                   /locus_tag="mCG_14709"
FT                   /product="RIKEN cDNA 1500004A08, isoform CRA_b"
FT                   /note="gene_id=mCG14709.2 transcript_id=mCT169078.0
FT                   protein_id=mCP91814.0 isoform=CRA_b"
FT                   /protein_id="EDL40409.1"
FT                   /translation="QGPASLTARRQNCCQGGPPPPPFGHWLLSHLRAEETRMLLAWVHT
FT                   FLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPSPGNH
FT                   NYCRNPDQDPRGPWCYISSETGVPEKRPCEDVSCPETTSQAPPPSSAMELEEKSGAPGD
FT                   KEAQVFPPANALPARSEAAEVQPVIGISQLVRMNSKEKKDLGTLGYVLGITMMVIILAI
FT                   GAGIIVGYTYKRWVLSPPGSLGIGLRKT"
FT   gene            complement(270645..335661)
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /note="gene_id=mCG14718.2"
FT   mRNA            complement(join(270645..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279724,
FT                   280624..280810,282621..282817,283159..283264,
FT                   285458..285646,286343..286452,287799..287934,
FT                   320265..320364,335533..335661))
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, transcript
FT                   variant mCT19877"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT19877.1 created
FT                   on 16-MAY-2002"
FT   mRNA            complement(join(270645..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279724,
FT                   280624..280810,282621..282817,283159..283264,
FT                   285458..285646,286343..286452,287799..287934,
FT                   298319..298742))
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, transcript
FT                   variant mCT169086"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT169086.0 created
FT                   on 16-MAY-2002"
FT   mRNA            complement(join(270645..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279724,
FT                   280624..280810,282621..282817,283159..283264,
FT                   285458..285646,286343..286452,287799..287934,
FT                   296332..296511))
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, transcript
FT                   variant mCT169088"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT169088.0 created
FT                   on 16-MAY-2002"
FT   mRNA            complement(join(270645..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279724,
FT                   280624..280810,282621..282817,283159..283264,
FT                   283401..283489))
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, transcript
FT                   variant mCT169089"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT169089.0 created
FT                   on 16-MAY-2002"
FT   mRNA            complement(join(270645..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..280164))
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, transcript
FT                   variant mCT169087"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT169087.0 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(273088..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279724,
FT                   280624..280810,282621..282817,283159..283264,
FT                   285458..285646,286343..286452,287799..287934,
FT                   320265..320364,335533..335548))
FT                   /codon_start=1
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT19877.1
FT                   protein_id=mCP7858.1 isoform=CRA_c"
FT                   /protein_id="EDL40413.1"
FT                   /translation="MAALAGDEAWRCRGCGTYVPLSQRLYRTANEAWHGSCFRCSECQE
FT                   SLTNWYYEKDGKLYCHKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVI
FT                   IEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTESVQDQLPYSVTLISMPATTECRR
FT                   GFSVTVESASSNYATTVQVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVED
FT                   AIKQTSQTLQLLIEHDPVPQRLDQLRLDARLPPHMQSTGHTLMLSTLDTKENQEGTLRR
FT                   RSLRRSNSISKSPGPSSPKEPLLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKG
FT                   FFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDK
FT                   KLNLLTEYIEGGTLKDFLRSVDPFPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCL
FT                   IKLDKTVVVADFGLSRLIVEERKRPPVEKATTKKRTLRKSDRKKRYTVVGNPYWMAPEM
FT                   LNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAF
FT                   FPLAAICCKLEPESRPAFSKLEDSFEALSLFLGELAIPLPAELEDLDHTVSMEYGLTRD
FT                   SPP"
FT   CDS             complement(join(273088..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279724,
FT                   280624..280810,282621..282817,283159..283264,
FT                   285458..285646,286343..286452,287799..287934,
FT                   298319..298371))
FT                   /codon_start=1
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT169086.0
FT                   protein_id=mCP91776.0 isoform=CRA_d"
FT                   /protein_id="EDL40414.1"
FT                   /translation="MGSYLSVPAYFTSRDPFRCSECQESLTNWYYEKDGKLYCHKDYWA
FT                   KFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCH
FT                   NEVVLAPMFERLSTESVQDQLPYSVTLISMPATTECRRGFSVTVESASSNYATTVQVKE
FT                   VNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAIKQTSQTLQLLIEHDPVPQR
FT                   LDQLRLDARLPPHMQSTGHTLMLSTLDTKENQEGTLRRRSLRRSNSISKSPGPSSPKEP
FT                   LLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKE
FT                   LIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSV
FT                   DPFPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEE
FT                   RKRPPVEKATTKKRTLRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCE
FT                   IIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFSKL
FT                   EDSFEALSLFLGELAIPLPAELEDLDHTVSMEYGLTRDSPP"
FT   CDS             complement(join(273088..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279724,
FT                   280624..280810,282621..282817,283159..283264,
FT                   285458..285646,286343..286452,287799..287816))
FT                   /codon_start=1
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT169088.0
FT                   protein_id=mCP91812.0 isoform=CRA_b"
FT                   /protein_id="EDL40412.1"
FT                   /translation="MTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGK
FT                   CHNEVVLAPMFERLSTESVQDQLPYSVTLISMPATTECRRGFSVTVESASSNYATTVQV
FT                   KEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAIKQTSQTLQLLIEHDPVP
FT                   QRLDQLRLDARLPPHMQSTGHTLMLSTLDTKENQEGTLRRRSLRRSNSISKSPGPSSPK
FT                   EPLLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVM
FT                   KELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLR
FT                   SVDPFPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIV
FT                   EERKRPPVEKATTKKRTLRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVL
FT                   CEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFS
FT                   KLEDSFEALSLFLGELAIPLPAELEDLDHTVSMEYGLTRDSPP"
FT   CDS             complement(join(273088..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279724,
FT                   280624..280810,282621..282817,283159..283254))
FT                   /codon_start=1
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT169089.0
FT                   protein_id=mCP91790.0 isoform=CRA_e"
FT                   /protein_id="EDL40415.1"
FT                   /translation="MHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAIKQTSQTLQ
FT                   LLIEHDPVPQRLDQLRLDARLPPHMQSTGHTLMLSTLDTKENQEGTLRRRSLRRSNSIS
FT                   KSPGPSSPKEPLLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTH
FT                   KATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIE
FT                   GGTLKDFLRSVDPFPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVA
FT                   DFGLSRLIVEERKRPPVEKATTKKRTLRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETV
FT                   DVFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKL
FT                   EPESRPAFSKLEDSFEALSLFLGELAIPLPAELEDLDHTVSMEYGLTRDSPP"
FT   CDS             complement(join(273088..273232,273583..273740,
FT                   274400..274455,274922..275096,275942..276007,
FT                   277740..277796,277990..278121,279638..279697))
FT                   /codon_start=1
FT                   /gene="Limk2"
FT                   /locus_tag="mCG_14718"
FT                   /product="LIM motif-containing protein kinase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14718.2 transcript_id=mCT169087.0
FT                   protein_id=mCP91798.0 isoform=CRA_a"
FT                   /protein_id="EDL40411.1"
FT                   /translation="MVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKL
FT                   NLLTEYIEGGTLKDFLRSVDPFPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCLIK
FT                   LDKTVVVADFGLSRLIVEERKRPPVEKATTKKRTLRKSDRKKRYTVVGNPYWMAPEMLN
FT                   GKSYDETVDVFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFP
FT                   LAAICCKLEPESRPAFSKLEDSFEALSLFLGELAIPLPAELEDLDHTVSMEYGLTRDSP
FT                   P"
FT   assembly_gap    327343..327362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(342476..379532)
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /note="gene_id=mCG14717.2"
FT   mRNA            complement(join(342476..344581,346356..346473,
FT                   351784..351838,353068..353180,355386..355404,
FT                   358912..359132,378784..379532))
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, transcript variant
FT                   mCT169084"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT169084.0 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(342476..344581,346356..346473,
FT                   351784..351838,353068..353180,355386..355404,
FT                   358912..359132,364731..364849,378784..379532))
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, transcript variant
FT                   mCT169085"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT169085.0 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(342476..344581,346356..346473,
FT                   351784..351838,353068..353180,358897..359132,
FT                   364731..364849,378784..379532))
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, transcript variant
FT                   mCT19875"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT19875.2 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(342478..344581,346356..346473,
FT                   351784..351838,353068..353180,355386..355404,
FT                   378784..379532))
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, transcript variant
FT                   mCT179865"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT179865.0 created
FT                   on 06-FEB-2003"
FT   mRNA            complement(join(342478..344581,346356..346473,
FT                   351784..351838,353068..353180,358912..359132,
FT                   378784..379532))
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, transcript variant
FT                   mCT179866"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT179866.0 created
FT                   on 06-FEB-2003"
FT   CDS             complement(join(344484..344581,346356..346473,
FT                   351784..351838,353068..353180,355386..355404,
FT                   358912..359132,364731..364793))
FT                   /codon_start=1
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, isoform CRA_b"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT169085.0
FT                   protein_id=mCP91801.0 isoform=CRA_b"
FT                   /protein_id="EDL40417.1"
FT                   /translation="MCILLCPHMFCRPINQRQADWDCLENLPWKLCWQAAMASKGPSAS
FT                   ASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLE
FT                   TRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFG
FT                   FGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIM
FT                   FWLLIA"
FT   CDS             complement(join(344484..344581,346356..346473,
FT                   351784..351838,353068..353180,355386..355404,
FT                   358912..359087))
FT                   /codon_start=1
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, isoform CRA_a"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT169084.0
FT                   protein_id=mCP91791.0 isoform=CRA_a"
FT                   /protein_id="EDL40416.1"
FT                   /translation="MASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDT
FT                   AKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPRE
FT                   KTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVP
FT                   GTPQYVDEQFLSRLFLFVALVIMFWLLIA"
FT   CDS             complement(join(344484..344581,346356..346473,
FT                   351784..351838,353068..353180,358897..358965))
FT                   /codon_start=1
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, isoform CRA_e"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT19875.2
FT                   protein_id=mCP7837.2 isoform=CRA_e"
FT                   /protein_id="EDL40420.1"
FT                   /translation="MPGHSQGCCHQPVWPPLLVSTLPWLETRPNRQVCPVCKAGISRDK
FT                   VIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGI
FT                   FATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA"
FT   CDS             complement(join(346377..346473,351784..351838,
FT                   353068..353180,358912..359087))
FT                   /codon_start=1
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, isoform CRA_d"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT179866.0
FT                   protein_id=mCP102788.0 isoform=CRA_d"
FT                   /protein_id="EDL40419.1"
FT                   /translation="MASKGPSASASTENSNAGGPSGSSNGTGESGGQDSTFECNICLDT
FT                   AKDAVISLCGHLFCGWRLGLTDKCVQSAKLASAETKSSPSMAEAALDSRIPERRLLLVL
FT                   KARGQSQKIEGDFKDLDLEMVAFRCLLELEHFHLGYLPQHLT"
FT   CDS             complement(join(346377..346473,351784..351838,
FT                   353068..353101))
FT                   /codon_start=1
FT                   /gene="Rnf185"
FT                   /locus_tag="mCG_14717"
FT                   /product="ring finger protein 185, isoform CRA_c"
FT                   /note="gene_id=mCG14717.2 transcript_id=mCT179865.0
FT                   protein_id=mCP102787.0 isoform=CRA_c"
FT                   /protein_id="EDL40418.1"
FT                   /translation="MAEAALDSRIPERRLLLVLKARGQSQKIEGDFKDLDLEMVAFRCL
FT                   LELEHFHLGYLPQHLT"
FT   assembly_gap    357136..357155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    375929..375948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <379047..406548
FT                   /gene="8430429K09Rik"
FT                   /locus_tag="mCG_146342"
FT                   /note="gene_id=mCG146342.0"
FT   mRNA            join(<379047..379315,397871..398125,405977..406230,
FT                   406359..406548)
FT                   /gene="8430429K09Rik"
FT                   /locus_tag="mCG_146342"
FT                   /product="RIKEN cDNA 8430429K09"
FT                   /note="gene_id=mCG146342.0 transcript_id=mCT186445.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<379128..379315,397871..398084)
FT                   /codon_start=1
FT                   /gene="8430429K09Rik"
FT                   /locus_tag="mCG_146342"
FT                   /product="RIKEN cDNA 8430429K09"
FT                   /note="gene_id=mCG146342.0 transcript_id=mCT186445.0
FT                   protein_id=mCP107637.0"
FT                   /protein_id="EDL40421.1"
FT                   /translation="RRGNKYVRTRQLIIAFIRVMGQNFNVVFEAGLGYMGPCRKNNGRM
FT                   KKPVLEIPVWNALYKKVSLHGGLWNTERRTPAMGVGILSSEAPPEAQGWATPMVIKADS
FT                   TPVRATQWERATAVSTPNVPAAGRTQLLS"
FT   gene            complement(397368..>398062)
FT                   /locus_tag="mCG_1041132"
FT                   /note="gene_id=mCG1041132.1"
FT   mRNA            complement(join(397368..397941,398023..>398062))
FT                   /locus_tag="mCG_1041132"
FT                   /product="mCG1041132"
FT                   /note="gene_id=mCG1041132.1 transcript_id=mCT158836.1
FT                   created on 16-MAY-2002"
FT   CDS             complement(397477..>397830)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041132"
FT                   /product="mCG1041132"
FT                   /note="gene_id=mCG1041132.1 transcript_id=mCT158836.1
FT                   protein_id=mCP59360.1"
FT                   /protein_id="EDL40422.1"
FT                   /translation="IRHKFTKSRIPDKVFQPKPEDHEKYGGDPQNPHKLHIVTRIRSTK
FT                   RRPYWEKDTIKMLGLQKAHRPQIHKNIPLVNAKLKVVKHLIRIQPLKLPQGLPTEETMS
FT                   STCLKSTGELVVQ"
FT   assembly_gap    398349..398613
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    405514..405701
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    410002..410021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            415455..426642
FT                   /gene="Pla2g3"
FT                   /locus_tag="mCG_56543"
FT                   /note="gene_id=mCG56543.3"
FT   mRNA            join(415455..416009,416918..417050,417299..417433,
FT                   417974..418257,419184..419313,419418..419534,
FT                   425225..425355,425520..426642)
FT                   /gene="Pla2g3"
FT                   /locus_tag="mCG_56543"
FT                   /product="phospholipase A2, group III, transcript variant
FT                   mCT185461"
FT                   /note="gene_id=mCG56543.3 transcript_id=mCT185461.0 created
FT                   on 11-JUN-2003"
FT   CDS             join(415508..416009,416918..417050,417299..417433,
FT                   417974..418257,419184..419313,419418..419534,
FT                   425225..425264)
FT                   /codon_start=1
FT                   /gene="Pla2g3"
FT                   /locus_tag="mCG_56543"
FT                   /product="phospholipase A2, group III, isoform CRA_b"
FT                   /note="gene_id=mCG56543.3 transcript_id=mCT185461.0
FT                   protein_id=mCP106719.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8BV23"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="InterPro:IPR033113"
FT                   /db_xref="MGI:MGI:2444945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BV23"
FT                   /protein_id="EDL40424.1"
FT                   /translation="MGVLGVLLGVLAFLEGSHTRHWDSTSCHLVQPIPGNPLGSLSFLG
FT                   KDAQGLALFQAFWDTHHRLQVCIRQDESELITAFRALCAHEPLQHSFIQTPGPALQRAL
FT                   ATLQSQWEACQRSQDSPTGAREKRAIEQSGAPDREHRRRRRGWTIPGTLWCGVGNSAEN
FT                   ASELGVFHGPDLCCREHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARFQQCLRSQGD
FT                   SISDIMGVAFFNVLEIPCFVLKEQEACVAWNWWGGCRAYGSTPLAHLRPRTYYNASWKA
FT                   EATSYTPSPQSPAPSKHPQKRGPQQTQARRHSTTTTTPFQTPAISSRPDMIPRGQPGVP
FT                   HLGFQDGPKHQSAHRVCRSLRHLDQCEHQIKPQETKFHLLNSAQMPLFHCDCTRRLARF
FT                   LRLHSPPAGTDKVWDLLGTTCFKLAPQLDCAEGKGVSVCSREACNSL"
FT   mRNA            join(<415508..416009,416918..417050,417299..417433,
FT                   417974..418257,419184..419313,419418..419534,
FT                   420262..421455)
FT                   /gene="Pla2g3"
FT                   /locus_tag="mCG_56543"
FT                   /product="phospholipase A2, group III, transcript variant
FT                   mCT56726"
FT                   /note="gene_id=mCG56543.3 transcript_id=mCT56726.3 created
FT                   on 11-JUN-2003"
FT   CDS             join(415508..416009,416918..417050,417299..417433,
FT                   417974..418257,419184..419313,419418..419534,
FT                   420262..420475)
FT                   /codon_start=1
FT                   /gene="Pla2g3"
FT                   /locus_tag="mCG_56543"
FT                   /product="phospholipase A2, group III, isoform CRA_c"
FT                   /note="gene_id=mCG56543.3 transcript_id=mCT56726.3
FT                   protein_id=mCP30220.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BZT7"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="InterPro:IPR033113"
FT                   /db_xref="MGI:MGI:2444945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BZT7"
FT                   /protein_id="EDL40425.1"
FT                   /translation="MGVLGVLLGVLAFLEGSHTRHWDSTSCHLVQPIPGNPLGSLSFLG
FT                   KDAQGLALFQAFWDTHHRLQVCIRQDESELITAFRALCAHEPLQHSFIQTPGPALQRAL
FT                   ATLQSQWEACQRSQDSPTGAREKRAIEQSGAPDREHRRRRRGWTIPGTLWCGVGNSAEN
FT                   ASELGVFHGPDLCCREHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARFQQCLRSQGD
FT                   SISDIMGVAFFNVLEIPCFVLKEQEACVAWNWWGGCRAYGSTPLAHLRPRTYYNASWKA
FT                   EATSYTPSPQSPAPSKHPQKRGPQQTQARRHSTTTTTPFQTPAISSRPDMIPRGQPGVP
FT                   HLGFQDGPKHQSAHRVCRSLRHLDQCEHQIKPQETKFHLLNSAQMPLFHCDCTRRLARF
FT                   LRLHSPPAGTDKVWDLLGTTCFKLAPQLDCAEGKGCSRDHRAIKVSARHLQRLHKSRLH
FT                   FRDKGTGGALAQPVEPPGSTMSFYSQCLQVTQAIWRRRGQKKFWSS"
FT   mRNA            join(416146..417050,417974..418257,419184..419534,
FT                   420262..421455)
FT                   /gene="Pla2g3"
FT                   /locus_tag="mCG_56543"
FT                   /product="phospholipase A2, group III, transcript variant
FT                   mCT185462"
FT                   /note="gene_id=mCG56543.3 transcript_id=mCT185462.0 created
FT                   on 11-JUN-2003"
FT   CDS             join(416812..417050,417974..418257,419184..419317)
FT                   /codon_start=1
FT                   /gene="Pla2g3"
FT                   /locus_tag="mCG_56543"
FT                   /product="phospholipase A2, group III, isoform CRA_a"
FT                   /note="gene_id=mCG56543.3 transcript_id=mCT185462.0
FT                   protein_id=mCP106720.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BL71"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="MGI:MGI:2444945"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BL71"
FT                   /protein_id="EDL40423.1"
FT                   /translation="MSWTAEGRLLYKVGIYELLHSIQAPAPLCSLSLHAGVFHGPDLCC
FT                   REHDQCPQTISPLQYNYGIRNFRFHTISHCDCDARCRAYGSTPLAHLRPRTYYNASWKA
FT                   EATSYTPSPQSPAPSKHPQKRGPQQTQARRHSTTTTTPFQTPAISSRPDMIPRGQPGVP
FT                   HLGFQDGPKHQSAHRVCRSLRHLDQCEHQIKPQETKFHLLNSAQMPLFHCDCTRR"
FT   assembly_gap    418874..419016
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            complement(421562..>432066)
FT                   /gene="Pib5pa"
FT                   /locus_tag="mCG_14715"
FT                   /note="gene_id=mCG14715.2"
FT   mRNA            complement(join(421562..422458,422639..422743,
FT                   422852..422929,423077..423214,426889..427072,
FT                   427183..427292,427430..427541,427866..428041,
FT                   428338..428454,428612..428720,428817..428930,
FT                   429279..430435,431936..432065))
FT                   /gene="Pib5pa"
FT                   /locus_tag="mCG_14715"
FT                   /product="phosphatidylinositol (4,5) bisphosphate
FT                   5-phosphatase, A, transcript variant mCT19874"
FT                   /note="gene_id=mCG14715.2 transcript_id=mCT19874.2 created
FT                   on 16-MAY-2002"
FT   mRNA            complement(join(<421675..421866,422639..422743,
FT                   422852..422929,423077..423214,426889..427072,
FT                   427183..427292,427430..427541,427866..428041,
FT                   428338..428454,428612..428720,428817..428930,
FT                   429279..430435,431936..>432066))
FT                   /gene="Pib5pa"
FT                   /locus_tag="mCG_14715"
FT                   /product="phosphatidylinositol (4,5) bisphosphate
FT                   5-phosphatase, A, transcript variant mCT193938"
FT                   /note="gene_id=mCG14715.2 transcript_id=mCT193938.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<421675..421866,422639..422743,
FT                   422852..422929,423077..423214,426889..427072,
FT                   427183..427292,427430..427541,427866..428041,
FT                   428338..428454,428612..428720,428817..428930,
FT                   429279..430435,431936..>432064))
FT                   /codon_start=1
FT                   /gene="Pib5pa"
FT                   /locus_tag="mCG_14715"
FT                   /product="phosphatidylinositol (4,5) bisphosphate
FT                   5-phosphatase, A, isoform CRA_a"
FT                   /note="gene_id=mCG14715.2 transcript_id=mCT193938.0
FT                   protein_id=mCP114898.0 isoform=CRA_a"
FT                   /protein_id="EDL40426.1"
FT                   /translation="GLPGAAADMEGQTRSGSARPGTRTGLGPLPGTHGVLQAEIPSKKV
FT                   NSSFQLPAKNSGPASSEPRLTLAPVGPRAAVSPPSERPRLVLSSPRPVLAPLSIAGEQK
FT                   RPPPPHSSNRAAKSVGQLVVSAAAASKPPPVASVSILAPKSLGQLVISASAMPRPSPAP
FT                   LGSVLTPTSRDQKQLSPTSVGPKPALATSGLSLALASQEQPPQSPSSPSPVPSPVLSPS
FT                   QEGHLAAASVTSTPASERQLPARQKDTAVPRPTPPADKCLYTPERAAGPATSPPRAQAF
FT                   SDPRLSPSFRARPEAPRHSPEDPVLPPPPQTLPLDVSPGLPESGTRSPGLLSPTFRPGI
FT                   PSSQTVPPPLPKPPRSPSRSPSRSPNRSPCLPPAPEVALPKPVTQAAGSGRCPSPNLQA
FT                   QESPAAATTTTSPTSSWSAQPTCKSDPGFRITVVTWNVGTAMPPDDVTSLLHLGSGHDN
FT                   DGADMIAIGLQEVNSMINKRLKDALFTDQWSELFMDALGPFNFVLVSTVRMQGVILLLF
FT                   AKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQR
FT                   KDNFQTILSLQQFQGPGAHGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWE
FT                   KDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAP
FT                   SGGPSPSGRESHRLQVTQHSYRSHMEYTVSDHKPVAAQFILQFAFRDDVPLVRLEVADE
FT                   WARPEQAVVRYRVETVFARSSWDWIGLYRVGFRHCKDYVAYVWAKHEEVDGNIYQVTFS
FT                   EESLPKGHGDFILGYYSHHHSILIGVTEPFQPLTTSATLSWPGAAYWGVPKLSPGTTST
FT                   VTISKASPGPSSGMMGGTDRYSHLGGHPLGIKFSSF"
FT   CDS             complement(join(421952..422458,422639..422743,
FT                   422852..422929,423077..423214,426889..427072,
FT                   427183..427292,427430..427541,427866..428041,
FT                   428338..428454,428612..428720,428817..428930,
FT                   429279..430435,431936..432040))
FT                   /codon_start=1
FT                   /gene="Pib5pa"
FT                   /locus_tag="mCG_14715"
FT                   /product="phosphatidylinositol (4,5) bisphosphate
FT                   5-phosphatase, A, isoform CRA_b"
FT                   /note="gene_id=mCG14715.2 transcript_id=mCT19874.2
FT                   protein_id=mCP7819.2 isoform=CRA_b"
FT                   /db_xref="GOA:P59644"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="MGI:MGI:2158663"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59644"
FT                   /protein_id="EDL40427.1"
FT                   /translation="MEGQTRSGSARPGTRTGLGPLPGTHGVLQAEIPSKKVNSSFQLPA
FT                   KNSGPASSEPRLTLAPVGPRAAVSPPSERPRLVLSSPRPVLAPLSIAGEQKRPPPPHSS
FT                   NRAAKSVGQLVVSAAAASKPPPVASVSILAPKSLGQLVISASAMPRPSPAPLGSVLTPT
FT                   SRDQKQLSPTSVGPKPALATSGLSLALASQEQPPQSPSSPSPVPSPVLSPSQEGHLAAA
FT                   SVTSTPASERQLPARQKDTAVPRPTPPADKCLYTPERAAGPATSPPRAQAFSDPRLSPS
FT                   FRARPEAPRHSPEDPVLPPPPQTLPLDVSPGLPESGTRSPGLLSPTFRPGIPSSQTVPP
FT                   PLPKPPRSPSRSPSRSPNRSPCLPPAPEVALPKPVTQAAGSGRCPSPNLQAQESPAAAT
FT                   TTTSPTSSWSAQPTCKSDPGFRITVVTWNVGTAMPPDDVTSLLHLGSGHDNDGADMIAI
FT                   GLQEVNSMINKRLKDALFTDQWSELFMDALGPFNFVLVSTVRMQGVILLLFAKYYHLPF
FT                   LRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTIL
FT                   SLQQFQGPGAHGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSNQLHQLWEKDQLNMAK
FT                   NTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDRILWKVKAPSGGPSPSG
FT                   RESHRLQVTQHSYRSHMEYTVSDHKPVAAQFILQFAFRDDVPLVRLEVADEWARPEQAV
FT                   VRYRVETVFARSSWDWIGLYRVGFRHCKDYVAYVWAKHEEVDGNIYQVTFSEESLPKGH
FT                   GDFILGYYSHHHSILIGVTEPFQISLPTSESASSSTDSSGTSSEGEDDSTLELLAPKSR
FT                   SPSPGKSKRHRSRSPGLARFPSLALHPSSRERRGGSRSPSPQSRQLPRVAPDRGHSSSS
FT                   RGSSEEGPSGLPGPWAFPPSVPRSLGLLPALRLETVDPGGGGSWGADQEAPDPNSLSPS
FT                   PQGRLGLEEGGLGP"
FT   gene            <429164..>444622
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /note="gene_id=mCG14712.2"
FT   mRNA            join(<429164..429178,442177..442344,443533..443568,
FT                   443758..443792,444114..444192,444274..444622)
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, transcript variant mCT169082"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT169082.0 created
FT                   on 16-MAY-2002"
FT   mRNA            join(<429164..429178,442177..442344,443533..443568,
FT                   443758..443792,444114..444192,444274..444384,
FT                   444471..>444622)
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, transcript variant mCT19871"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT19871.2 created
FT                   on 16-MAY-2002"
FT   CDS             join(<429166..429178,442177..442344,443533..443568,
FT                   443758..443792,444114..444192,444274..444384,
FT                   444471..>444622)
FT                   /codon_start=1
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, isoform CRA_e"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT19871.2
FT                   protein_id=mCP7877.2 isoform=CRA_e"
FT                   /protein_id="EDL40432.1"
FT                   /translation="PPPPLWVQPAERLLPGTDEHPTVAAVAAAASCSPCGSSHLHHQLP
FT                   TGLEPSSRPGQGAGGDLWRMTVESPKGGEGLCHRGHSTVPQPGDEAPPWGRPRTRAVKP
FT                   KLPGTRANPTQPNDPGRDQCAGTGARLLPQVGAGSSGAPRVPVAPRRQNEALSIPGASP
FT                   LLRADASLQSNGNGVCGGNLNPPFPLPSSTKSSSF"
FT   CDS             join(<429166..429178,442177..442344,443533..443568,
FT                   443758..443792,444114..444192,444274..444395)
FT                   /codon_start=1
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, isoform CRA_c"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT169082.0
FT                   protein_id=mCP91800.0 isoform=CRA_c"
FT                   /protein_id="EDL40430.1"
FT                   /translation="PPPPLWVQPAERLLPGTDEHPTVAAVAAAASCSPCGSSHLHHQLP
FT                   TGLEPSSRPGQGAGGDLWRMTVESPKGGEGLCHRGHSTVPQPGDEAPPWGRPRTRAVKP
FT                   KLPGTRANPTQPNDPGRDQCAGTGARLLPQVGAGSSGAPRVPVGAR"
FT   assembly_gap    433342..433361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<441954..442344,443533..443792,444114..444192,
FT                   444274..444622)
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, transcript variant mCT169079"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT169079.0 created
FT                   on 16-MAY-2002"
FT   mRNA            join(<441954..442344,443533..443568,443758..444192,
FT                   444274..444622)
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, transcript variant mCT169080"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT169080.0 created
FT                   on 16-MAY-2002"
FT   mRNA            join(<441954..442344,443533..443568,443758..443792,
FT                   444114..444192,444274..444622)
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, transcript variant mCT169081"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT169081.0 created
FT                   on 16-MAY-2002"
FT   CDS             join(<441999..442344,443533..443568,443758..443792,
FT                   444114..444192,444274..444395)
FT                   /codon_start=1
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, isoform CRA_b"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT169081.0
FT                   protein_id=mCP91787.0 isoform=CRA_b"
FT                   /protein_id="EDL40429.1"
FT                   /translation="SLEDQRVAETGMGVSGRQPPDLGGMSVGLFLALGAWFMAGRSFWL
FT                   GRGQLAGQTWRSGRVWVQPAERLLPGTDEHPTVAAVAAAASCSPCGSSHLHHQLPTGLE
FT                   PSSRPGQGAGGDLWRMTVESPKGGEGLCHRGHSTVPQPGDEAPPWGRPRTRAVKPKLPG
FT                   TRANPTQPNDPGRDQCAGTGARLLPQVGAGSSGAPRVPVGAR"
FT   CDS             join(<441999..442344,443533..443568,443758..443825)
FT                   /codon_start=1
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, isoform CRA_a"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT169080.0
FT                   protein_id=mCP91778.0 isoform=CRA_a"
FT                   /protein_id="EDL40428.1"
FT                   /translation="SLEDQRVAETGMGVSGRQPPDLGGMSVGLFLALGAWFMAGRSFWL
FT                   GRGQLAGQTWRSGRVWVQPAERLLPGTDEHPTVAAVAAAASCSPCGSSHLHHQLPTGLE
FT                   PSSRPGQGAGGDLWRMTVESPKGGEGLCHRGHSTVVSFSCCGGRG"
FT   CDS             join(<441999..442344,443533..443654)
FT                   /codon_start=1
FT                   /gene="Selm"
FT                   /locus_tag="mCG_14712"
FT                   /product="selenoprotein M, isoform CRA_d"
FT                   /note="gene_id=mCG14712.2 transcript_id=mCT169079.0
FT                   protein_id=mCP91813.0 isoform=CRA_d"
FT                   /protein_id="EDL40431.1"
FT                   /translation="SLEDQRVAETGMGVSGRQPPDLGGMSVGLFLALGAWFMAGRSFWL
FT                   GRGQLAGQTWRSGRVWVQPAERLLPGTDEHPTVAAVAAAASCSPCGSSHLHHQLPTGLE
FT                   PSSRPGQGAGGDLWRMTVESPKGGEFEGRESLLGNKEHWSLTGGLVGIPVL"
FT   gene            complement(444795..>466526)
FT                   /gene="Smtn"
FT                   /locus_tag="mCG_14716"
FT                   /note="gene_id=mCG14716.2"
FT   mRNA            complement(join(444795..445099,448025..448189,
FT                   449090..449241,449733..449850,450047..450220,
FT                   451905..451998,452155..452217,452314..452478,
FT                   453437..453512,453600..453752,456712..456884,
FT                   457039..457554,457642..457713,458317..458389,
FT                   458474..458794,459289..459341,459683..459780,
FT                   459870..459948,460033..460126,460647..460795,
FT                   464595..464708,466384..>466526))
FT                   /gene="Smtn"
FT                   /locus_tag="mCG_14716"
FT                   /product="smoothelin, transcript variant mCT193939"
FT                   /note="gene_id=mCG14716.2 transcript_id=mCT193939.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(444795..445099,448025..448189,
FT                   449090..449241,449733..449850,450047..450220,
FT                   451905..451998,452155..452217,452314..452478,
FT                   453437..453512,453600..453752,456712..456884,
FT                   457039..457554,457642..457713,458317..458389,
FT                   458474..458794,459683..459780,459870..459948,
FT                   460033..460126,460647..460795,464595..464708,
FT                   466384..466511))
FT                   /gene="Smtn"
FT                   /locus_tag="mCG_14716"
FT                   /product="smoothelin, transcript variant mCT19876"
FT                   /note="gene_id=mCG14716.2 transcript_id=mCT19876.0 created
FT                   on 16-MAY-2002"
FT   mRNA            complement(join(444799..445099,449090..449241,
FT                   449733..449850,450047..450220,451905..451998,
FT                   452155..452217,452314..452478,453437..453512,
FT                   453600..453752,456712..456884,457039..457554,
FT                   457642..457713,458317..458389,458474..458794,
FT                   459683..459780,459870..459948,460033..460126,
FT                   460647..460795,464595..464708,466384..466511))
FT                   /gene="Smtn"
FT                   /locus_tag="mCG_14716"
FT                   /product="smoothelin, transcript variant mCT169083"
FT                   /note="gene_id=mCG14716.2 transcript_id=mCT169083.0 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(444949..445099,449090..449241,
FT                   449733..449850,450047..450220,451905..451998,
FT                   452155..452217,452314..452478,453437..453512,
FT                   453600..453752,456712..456884,457039..457554,
FT                   457642..457713,458317..458389,458474..458794,
FT                   459683..459780,459870..459948,460033..460126,
FT                   460647..460795,464595..464645))
FT                   /codon_start=1
FT                   /gene="Smtn"
FT                   /locus_tag="mCG_14716"
FT                   /product="smoothelin, isoform CRA_b"
FT                   /note="gene_id=mCG14716.2 transcript_id=mCT169083.0
FT                   protein_id=mCP91808.0 isoform=CRA_b"
FT                   /protein_id="EDL40434.1"
FT                   /translation="MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELERE
FT                   EEALASKRFRAERQDNKENWLHSQQREAEQQAALARLAGRLESMNDVEELTTLLRSAGE
FT                   YEERKLIRAAIRRVRAQEIKAATLAGRLCSRLPSSGPREDSRRQAAHTLDPGKVPEPEQ
FT                   QEQQTEVLEPTPTPEDTSQDVTTVTLLLRAPPGGRPSSPASPHNSPTSASPEPLLEPAG
FT                   AQCPAVEAPVSSEPLPHPSEAPSPEPPMSPVPSSSRGRVISKPLPGPTEPSDTLDSIRG
FT                   FSNTKRADPSETKSCQRSLSVLSPRQPTPNREPTSLAGPSQFRRVGSVRDRVQKFTSDS
FT                   PVVARLQDGPPRTALASPTPTRLPGPSLISTTPASSSSSNSSSPSPSDTSSHKKQRELA
FT                   HSLAELQSCPQEEGPGGRGLALRSLENRAGGPKPCSEEPSTPPPVAVGTGEPGGSMKTT
FT                   FTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKNTITHISNPGTVT
FT                   RLGSVTHVTTFSHASPGNRGGCNFKMEPDPAEPPSTTVEAANGAEQARVDKGPEGRSPL
FT                   SAEELTAIEDEGVLDKMLDQTTNFEERKLIRAALRELRQRKRDQRDKERERRLREARAR
FT                   PGESRSNVATETTTRHSQRAADGSTVGTVTKTERLVHSNDGTQTARTTTVESSFMRRLE
FT                   NGSSSSSTTTTTVQTKSFSSSSSSSSSKKMGSIFDREDQTSSRPGSLAALERRQAEKKK
FT                   ELMKAQSLPKTSASQARKAMIEKLEKEGSAGGPGTPRTAVQRSTSFGVPNANSIKQMLL
FT                   DWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFS
FT                   SAEMLVDCVPLVEVEDMMIMGKKPDPKCVFTYVQSLYNHLRRHELRLRGKNV"
FT   CDS             complement(join(448045..448189,449090..449241,
FT                   449733..449850,450047..450220,451905..451998,
FT                   452155..452217,452314..452478,453437..453512,
FT                   453600..453752,456712..456884,457039..457554,
FT                   457642..457713,458317..458389,458474..458794,
FT                   459683..459780,459870..459948,460033..460126,
FT                   460647..460795,464595..464645))
FT                   /codon_start=1
FT                   /gene="Smtn"
FT                   /locus_tag="mCG_14716"
FT                   /product="smoothelin, isoform CRA_c"
FT                   /note="gene_id=mCG14716.2 transcript_id=mCT19876.0
FT                   protein_id=mCP7829.1 isoform=CRA_c"
FT                   /protein_id="EDL40435.1"
FT                   /translation="MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELERE
FT                   EEALASKRFRAERQDNKENWLHSQQREAEQQAALARLAGRLESMNDVEELTTLLRSAGE
FT                   YEERKLIRAAIRRVRAQEIKAATLAGRLCSRLPSSGPREDSRRQAAHTLDPGKVPEPEQ
FT                   QEQQTEVLEPTPTPEDTSQDVTTVTLLLRAPPGGRPSSPASPHNSPTSASPEPLLEPAG
FT                   AQCPAVEAPVSSEPLPHPSEAPSPEPPMSPVPSSSRGRVISKPLPGPTEPSDTLDSIRG
FT                   FSNTKRADPSETKSCQRSLSVLSPRQPTPNREPTSLAGPSQFRRVGSVRDRVQKFTSDS
FT                   PVVARLQDGPPRTALASPTPTRLPGPSLISTTPASSSSSNSSSPSPSDTSSHKKQRELA
FT                   HSLAELQSCPQEEGPGGRGLALRSLENRAGGPKPCSEEPSTPPPVAVGTGEPGGSMKTT
FT                   FTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKNTITHISNPGTVT
FT                   RLGSVTHVTTFSHASPGNRGGCNFKMEPDPAEPPSTTVEAANGAEQARVDKGPEGRSPL
FT                   SAEELTAIEDEGVLDKMLDQTTNFEERKLIRAALRELRQRKRDQRDKERERRLREARAR
FT                   PGESRSNVATETTTRHSQRAADGSTVGTVTKTERLVHSNDGTQTARTTTVESSFMRRLE
FT                   NGSSSSSTTTTTVQTKSFSSSSSSSSSKKMGSIFDREDQTSSRPGSLAALERRQAEKKK
FT                   ELMKAQSLPKTSASQARKAMIEKLEKEGSAGGPGTPRTAVQRSTSFGVPNANSIKQMLL
FT                   DWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFS
FT                   SAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEFYRCLVQKGLVKTKKS"
FT   CDS             complement(join(448045..448189,449090..449241,
FT                   449733..449850,450047..450220,451905..451998,
FT                   452155..452217,452314..452478,453437..453512,
FT                   453600..453752,456712..456884,457039..457554,
FT                   457642..457713,458317..458389,458474..458794,
FT                   459289..459341,459683..>459683))
FT                   /codon_start=1
FT                   /gene="Smtn"
FT                   /locus_tag="mCG_14716"
FT                   /product="smoothelin, isoform CRA_a"
FT                   /note="gene_id=mCG14716.2 transcript_id=mCT193939.0
FT                   protein_id=mCP114899.0 isoform=CRA_a"
FT                   /protein_id="EDL40433.1"
FT                   /translation="ACAQQSEGSSPGNANLVLVPEPEQQEQQTEVLEPTPTPEDTSQDV
FT                   TTVTLLLRAPPGGRPSSPASPHNSPTSASPEPLLEPAGAQCPAVEAPVSSEPLPHPSEA
FT                   PSPEPPMSPVPSSSRGRVISKPLPGPTEPSDTLDSIRGFSNTKRADPSETKSCQRSLSV
FT                   LSPRQPTPNREPTSLAGPSQFRRVGSVRDRVQKFTSDSPVVARLQDGPPRTALASPTPT
FT                   RLPGPSLISTTPASSSSSNSSSPSPSDTSSHKKQRELAHSLAELQSCPQEEGPGGRGLA
FT                   LRSLENRAGGPKPCSEEPSTPPPVAVGTGEPGGSMKTTFTIEIKDGRGQASTGRVLLPT
FT                   GNQRAELTLGLRAPPTLLSTSSGGKNTITHISNPGTVTRLGSVTHVTTFSHASPGNRGG
FT                   CNFKMEPDPAEPPSTTVEAANGAEQARVDKGPEGRSPLSAEELTAIEDEGVLDKMLDQT
FT                   TNFEERKLIRAALRELRQRKRDQRDKERERRLREARARPGESRSNVATETTTRHSQRAA
FT                   DGSTVGTVTKTERLVHSNDGTQTARTTTVESSFMRRLENGSSSSSTTTTTVQTKSFSSS
FT                   SSSSSSKKMGSIFDREDQTSSRPGSLAALERRQAEKKKELMKAQSLPKTSASQARKAMI
FT                   EKLEKEGSAGGPGTPRTAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSS
FT                   WSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAETHADCPQLLDTEDMVRLR
FT                   EPDWKCVYTYIQEFYRCLVQKGLVKTKKS"
FT   gene            <458217..464128
FT                   /locus_tag="mCG_146142"
FT                   /note="gene_id=mCG146142.0"
FT   mRNA            join(<458217..459225,459691..459798,460724..463464,
FT                   464043..464128)
FT                   /locus_tag="mCG_146142"
FT                   /product="mCG146142"
FT                   /note="gene_id=mCG146142.0 transcript_id=mCT186245.0
FT                   created on 14-JUL-2003"
FT   CDS             <458304..458963
FT                   /codon_start=1
FT                   /locus_tag="mCG_146142"
FT                   /product="mCG146142"
FT                   /note="gene_id=mCG146142.0 transcript_id=mCT186245.0
FT                   protein_id=mCP107636.0"
FT                   /protein_id="EDL40436.1"
FT                   /translation="QGSSPALLVLEKPLMESKVSEGSVGPGRGCKEKHHIGRGSQAKEL
FT                   TCLASPPLAQLTLLMTRPRELDGTGDMGGSGLGASEGCGSGSELTGASTAGHWAPAGSS
FT                   RGSGEALVGELWGEAGELGLPPGGALSRSVTVVTSWLVSSGVGVGSSTSVCCSCCSGSG
FT                   TCRRHTGRNQGFSDSECYPHPQRTKLIEQAMQSRGAGHGFPRAHLHKEGWSVPKVV"
FT   assembly_gap    476444..476874
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    478250..478782
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   assembly_gap    487530..488209
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    495836..496068
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    503046..503065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    521313..521332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    525418..525514
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    537110..537129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(552808..553479)
FT                   /locus_tag="mCG_50464"
FT                   /note="gene_id=mCG50464.1"
FT   mRNA            complement(552808..553479)
FT                   /locus_tag="mCG_50464"
FT                   /product="mCG50464"
FT                   /note="gene_id=mCG50464.1 transcript_id=mCT50647.1 created
FT                   on 16-MAY-2002"
FT   CDS             complement(553050..553421)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50464"
FT                   /product="mCG50464"
FT                   /note="gene_id=mCG50464.1 transcript_id=mCT50647.1
FT                   protein_id=mCP30272.0"
FT                   /protein_id="EDL40437.1"
FT                   /translation="MQSEKTFKQRGSFEQRVEDARLIREQYPTKIPVIIERYKGEKQLP
FT                   VLDKTKFLVPDYVNVSELIKIIRQRLQLNANQAFFLLVNGHSMVCPHPSLKYESERDED
FT                   SFLYLVYASQETFGTAMAV"
FT   gene            556395..557614
FT                   /pseudo
FT                   /locus_tag="mCG_1041126"
FT                   /note="gene_id=mCG1041126.1"
FT   mRNA            556395..557614
FT                   /pseudo
FT                   /locus_tag="mCG_1041126"
FT                   /note="gene_id=mCG1041126.1 transcript_id=mCT158830.1
FT                   created on 16-MAY-2002"
FT   gene            complement(560434..561066)
FT                   /pseudo
FT                   /locus_tag="mCG_14714"
FT                   /note="gene_id=mCG14714.1"
FT   mRNA            complement(560434..561066)
FT                   /pseudo
FT                   /locus_tag="mCG_14714"
FT                   /note="gene_id=mCG14714.1 transcript_id=mCT19872.1 created
FT                   on 16-MAY-2002"
FT   gene            complement(572132..>574603)
FT                   /locus_tag="mCG_125115"
FT                   /note="gene_id=mCG125115.1"
FT   mRNA            complement(join(572132..573100,574134..>574603))
FT                   /locus_tag="mCG_125115"
FT                   /product="mCG125115"
FT                   /note="gene_id=mCG125115.1 transcript_id=mCT126367.1
FT                   created on 16-MAY-2002"
FT   CDS             complement(574160..>574429)
FT                   /codon_start=1
FT                   /locus_tag="mCG_125115"
FT                   /product="mCG125115"
FT                   /note="gene_id=mCG125115.1 transcript_id=mCT126367.1
FT                   protein_id=mCP59458.1"
FT                   /protein_id="EDL40438.1"
FT                   /translation="STCSSWSGFHFQCSCHHGLQAPRFSRTGPVTQKSLSRYDRNSGGG
FT                   RFVFNFGTVDLAVRKERHDSPSTATSTVTGNLKIQVSVQNLSAN"
FT   gene            <576224..576626
FT                   /locus_tag="mCG_1041133"
FT                   /note="gene_id=mCG1041133.0"
FT   mRNA            join(<576224..576367,576402..576626)
FT                   /locus_tag="mCG_1041133"
FT                   /product="mCG1041133"
FT                   /note="gene_id=mCG1041133.0 transcript_id=mCT158837.1
FT                   created on 16-MAY-2002"
FT   CDS             join(<576307..576367,576402..576625)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041133"
FT                   /product="mCG1041133"
FT                   /note="gene_id=mCG1041133.0 transcript_id=mCT158837.1
FT                   protein_id=mCP59364.1"
FT                   /protein_id="EDL40439.1"
FT                   /translation="AAARVLRTRRKTRRERQRPPELDARAGERAANRSLDRPHARSFAL
FT                   PDRGGGEGAPGLLRVRGLTPRRQDKMAPPLCSAATVPAASLGPPPVLFL"
FT   assembly_gap    576683..576702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    580545..580652
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   gene            586206..617990
FT                   /gene="Morc2a"
FT                   /locus_tag="mCG_14711"
FT                   /note="gene_id=mCG14711.2"
FT   mRNA            join(586206..586239,596330..596405,596895..596985,
FT                   599832..599940,603394..603553,603670..603781,
FT                   604208..604333,604969..605048,605793..605875,
FT                   606102..606187,607222..607362,607446..607600,
FT                   607741..607869,608349..608454,609241..609373,
FT                   611112..611183,611266..611643,612181..612312,
FT                   612405..612459,612952..613093,613225..613449,
FT                   613543..613636,615678..615866,616602..617990)
FT                   /gene="Morc2a"
FT                   /locus_tag="mCG_14711"
FT                   /product="microrchidia 2A, transcript variant mCT19870"
FT                   /note="gene_id=mCG14711.2 transcript_id=mCT19870.2 created
FT                   on 16-MAY-2002"
FT   assembly_gap    589240..589495
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   CDS             join(596366..596405,596895..596985,599832..599940,
FT                   603394..603553,603670..603781,604208..604333,
FT                   604969..605048,605793..605875,606102..606187,
FT                   607222..607362,607446..607600,607741..607869,
FT                   608349..608454,609241..609373,611112..611183,
FT                   611266..611643,612181..612312,612405..612459,
FT                   612952..613093,613225..613449,613543..613636,
FT                   615678..615866,616602..616670)
FT                   /codon_start=1
FT                   /gene="Morc2a"
FT                   /locus_tag="mCG_14711"
FT                   /product="microrchidia 2A, isoform CRA_b"
FT                   /note="gene_id=mCG14711.2 transcript_id=mCT19870.2
FT                   protein_id=mCP7843.2 isoform=CRA_b"
FT                   /protein_id="EDL40441.1"
FT                   /translation="MLCFLDDGAGMDPSDAASVIQFGKSAKRTPESTQIGQYGNGLKSG
FT                   SMRIGKDFILFTKKEDTMTCLFLSRTFHEEEGIDEVIVPLPTWNARTREPITDNVEKFA
FT                   IETELVYKYSPFHTEEQVMNQFMKIPGNSGTLVIIFNLKLMDNGEPELDIISNPKDIQM
FT                   AETSPEGTKPERRSFRAYAAVLYIDPRMRIFIHGHKVQTKRLSCCLYKPRMYKYTSSRF
FT                   KTRAEQEVKKAEHVARIAEEKAREAESKARTLEVRMGGDLTRDSRVMLRQVQNTAITLR
FT                   READVKKRIKDAKQRALKEPKELNFVFGVNIEHRDLDGMFIYNCSRLIKMYEKVGPQLE
FT                   GGMACGGVVGVVDVPYLVLEPTHNKQDFADAKEYRHLLRAMGEHLAQYWKDIAIAQRGI
FT                   IKFWDEFGYLSANWNQPPSSELRFKRRRAMEIPTTIQCDLCLKWRTLPFQLSSVETDYP
FT                   DTWVCSMNPDPEQDRCEASEQKQKVPLGTLKKDPKTQEEKQKQLTEKIRQQQEKLEALQ
FT                   KTTPIRSQADLKKLPLEVTTRPIEEPVRRPQRPRSPPLPAVIKNAPSRPPSIQTPRPST
FT                   QLRKTSVISLPKPPTTAARGETSTSRLLQPTEAPRKPANPPIKTVPRPTPPVHTPPLSL
FT                   IPSSKSLREVPAQKAIKTPVVKKPEPPVKQSVATSGRKRSLAVSDEEEAEEEAEKRRER
FT                   CKRGKLAVKEEKKEANELSDSAGEDHPAELRKAQKDKGLHVEVRVNREWYTGRVTAVEV
FT                   GKNAVRWKVKFDYVPTDTTPRDRWVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMV
FT                   ARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILRNCLRYFLPPSFPISKKELS
FT                   VMNSEELISFPLKEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKL
FT                   QKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD"
FT   mRNA            join(607928..608454,609241..609373,611112..611183,
FT                   611266..611643,612181..612312,612405..612459,
FT                   612952..613093,613225..613449,613543..613636,
FT                   615678..615866,616602..617989)
FT                   /gene="Morc2a"
FT                   /locus_tag="mCG_14711"
FT                   /product="microrchidia 2A, transcript variant mCT126375"
FT                   /note="gene_id=mCG14711.2 transcript_id=mCT126375.1 created
FT                   on 16-MAY-2002"
FT   CDS             join(608312..608454,609241..609373,611112..611183,
FT                   611266..611643,612181..612312,612405..612459,
FT                   612952..613093,613225..613449,613543..613636,
FT                   615678..615866,616602..616670)
FT                   /codon_start=1
FT                   /gene="Morc2a"
FT                   /locus_tag="mCG_14711"
FT                   /product="microrchidia 2A, isoform CRA_a"
FT                   /note="gene_id=mCG14711.2 transcript_id=mCT126375.1
FT                   protein_id=mCP59354.1 isoform=CRA_a"
FT                   /protein_id="EDL40440.1"
FT                   /translation="MVDLLRGVFFLADLCLKWRTLPFQLSSVETDYPDTWVCSMNPDPE
FT                   QDRCEASEQKQKVPLGTLKKDPKTQEEKQKQLTEKIRQQQEKLEALQKTTPIRSQADLK
FT                   KLPLEVTTRPIEEPVRRPQRPRSPPLPAVIKNAPSRPPSIQTPRPSTQLRKTSVISLPK
FT                   PPTTAARGETSTSRLLQPTEAPRKPANPPIKTVPRPTPPVHTPPLSLIPSSKSLREVPA
FT                   QKAIKTPVVKKPEPPVKQSVATSGRKRSLAVSDEEEAEEEAEKRRERCKRGKLAVKEEK
FT                   KEANELSDSAGEDHPAELRKAQKDKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKFD
FT                   YVPTDTTPRDRWVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPST
FT                   SDGLPIEPDTTATSPSHETIDLLVQILRNCLRYFLPPSFPISKKELSVMNSEELISFPL
FT                   KEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQ
FT                   KVQEDIDINTDDELDAYIEDLITKGD"
FT   gene            complement(631298..>793943)
FT                   /gene="Osbp2"
FT                   /locus_tag="mCG_9627"
FT                   /note="gene_id=mCG9627.2"
FT   mRNA            complement(join(631298..631538,631714..632847,
FT                   633031..633257,639514..639689,639778..639873,
FT                   639946..640049,640279..640399,642291..642536,
FT                   642908..643054,643317..643371,644917..645034,
FT                   645614..645806,654123..654379,748174..748382,
FT                   793309..>793943))
FT                   /gene="Osbp2"
FT                   /locus_tag="mCG_9627"
FT                   /product="oxysterol binding protein 2"
FT                   /note="gene_id=mCG9627.2 transcript_id=mCT9980.2 created on
FT                   16-MAY-2002"
FT   assembly_gap    631546..631713
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   CDS             complement(join(632705..632847,633031..633257,
FT                   639514..639689,639778..639873,639946..640049,
FT                   640279..640399,642291..642536,642908..643054,
FT                   643317..643371,644917..645034,645614..645806,
FT                   654123..654379,748174..748382,793309..793943))
FT                   /codon_start=1
FT                   /gene="Osbp2"
FT                   /locus_tag="mCG_9627"
FT                   /product="oxysterol binding protein 2"
FT                   /note="gene_id=mCG9627.2 transcript_id=mCT9980.2
FT                   protein_id=mCP7838.1"
FT                   /protein_id="EDL40442.1"
FT                   /translation="MGKAAALSRGGGCAGRSRGLSSLFTVVPCLSCHTAAPGMNSSAFG
FT                   SGPASKPQLQPVQAPERELLSKQVCQPISEPASRSEPGSQTTSVPRPSGVGQESELQGL
FT                   WPGSENGTRSVSIIKASPELAMPSPLQSTVGSLPVTKPESKLVPKTQSFLRQGQAKISV
FT                   GTPVSGIGVQMVSPPLDSYKGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCR
FT                   ATINLASTHFETEDSCGILLCNGARTYHLKASSEVDRQHWITALELAKAKAIRVMKTQS
FT                   DDSGDDDEEPAAPADNSELHHTLKTLSLKLNDLSTCNDLIAKHGAALQRSLNELDSLKI
FT                   PSECGEKLKVVNERATLFRITSNAMINACRDFLELAETHSRKWQRALNYEQEQRVHLEE
FT                   TIEQLAKQHNSLERAFCNTPGGPASSSKSFSEGSFLTSKGENSEEDEDTEYFDAMEDST
FT                   SFITVVTEAKEDRKPESGPGTTTVDWTSADNVLDGASFMPKNSCKVKRRVRIPDKPNYS
FT                   LNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCL
FT                   VAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSK
FT                   HGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWID
FT                   QSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMEC
FT                   SKIVHSSPSSDGRQKTVYQTLPAKLLWRKYPLPENAENMYYFSELALTLNEQEDGVAPT
FT                   DSRLRPDQRLMERGRWDEANTEKQRLEEKQRLSRRRRLESCTAGGGGEEEKESDGYVPL
FT                   WFEKRLDPLTGEMACMYKGGYWEAKEKKDWHMCPNIF"
FT   assembly_gap    635945..636330
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   assembly_gap    660314..660333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    668739..668758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    690375..690478
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    702630..703005
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    744892..744996
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    753251..753270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    754492..754511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    756191..756432
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    768524..768787
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    781929..781948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(816162..825203)
FT                   /gene="4921536K21Rik"
FT                   /locus_tag="mCG_9623"
FT                   /note="gene_id=mCG9623.1"
FT   mRNA            complement(join(816162..818386,820116..820224,
FT                   824943..825203))
FT                   /gene="4921536K21Rik"
FT                   /locus_tag="mCG_9623"
FT                   /product="RIKEN cDNA 4921536K21"
FT                   /note="gene_id=mCG9623.1 transcript_id=mCT9978.1 created on
FT                   16-MAY-2002"
FT   CDS             complement(join(818237..818386,820116..820224,
FT                   824943..825190))
FT                   /codon_start=1
FT                   /gene="4921536K21Rik"
FT                   /locus_tag="mCG_9623"
FT                   /product="RIKEN cDNA 4921536K21"
FT                   /note="gene_id=mCG9623.1 transcript_id=mCT9978.1
FT                   protein_id=mCP7772.2"
FT                   /protein_id="EDL40443.1"
FT                   /translation="MVLGLASFPESLSSQSETATQPRRPSVKWDLGSDYRKGTEETTAS
FT                   GSNFRRERLDSQPDLGLHVQPQIYFLRPRSPLPKLLFSLMNTNDANVKKLLPKSHLSRV
FT                   IIRDNLNAQRICEMEMKASDKTKRKMSYLYDHLKKKFMMDQLRKMIRWRRDSQSTQDYL
FT                   DKERV"
FT   assembly_gap    822123..822228
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            <825339..830227
FT                   /gene="Dusp18"
FT                   /locus_tag="mCG_9619"
FT                   /note="gene_id=mCG9619.2"
FT   mRNA            join(<825339..825620,827851..830227)
FT                   /gene="Dusp18"
FT                   /locus_tag="mCG_9619"
FT                   /product="dual specificity phosphatase 18"
FT                   /note="gene_id=mCG9619.2 transcript_id=mCT9974.2 created on
FT                   16-MAY-2002"
FT   CDS             join(<825593..825620,827851..828578)
FT                   /codon_start=1
FT                   /gene="Dusp18"
FT                   /locus_tag="mCG_9619"
FT                   /product="dual specificity phosphatase 18"
FT                   /note="gene_id=mCG9619.2 transcript_id=mCT9974.2
FT                   protein_id=mCP7787.0"
FT                   /protein_id="EDL40444.1"
FT                   /translation="KISGALREGGFSGHSLAERCKLNTARTVDFHFDDFTVECLPSSDP
FT                   PAFDQRPLADHQEPVYQQWCGCQQQAPTVQQSDHHSHQRLSRGSKHLLRGYPVCAGACG
FT                   RCARRTPLQFLRFRCRPYPFGGDAEGPHTVALCCWGEPLSCAVPRLPHEVPCHVPCRCP
FT                   HLDQVMQAHHPAQQWLLGAAHPLRVAALWQEYNADDGLANGTDPRHLREGDPFDDPTVS
FT                   QPTSNSSTPRSELELRLLLLQEHSRWCFS"
FT   assembly_gap    825741..826963
FT                   /estimated_length=1223
FT                   /gap_type="unknown"
FT   gene            complement(837930..>845583)
FT                   /gene="Slc35e4"
FT                   /locus_tag="mCG_9628"
FT                   /note="gene_id=mCG9628.2"
FT   mRNA            complement(join(837930..838893,843478..>844878))
FT                   /gene="Slc35e4"
FT                   /locus_tag="mCG_9628"
FT                   /product="solute carrier family 35, member E4, transcript
FT                   variant mCT9983"
FT                   /note="gene_id=mCG9628.2 transcript_id=mCT9983.2 created on
FT                   16-MAY-2002"
FT   CDS             complement(join(838460..838893,843478..>844351))
FT                   /codon_start=1
FT                   /gene="Slc35e4"
FT                   /locus_tag="mCG_9628"
FT                   /product="solute carrier family 35, member E4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG9628.2 transcript_id=mCT9983.2
FT                   protein_id=mCP7835.2 isoform=CRA_b"
FT                   /protein_id="EDL40446.1"
FT                   /translation="KHRVSLGRGEERRPPLVREVPRAYEAWVDTSQSGILAATTFFPDQ
FT                   NYRLAQSLAPEVLPSPVRGIRTRLSDSLESLPPAPAPLVRMCRCPLEHHEGMMTSAEAV
FT                   AVAGSAQEHGRPKWPPDKPQVLGQPAPARVVVAALVWLLAGASMSSLNKWIFTVHGFGR
FT                   PLLLSALHMLAAALACHWGAQRPVPHSIHRRVLLLSLTFGTSMACGNVGLSTVPLDLAQ
FT                   LATTTTPLFTMALSALLLGRRHHPLQFAAMGPLCLGAACSLAGELRAPPAGCGFLLVAT
FT                   CLRGFKSVQQSALLQEERLDTVTLLYATSLPSFCLLASAALVLEAGTAPPLPPTDSRLW
FT                   ACVLLSCFLSVVYNLASFSLLALTSALTVHVLGNLMVVGNLILSRLLFGSHLSALSYLG
FT                   ITLTLSGMFLYHNCELVASWATRWGLWNRDQPGKGL"
FT   mRNA            complement(join(<843477..844957,845404..>845583))
FT                   /gene="Slc35e4"
FT                   /locus_tag="mCG_9628"
FT                   /product="solute carrier family 35, member E4, transcript
FT                   variant mCT126374"
FT                   /note="gene_id=mCG9628.2 transcript_id=mCT126374.0 created
FT                   on 16-MAY-2002"
FT   CDS             complement(<843477..>844351)
FT                   /codon_start=1
FT                   /gene="Slc35e4"
FT                   /locus_tag="mCG_9628"
FT                   /product="solute carrier family 35, member E4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG9628.2 transcript_id=mCT126374.0
FT                   protein_id=mCP59350.0 isoform=CRA_a"
FT                   /protein_id="EDL40445.1"
FT                   /translation="KHRVSLGRGEERRPPLVREVPRAYEAWVDTSQSGILAATTFFPDQ
FT                   NYRLAQSLAPEVLPSPVRGIRTRLSDSLESLPPAPAPLVRMCRCPLEHHEGMMTSAEAV
FT                   AVAGSAQEHGRPKWPPDKPQVLGQPAPARVVVAALVWLLAGASMSSLNKWIFTVHGFGR
FT                   PLLLSALHMLAAALACHWGAQRPVPHSIHRRVLLLSLTFGTSMACGNVGLSTVPLDLAQ
FT                   LATTTTPLFTMALSALLLGRRHHPLQFAAMGPLCLGAACSLAGELRAPPAGCGFLLVAT
FT                   CLRGFKSVQQ"
FT   gene            complement(848097..862540)
FT                   /gene="Tcn2"
FT                   /locus_tag="mCG_9613"
FT                   /note="gene_id=mCG9613.2"
FT   mRNA            complement(join(848097..848616,850197..850312,
FT                   852962..853127,854347..854533,854653..854825,
FT                   855892..856053,856951..857120,858341..858533,
FT                   862345..862535))
FT                   /gene="Tcn2"
FT                   /locus_tag="mCG_9613"
FT                   /product="transcobalamin 2, transcript variant mCT9968"
FT                   /note="gene_id=mCG9613.2 transcript_id=mCT9968.0 created on
FT                   16-MAY-2002"
FT   mRNA            complement(join(848121..848460,857081..857120,
FT                   858341..858533,862345..862538))
FT                   /gene="Tcn2"
FT                   /locus_tag="mCG_9613"
FT                   /product="transcobalamin 2, transcript variant mCT169105"
FT                   /note="gene_id=mCG9613.2 transcript_id=mCT169105.0 created
FT                   on 16-MAY-2002"
FT   mRNA            complement(join(848135..848616,850197..850312,
FT                   852962..853112,858508..858533,862345..862540))
FT                   /gene="Tcn2"
FT                   /locus_tag="mCG_9613"
FT                   /product="transcobalamin 2, transcript variant mCT169106"
FT                   /note="gene_id=mCG9613.2 transcript_id=mCT169106.0 created
FT                   on 16-MAY-2002"
FT   CDS             complement(join(848452..848460,857081..857120,
FT                   858341..858533,862345..862408))
FT                   /codon_start=1
FT                   /gene="Tcn2"
FT                   /locus_tag="mCG_9613"
FT                   /product="transcobalamin 2, isoform CRA_a"
FT                   /note="gene_id=mCG9613.2 transcript_id=mCT169105.0
FT                   protein_id=mCP91797.0 isoform=CRA_a"
FT                   /protein_id="EDL40447.1"
FT                   /translation="MELLKALLLLSGVFGALAEFCVIPRIDSQLVEKLGQRLLPWMDRL
FT                   SSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTSSDDNSSCQPKRI"
FT   CDS             complement(join(848555..848616,850197..850312,
FT                   852962..853127,854347..854533,854653..854825,
FT                   855892..856053,856951..857120,858341..858533,
FT                   862345..862408))
FT                   /codon_start=1
FT                   /gene="Tcn2"
FT                   /locus_tag="mCG_9613"
FT                   /product="transcobalamin 2, isoform CRA_c"
FT                   /note="gene_id=mCG9613.2 transcript_id=mCT9968.0
FT                   protein_id=mCP7846.1 isoform=CRA_c"
FT                   /db_xref="GOA:O88968"
FT                   /db_xref="InterPro:IPR002157"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="MGI:MGI:98534"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88968"
FT                   /protein_id="EDL40449.1"
FT                   /translation="MELLKALLLLSGVFGALAEFCVIPRIDSQLVEKLGQRLLPWMDRL
FT                   SSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTSSDDNSSCQPKLSGGS
FT                   LALYLLALRANCEFFGSRKGDRLISQLKWFLEDEKKAIGHNHEGHPNTNYYQYGLSILA
FT                   LCVHQKRLHDSVVGKLLYAVEHDYFTYQGHVSVDTEAMAGLALTCLERFNFNSDLRPRI
FT                   TMAIETVREKILKSQAPEGYFGNIYSTPLALQMLMTSPASGVGLGTACIKAGTSLLLSL
FT                   QDGAFQNPLMISQLLPILNHKTYLDLIFPDCQASRVMLVPAVEDPVHISEVISVTLKVA
FT                   SALSPYEQTFFVFAGSSLEDVLKLAQDGGGFTYGTQASLSGPYLTSVLGKDAGDREYWQ
FT                   LLRAPDTPLLQGIADYKPQDGETIELRLVRW"
FT   assembly_gap    850974..851488
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   CDS             complement(join(853065..853112,858508..858533,
FT                   862345..862408))
FT                   /codon_start=1
FT                   /gene="Tcn2"
FT                   /locus_tag="mCG_9613"
FT                   /product="transcobalamin 2, isoform CRA_b"
FT                   /note="gene_id=mCG9613.2 transcript_id=mCT169106.0
FT                   protein_id=mCP91779.0 isoform=CRA_b"
FT                   /protein_id="EDL40448.1"
FT                   /translation="MELLKALLLLSGVFGALAEFCVIPRIDSQLLLRTLSTSQKSSASR
FT                   "
FT   assembly_gap    862781..863220
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    873941..874331
FT                   /estimated_length=391
FT                   /gap_type="unknown"
FT   assembly_gap    877176..877195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    880584..880727
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            883154..884419
FT                   /pseudo
FT                   /locus_tag="mCG_9609"
FT                   /note="gene_id=mCG9609.2"
FT   mRNA            883154..884419
FT                   /pseudo
FT                   /locus_tag="mCG_9609"
FT                   /note="gene_id=mCG9609.2 transcript_id=mCT9960.2 created on
FT                   26-JUN-2003"
FT   assembly_gap    887341..887539
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            895672..911905
FT                   /locus_tag="mCG_9607"
FT                   /note="gene_id=mCG9607.2"
FT   mRNA            join(895672..895717,899920..899999,901090..901243,
FT                   902282..902391,904854..905025,905106..905195,
FT                   907186..907302,907397..907471,907692..907778,
FT                   907945..908075,908429..908554,908673..908857,
FT                   909283..909440,909528..909689,910484..911905)
FT                   /locus_tag="mCG_9607"
FT                   /product="mCG9607"
FT                   /note="gene_id=mCG9607.2 transcript_id=mCT9963.2 created on
FT                   17-MAY-2002"
FT   CDS             join(895694..895717,899920..899999,901090..901243,
FT                   902282..902391,904854..905025,905106..905195,
FT                   907186..907302,907397..907471,907692..907778,
FT                   907945..908075,908429..908554,908673..908857,
FT                   909283..909440,909528..909689,910484..910567)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9607"
FT                   /product="mCG9607"
FT                   /note="gene_id=mCG9607.2 transcript_id=mCT9963.2
FT                   protein_id=mCP7827.1"
FT                   /protein_id="EDL40450.1"
FT                   /translation="MGGLEKKKYERGSATNYITRNKARKKLQLSLPDFRRLCILKGIYP
FT                   HEPKHKKKVNKGSTAARTFYLIKDIKFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNAV
FT                   ERLKDNKPCYKLDHIVKERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRR
FT                   LTVEFLHYVITARALRKVFLSIKGIYYQAEVLGQPIVWIAPYAFSHDHPTDVDYRVMAT
FT                   FTEFYTTLLGFVNFRLYQSLNLHYPPKLEGQAQAETKISEDTYALDSESSMEKLAALSA
FT                   SLARVVVPAIEEAEADEFPTDGEVTAQEEDRKKELEAQEKHKKLFEGLKFFLNREVPRE
FT                   ALAFIIRSFGGDVSWDKSLCIGATYDVTDSCITHQIVDRPGQQTPIIGRYYVQPQWVFD
FT                   CVNARLLLPVAEYFPGMQLPPHLSPFVSEKEGDYIPPEKLKLLALQRGEDPGHLEEEEE
FT                   EDEDDDNEGDVAAENEEEDVEVESEEEEEEEVHLSALEQHRLEEKKPQVMAGTVKLEDK
FT                   QRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIREANKLAEKRKAHDDAVRSEK
FT                   KAKRTRPV"
FT   assembly_gap    912563..912672
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            916764..930977
FT                   /gene="Gal3st1"
FT                   /locus_tag="mCG_9605"
FT                   /note="gene_id=mCG9605.1"
FT   mRNA            join(916764..916809,928560..928702,929577..930977)
FT                   /gene="Gal3st1"
FT                   /locus_tag="mCG_9605"
FT                   /product="galactose-3-O-sulfotransferase 1"
FT                   /note="gene_id=mCG9605.1 transcript_id=mCT9961.1 created on
FT                   17-MAY-2002"
FT   CDS             join(928572..928702,929577..930717)
FT                   /codon_start=1
FT                   /gene="Gal3st1"
FT                   /locus_tag="mCG_9605"
FT                   /product="galactose-3-O-sulfotransferase 1"
FT                   /note="gene_id=mCG9605.1 transcript_id=mCT9961.1
FT                   protein_id=mCP7812.1"
FT                   /protein_id="EDL40451.1"
FT                   /translation="MTLLPKKPCKSKAKGLLLGALFTSFLLLLYSYVVPPLYPNMAFTT
FT                   SEAAAPCSPIPNEPVAATPANGSAGGCQPRRDIVFMKTHKTASSTLLNILFRFGQKHEL
FT                   KFAFPNGRNDFHYPSYFARSLVQDYRPGACFNIICNHMRFHYEEVRGLVRPGATFITVI
FT                   RDPARLFESSFHYFGSVVPLTWKLSSRDKLAEFLQDPDRYYDPSSYNAHYLRNLLFFDL
FT                   GYDSSLDPASPRVQEHILEVERRFHLVLLQEYFDESLVLLRELLCWDLEDVLYFKLNAR
FT                   RDSPVPRLSGELYRRATAWNLLDVRLYRHFNASFWRKVEAFGRERMAREVAELRQANEH
FT                   MRHICIDGGQAVGAEAIQDSAMQPWQPLGIKSILGYNLKKSIGPQHEQLCRRMLTPEIQ
FT                   YLSDLGANLWVTKLWKFLRDFLRW"
FT   gene            934064..934657
FT                   /pseudo
FT                   /locus_tag="mCG_48899"
FT                   /note="gene_id=mCG48899.1"
FT   mRNA            934064..934657
FT                   /pseudo
FT                   /locus_tag="mCG_48899"
FT                   /note="gene_id=mCG48899.1 transcript_id=mCT49082.1 created
FT                   on 17-MAY-2002"
FT   assembly_gap    939744..939976
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    940541..940773
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    945149..945168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    956566..956805
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    958463..958482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            963208..979758
FT                   /locus_tag="mCG_9615"
FT                   /note="gene_id=mCG9615.2"
FT   mRNA            join(963208..963273,966878..966953,971192..971235,
FT                   971527..971586,971693..971881,973493..973588,
FT                   973940..974000,975036..975119,975402..975508,
FT                   975582..975721,975813..975982,977962..979756)
FT                   /locus_tag="mCG_9615"
FT                   /product="mCG9615, transcript variant mCT126377"
FT                   /note="gene_id=mCG9615.2 transcript_id=mCT126377.1 created
FT                   on 10-FEB-2003"
FT   mRNA            join(963228..963273,966878..966953,978788..979758)
FT                   /locus_tag="mCG_9615"
FT                   /product="mCG9615, transcript variant mCT169107"
FT                   /note="gene_id=mCG9615.2 transcript_id=mCT169107.1 created
FT                   on 10-FEB-2003"
FT   mRNA            join(963575..963654,966878..966953,971192..971235,
FT                   971527..971586,971693..971881,973493..973588,
FT                   973940..974000,975036..975119,975402..975508,
FT                   975582..975721,975813..975982,977962..979756)
FT                   /locus_tag="mCG_9615"
FT                   /product="mCG9615, transcript variant mCT9970"
FT                   /note="gene_id=mCG9615.2 transcript_id=mCT9970.2 created on
FT                   10-FEB-2003"
FT   mRNA            join(<963575..963654,966878..966953,971192..971235,
FT                   971527..971586,971693..971881,973493..973588,
FT                   973940..974000,975036..975508,975582..975721,
FT                   975813..975982,977962..979755)
FT                   /locus_tag="mCG_9615"
FT                   /product="mCG9615, transcript variant mCT193943"
FT                   /note="gene_id=mCG9615.2 transcript_id=mCT193943.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<963583..963654,966878..966953,971192..971235,
FT                   971527..971586,971693..971881,973493..973588,
FT                   973940..974000,975036..975370)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9615"
FT                   /product="mCG9615, isoform CRA_b"
FT                   /note="gene_id=mCG9615.2 transcript_id=mCT193943.0
FT                   protein_id=mCP114909.0 isoform=CRA_b"
FT                   /protein_id="EDL40453.1"
FT                   /translation="GLAESTMRGQVGDLSPQQQEALARFRETLQDLLPTLPKADDYFLL
FT                   RWLRARNFDLKKSEDMLRKHVEFRNQQNLDQILTWQAPEVIQLYDSGGLSGYDYEGCPV
FT                   WFDIIGTMDPKGLFMSASKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEG
FT                   LSLRHLWKPAVEVYQQFFAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKK
FT                   IVILGGTCLHPWSLARANSVLVWRTEAAAKGRLHPGQSLHNHDLASSAHRVGFQFQIMA
FT                   EEPESKLMCVLCRLSGEQAVPSVGSQLAS"
FT   CDS             join(963601..963654,966878..966953,971192..971235,
FT                   971527..971586,971693..971881,973493..973588,
FT                   973940..974000,975036..975119,975402..975508,
FT                   975582..975721,975813..975982,977962..978092)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9615"
FT                   /product="mCG9615, isoform CRA_c"
FT                   /note="gene_id=mCG9615.2 transcript_id=mCT9970.2
FT                   protein_id=mCP7801.2 isoform=CRA_c"
FT                   /protein_id="EDL40454.1"
FT                   /translation="MRGQVGDLSPQQQEALARFRETLQDLLPTLPKADDYFLLRWLRAR
FT                   NFDLKKSEDMLRKHVEFRNQQNLDQILTWQAPEVIQLYDSGGLSGYDYEGCPVWFDIIG
FT                   TMDPKGLFMSASKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGLSLRHL
FT                   WKPAVEVYQQFFAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGG
FT                   NWKQELVKFVSPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKRYYLSNQERPQYEHS
FT                   VVVGRGSSHQVENEILFPGCVLRWQFASDGGDIGFGVFLKTRMGERQKAGEMVEVLPSQ
FT                   RYNAHMVPEDGSLNCLKAGVYVLRFDNTYSLLHTKKVGYTAEVLLPDKACEEKLQGLGS
FT                   VSPP"
FT   CDS             join(971224..971235,971527..971586,971693..971881,
FT                   973493..973588,973940..974000,975036..975119,
FT                   975402..975508,975582..975721,975813..975982,
FT                   977962..978092)
FT                   /codon_start=1
FT                   /locus_tag="mCG_9615"
FT                   /product="mCG9615, isoform CRA_a"
FT                   /note="gene_id=mCG9615.2 transcript_id=mCT126377.1
FT                   protein_id=mCP59373.1 isoform=CRA_a"
FT                   /protein_id="EDL40452.1"
FT                   /translation="MLRKHVEFRNQQNLDQILTWQAPEVIQLYDSGGLSGYDYEGCPVW
FT                   FDIIGTMDPKGLFMSASKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGL
FT                   SLRHLWKPAVEVYQQFFAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKI
FT                   VILGGNWKQELVKFVSPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKRYYLSNQERP
FT                   QYEHSVVVGRGSSHQVENEILFPGCVLRWQFASDGGDIGFGVFLKTRMGERQKAGEMVE
FT                   VLPSQRYNAHMVPEDGSLNCLKAGVYVLRFDNTYSLLHTKKVGYTAEVLLPDKACEEKL
FT                   QGLGSVSPP"
FT   assembly_gap    973633..973785
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   CDS             979379..979591
FT                   /codon_start=1
FT                   /locus_tag="mCG_9615"
FT                   /product="mCG9615, isoform CRA_d"
FT                   /note="gene_id=mCG9615.2 transcript_id=mCT169107.1
FT                   protein_id=mCP91786.1 isoform=CRA_d"
FT                   /protein_id="EDL40455.1"
FT                   /translation="MNDQIDVSGKGVLTLKCHRPRSLSRNHLVKAPCRRDFRPHRLLLP
FT                   DPIFGFLCLLNRCLHYQRHFNGEKQ"
FT   gene            complement(981417..982094)
FT                   /pseudo
FT                   /locus_tag="mCG_1041174"
FT                   /note="gene_id=mCG1041174.1"
FT   mRNA            complement(981417..982094)
FT                   /pseudo
FT                   /locus_tag="mCG_1041174"
FT                   /note="gene_id=mCG1041174.1 transcript_id=mCT158878.1
FT                   created on 17-MAY-2002"
FT   assembly_gap    989535..989554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            997160..1011396
FT                   /locus_tag="mCG_140354"
FT                   /note="gene_id=mCG140354.0"
FT   mRNA            join(997160..997267,998446..998521,998769..998812,
FT                   998949..999008,1000265..1000453,1001564..1001659,
FT                   1002393..1002453,1003718..1003804,1007029..1007135,
FT                   1007475..1007614,1007701..1007870,1008555..1011396)
FT                   /locus_tag="mCG_140354"
FT                   /product="mCG140354"
FT                   /note="gene_id=mCG140354.0 transcript_id=mCT169075.1
FT                   created on 18-SEP-2002"
FT   CDS             join(997214..997267,998446..998521,998769..998812,
FT                   998949..999008,1000265..1000453,1001564..1001659,
FT                   1002393..1002453,1003718..1003804,1007029..1007135,
FT                   1007475..1007614,1007701..1007870,1008555..1008676)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140354"
FT                   /product="mCG140354"
FT                   /note="gene_id=mCG140354.0 transcript_id=mCT169075.1
FT                   protein_id=mCP91802.1"
FT                   /db_xref="GOA:Q5SQ27"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="MGI:MGI:3617848"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SQ27"
FT                   /protein_id="EDL40456.1"
FT                   /translation="MSGRVGDLSPKQAETLAKFRENVQDVLPALPNPDDYFLLRWLRAR
FT                   NFDLQKSEAMLRKYMEFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIG
FT                   PLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTERLGRKIETIVMIFDCEGLGLKHF
FT                   WKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGS
FT                   NSWKEGLLKLISPEELPAHFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEH
FT                   SVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQKAGEMVEVLTS
FT                   QRYNAHMVPEDGSLTCSEAGVYVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDEELT
FT                   PV"
FT   assembly_gap    998127..998151
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            complement(1023792..1027724)
FT                   /gene="1700020C11Rik"
FT                   /locus_tag="mCG_9616"
FT                   /note="gene_id=mCG9616.2"
FT   mRNA            complement(join(1023792..1024610,1026112..1026344,
FT                   1026700..1026827,1027526..1027724))
FT                   /gene="1700020C11Rik"
FT                   /locus_tag="mCG_9616"
FT                   /product="RIKEN cDNA 1700020C11"
FT                   /note="gene_id=mCG9616.2 transcript_id=mCT9971.2 created on
FT                   17-MAY-2002"
FT   CDS             complement(join(1024538..1024610,1026112..1026344,
FT                   1026700..1026827,1027526..1027592))
FT                   /codon_start=1
FT                   /gene="1700020C11Rik"
FT                   /locus_tag="mCG_9616"
FT                   /product="RIKEN cDNA 1700020C11"
FT                   /note="gene_id=mCG9616.2 transcript_id=mCT9971.2
FT                   protein_id=mCP7862.1"
FT                   /protein_id="EDL40457.1"
FT                   /translation="MSEQQRQGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSY
FT                   GVSSSYVLADAIDKGKKAGEVPSPEAGRNTRMALAVVDTFVWQSLASVAIPGFTINRLC
FT                   AASLYVLGTMTHWPPTVRKWTTTTLGLLAIPVIIHPIDRSVDFLLDSSLRKLYPSVEKP
FT                   STP"
FT   gene            complement(1029346..1051473)
FT                   /gene="Sec14l2"
FT                   /locus_tag="mCG_9618"
FT                   /note="gene_id=mCG9618.2"
FT   mRNA            complement(join(1029346..1029454,1030075..1030745,
FT                   1035693..1035862,1035979..1036118,1036200..1036306,
FT                   1041205..1041288,1041672..1041732,1041857..1041952,
FT                   1043745..1043933,1044151..1044210,1044602..1044645,
FT                   1049405..1049480,1051349..1051473))
FT                   /gene="Sec14l2"
FT                   /locus_tag="mCG_9618"
FT                   /product="SEC14-like 2 (S. cerevisiae), transcript variant
FT                   mCT9973"
FT                   /note="gene_id=mCG9618.2 transcript_id=mCT9973.2 created on
FT                   17-MAY-2002"
FT   mRNA            complement(join(1029364..1030256,1044614..1044645,
FT                   1049405..1049480,1051349..1051403))
FT                   /gene="Sec14l2"
FT                   /locus_tag="mCG_9618"
FT                   /product="SEC14-like 2 (S. cerevisiae), transcript variant
FT                   mCT169108"
FT                   /note="gene_id=mCG9618.2 transcript_id=mCT169108.0 created
FT                   on 17-MAY-2002"
FT   CDS             complement(join(1030239..1030256,1044614..1044645,
FT                   1049405..1049480,1051349..1051402))
FT                   /codon_start=1
FT                   /gene="Sec14l2"
FT                   /locus_tag="mCG_9618"
FT                   /product="SEC14-like 2 (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG9618.2 transcript_id=mCT169108.0
FT                   protein_id=mCP91807.0 isoform=CRA_a"
FT                   /protein_id="EDL40458.1"
FT                   /translation="MSGRVGDLSPKQEEALAKFRENVQDVLPTLPNPDDYFLLRWLRAR
FT                   SFDLQKSEAKLAPK"
FT   CDS             complement(join(1030615..1030745,1035693..1035862,
FT                   1035979..1036118,1036200..1036306,1041205..1041288,
FT                   1041672..1041732,1041857..1041952,1043745..1043933,
FT                   1044151..1044210,1044602..1044645,1049405..1049480,
FT                   1051349..1051402))
FT                   /codon_start=1
FT                   /gene="Sec14l2"
FT                   /locus_tag="mCG_9618"
FT                   /product="SEC14-like 2 (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG9618.2 transcript_id=mCT9973.2
FT                   protein_id=mCP7822.2 isoform=CRA_b"
FT                   /protein_id="EDL40459.1"
FT                   /translation="MSGRVGDLSPKQEEALAKFRENVQDVLPTLPNPDDYFLLRWLRAR
FT                   SFDLQKSEAMLRKHVEFRKQKDIDKIISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIG
FT                   PLDAKGLLFSASKQDLLRTKMRDCELLLQECIQQTTKLGKKIETITMIYDCEGLGLKHL
FT                   WKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGA
FT                   NWKEVLLKHISPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEHT
FT                   VQVSRGSSHQVEYEILFPGCVLRWQFMSEGSDVGFGIFLKTKMGERQRAGEMTEVLPNQ
FT                   RYNSHMVPEDGTLTCSEPGIYVLRFDNTYSFIHAKKVSFTVEVLLPDKAAEEKMNQQGA
FT                   DTPK"
FT   assembly_gap    1036926..1036945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1067919..1075087
FT                   /gene="0610009J22Rik"
FT                   /locus_tag="mCG_140351"
FT                   /note="gene_id=mCG140351.1"
FT   mRNA            join(1067919..1068287,1068538..1068681,1069284..1069355,
FT                   1069436..1069521,1069936..1070092,1072463..1072582,
FT                   1072659..1072802,1073022..1073124,1073211..1074544)
FT                   /gene="0610009J22Rik"
FT                   /locus_tag="mCG_140351"
FT                   /product="RIKEN cDNA 0610009J22, transcript variant
FT                   mCT169060"
FT                   /note="gene_id=mCG140351.1 transcript_id=mCT169060.0
FT                   created on 17-MAY-2002"
FT   mRNA            join(<1067936..1068287,1068538..1068681,1069284..1069355,
FT                   1069436..1069521,1069936..1070092,1072463..1072582,
FT                   1072659..1072802,1073022..1073124,1073211..1073404,
FT                   1074731..1075087)
FT                   /gene="0610009J22Rik"
FT                   /locus_tag="mCG_140351"
FT                   /product="RIKEN cDNA 0610009J22, transcript variant
FT                   mCT193932"
FT                   /note="gene_id=mCG140351.1 transcript_id=mCT193932.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1067937..1068287,1068538..1068681,1069284..1069355,
FT                   1069436..1069521,1069936..1070092,1072463..1072582,
FT                   1072659..1072802,1073022..1073124,1073211..1073233)
FT                   /codon_start=1
FT                   /gene="0610009J22Rik"
FT                   /locus_tag="mCG_140351"
FT                   /product="RIKEN cDNA 0610009J22, isoform CRA_b"
FT                   /note="gene_id=mCG140351.1 transcript_id=mCT193932.0
FT                   protein_id=mCP114914.0 isoform=CRA_b"
FT                   /protein_id="EDL40461.1"
FT                   /translation="LCSPGPRDLRLRPRHLSGRIMGSADRPALRSPSLPPPPPSPPSPL
FT                   LLLLPLLPLWLGLMGPGAAADGSEPATGEGRGGARSVRVDVKLPRQDALVLEGVRIGPE
FT                   DGPEPLLGGRLLLMDVVDAEQEIPVDGWIAVAYVGKEQVAQFHQENQGSSQKAYPKALV
FT                   QQMRRALFLGASALLLLILNHSVVRELDVSQLLLRPVIVLHYSSNVTKLLEALLQRTQA
FT                   TAEISSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGAQAQEQKPLQQLWNAIL
FT                   LVAMLLCTGLVVQAQRQASRQNQQEPGGQEDLFKRRVVRRLASLKTRRCRLSRAAHSLP
FT                   EPGTETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLMLQQTCPLCKFNVLGNHYSDD
FT                   "
FT   CDS             join(1067997..1068287,1068538..1068681,1069284..1069355,
FT                   1069436..1069521,1069936..1070092,1072463..1072582,
FT                   1072659..1072802,1073022..1073124,1073211..1073233)
FT                   /codon_start=1
FT                   /gene="0610009J22Rik"
FT                   /locus_tag="mCG_140351"
FT                   /product="RIKEN cDNA 0610009J22, isoform CRA_a"
FT                   /note="gene_id=mCG140351.1 transcript_id=mCT169060.0
FT                   protein_id=mCP91805.0 isoform=CRA_a"
FT                   /protein_id="EDL40460.1"
FT                   /translation="MGSADRPALRSPSLPPPPPSPPSPLLLLLPLLPLWLGLMGPGAAA
FT                   DGSEPATGEGRGGARSVRVDVKLPRQDALVLEGVRIGPEDGPEPLLGGRLLLMDVVDAE
FT                   QEIPVDGWIAVAYVGKEQVAQFHQENQGSSQKAYPKALVQQMRRALFLGASALLLLILN
FT                   HSVVRELDVSQLLLRPVIVLHYSSNVTKLLEALLQRTQATAEISSGESLSANIEWKLTL
FT                   WTTCGLSKDGYGGWQDLVCLGGAQAQEQKPLQQLWNAILLVAMLLCTGLVVQAQRQASR
FT                   QNQQEPGGQEDLFKRRVVRRLASLKTRRCRLSRAAHSLPEPGTETCAVCLDYFCNKQWL
FT                   RVLPCKHEFHRDCVDPWLMLQQTCPLCKFNVLGNHYSDD"
FT   gene            complement(1074115..>1092945)
FT                   /gene="4930562D19Rik"
FT                   /locus_tag="mCG_145701"
FT                   /note="gene_id=mCG145701.0"
FT   mRNA            complement(join(1074115..1076659,1076750..1076838,
FT                   1077234..1077373,1078958..1079102,1079266..1079442,
FT                   1079893..1080083,1080424..1080501,1081163..1081808,
FT                   1082655..1082826,1084113..1084248,1084396..1084654,
FT                   1085633..1085780,1092883..1092945))
FT                   /gene="4930562D19Rik"
FT                   /locus_tag="mCG_145701"
FT                   /product="RIKEN cDNA 4930562D19, transcript variant
FT                   mCT185247"
FT                   /note="gene_id=mCG145701.0 transcript_id=mCT185247.0
FT                   created on 13-JUN-2003"
FT   gene            <1074665..1075528
FT                   /locus_tag="mCG_140353"
FT                   /note="gene_id=mCG140353.0"
FT   mRNA            join(<1074665..1074821,1075259..1075528)
FT                   /locus_tag="mCG_140353"
FT                   /product="mCG140353"
FT                   /note="gene_id=mCG140353.0 transcript_id=mCT169062.0
FT                   created on 17-MAY-2002"
FT   CDS             <1075268..1075444
FT                   /codon_start=1
FT                   /locus_tag="mCG_140353"
FT                   /product="mCG140353"
FT                   /note="gene_id=mCG140353.0 transcript_id=mCT169062.0
FT                   protein_id=mCP91796.0"
FT                   /protein_id="EDL40464.1"
FT                   /translation="VDADSAEAWDLQQSQGLSRGAVPKAGSPQVEWLRASSLPQNPWAV
FT                   KKQSWASSSGAHL"
FT   mRNA            complement(join(1076333..1076659,1076750..1076838,
FT                   1077234..1077373,1078958..1079126,1079266..1079442,
FT                   1079893..1080083,1080424..1080501,1081163..1081808,
FT                   1082655..1082826,1084113..1084248,1084396..1084654,
FT                   1085633..1085780,1092883..>1092945))
FT                   /gene="4930562D19Rik"
FT                   /locus_tag="mCG_145701"
FT                   /product="RIKEN cDNA 4930562D19, transcript variant
FT                   mCT193924"
FT                   /note="gene_id=mCG145701.0 transcript_id=mCT193924.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(1076413..1076659,1076750..1076838,
FT                   1077234..1077373,1078958..1079126,1079266..1079442,
FT                   1079893..1080083,1080424..1080501,1081163..1081808,
FT                   1082655..1082826,1084113..>1084186))
FT                   /codon_start=1
FT                   /gene="4930562D19Rik"
FT                   /locus_tag="mCG_145701"
FT                   /product="RIKEN cDNA 4930562D19, isoform CRA_a"
FT                   /note="gene_id=mCG145701.0 transcript_id=mCT193924.0
FT                   protein_id=mCP114915.0 isoform=CRA_a"
FT                   /protein_id="EDL40462.1"
FT                   /translation="AVFSLCIARPKTGGVFPIPSPARKRLLLLLQSCASYLENLSVEQM
FT                   MPPARAAGPCMSVGLTVRRFWSNLLRLGLLYQQAVPQKRANQGEISITKPTAKGEPARS
FT                   PECMTAKFIKPPSPVPGLPLICQGLQSIPVRVSLRSPGGTSEKTKSVYSQTVETALVPC
FT                   DACTSVQGSLWEVGKVVISLCQSQNLPSSLGQFQKLVKDSLGLKPLPAATVGHWAAEQS
FT                   KDLTRLNKHVGALTQLVGPLRAQLEDAEGQKDGLRKQVSKLEQALQQEQGQRQRQTEEA
FT                   ERTLAKCEHDRHQLLTETCDLKTKVAVLEGDLKQQQKSIQAMEAKAQQLEEEGERRAAA
FT                   ERQVQQLEEQVQLLAGRLDGASQQIRWASTELDKEKARVDSMVRHQESLQAKQRTLLQQ
FT                   LDCLDQEREELRGSLDEAEAQRSELEEQLQSLQSDREQEQCQLQAQQELLQSLQQEKQD
FT                   LEQVTTDLQLTISELRQQLEELKERERLLVAFPDLHQPEEAQIQSSSNVTQDMERQVQA
FT                   NAIRIQVLQEENKRLQSMLTKIREVAQQGGLKMVPQGQLWSPPYKGIQGATPPAQAQSA
FT                   FSGLTGRRQSPGSRTSSTGRTHPGGLRTSPSRQPGGLPSKFSLGDGSHSASCTQNPIRA
FT                   LARLRRKLSPNRQAGSTYQPQERPT"
FT   CDS             complement(join(1076413..1076659,1076750..1076838,
FT                   1077234..1077373,1078958..1079102,1079266..1079442,
FT                   1079893..1080083,1080424..1080501,1081163..1081808,
FT                   1082655..1082768))
FT                   /codon_start=1
FT                   /gene="4930562D19Rik"
FT                   /locus_tag="mCG_145701"
FT                   /product="RIKEN cDNA 4930562D19, isoform CRA_b"
FT                   /note="gene_id=mCG145701.0 transcript_id=mCT185247.0
FT                   protein_id=mCP106505.0 isoform=CRA_b"
FT                   /protein_id="EDL40463.1"
FT                   /translation="MMPPARAAGPCMSVGLTVRRFWSNLLRLGLLYQQAVPQKRANQGE
FT                   ISITKPTAKGEPARSPECMTAKFIKPPSPVPGLPLICQGLQSIPVRVSLRSPGGTSEKT
FT                   KSVYSQTVETALVPCDACTSVQGSLWEVGKVVISLCQSQNLPSSLGQFQKLVKDSLGLK
FT                   PLPAATVGHWAAEQSKDLTRLNKHVGALTQLVGPLRAQLEDAEGQKDGLRKQVSKLEQA
FT                   LQQEQGQRQRQTEEAERTLAKCEHDRHQLLTETCDLKTKVAVLEGDLKQQQKSIQAMEA
FT                   KAQQLEEEGERRAAAERQVQQLEEQVQLLAGRLDGASQQIRWASTELDKEKARVDSMVR
FT                   HQESLQAKQRTLLQQLDCLDQEREELRGSLDEAEAQRSELEEQLQSLQSDREQEQCQLQ
FT                   AQQEKQDLEQVTTDLQLTISELRQQLEELKERERLLVAFPDLHQPEEAQIQSSSNVTQD
FT                   MERQVQANAIRIQVLQEENKRLQSMLTKIREVAQQGGLKMVPQGQLWSPPYKGIQGATP
FT                   PAQAQSAFSGLTGRRQSPGSRTSSTGRTHPGGLRTSPSRQPGGLPSKFSLGDGSHSASC
FT                   TQNPIRALARLRRKLSPNRQAGSTYQPQERPT"
FT   gene            1093077..1115946
FT                   /gene="Sf3a1"
FT                   /locus_tag="mCG_9630"
FT                   /note="gene_id=mCG9630.2"
FT   mRNA            join(1093077..1093274,1093770..1093891,1099821..1100028,
FT                   1100958..1101215,1104387..1104461,1106403..1106553,
FT                   1107355..1107542,1108359..1108476,1108718..1108903,
FT                   1109593..1109714,1109804..1110049,1110736..1110943,
FT                   1111394..1111548,1112464..1112565,1112677..1112748,
FT                   1113357..1115946)
FT                   /gene="Sf3a1"
FT                   /locus_tag="mCG_9630"
FT                   /product="splicing factor 3a, subunit 1"
FT                   /note="gene_id=mCG9630.2 transcript_id=mCT9985.1 created on
FT                   17-MAY-2002"
FT   CDS             join(1093212..1093274,1093770..1093891,1099821..1100028,
FT                   1100958..1101215,1104387..1104461,1106403..1106553,
FT                   1107355..1107542,1108359..1108476,1108718..1108903,
FT                   1109593..1109714,1109804..1110049,1110736..1110943,
FT                   1111394..1111548,1112464..1112565,1112677..1112748,
FT                   1113357..1113458)
FT                   /codon_start=1
FT                   /gene="Sf3a1"
FT                   /locus_tag="mCG_9630"
FT                   /product="splicing factor 3a, subunit 1"
FT                   /note="gene_id=mCG9630.2 transcript_id=mCT9985.1
FT                   protein_id=mCP7786.1"
FT                   /protein_id="EDL40465.1"
FT                   /translation="MQAGPVQAVPPPPPVATESKQPIEEEASSKEDPTPSKPVVGIIYP
FT                   PPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEG
FT                   KAQEPSAAIPKVMQQQQQATQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFD
FT                   LDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPP
FT                   KGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVV
FT                   VETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDQEKAEET
FT                   PSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPL
FT                   PPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGL
FT                   DIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQAN
FT                   ITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPR
FT                   PPAMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPAAPP
FT                   IMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPPSKKLKTEDSLMPEEE
FT                   FLRRNKGPVSIKVQVPNMQDKTEWKLNGQGLVFTLPLTDQVSVIKVKIHEATGMPAGKQ
FT                   KLQYEGIFIKDSNSLAYYNMASGAVIHLALKERGGRKK"
FT   assembly_gap    1095236..1095255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1120156..1148828
FT                   /gene="Tbc1d10a"
FT                   /locus_tag="mCG_140352"
FT                   /note="gene_id=mCG140352.0"
FT   mRNA            join(1120156..1120422,1139080..1139179,1143250..1143357,
FT                   1145465..1145571,1146109..1146223,1146302..1146367,
FT                   1146881..1147070,1147161..1147315,1148025..1148828)
FT                   /gene="Tbc1d10a"
FT                   /locus_tag="mCG_140352"
FT                   /product="TBC1 domain family, member 10a"
FT                   /note="gene_id=mCG140352.0 transcript_id=mCT169061.0
FT                   created on 17-MAY-2002"
FT   CDS             join(1120214..1120422,1139080..1139179,1143250..1143357,
FT                   1145465..1145571,1146109..1146223,1146302..1146367,
FT                   1146881..1147070,1147161..1147315,1148025..1148477)
FT                   /codon_start=1
FT                   /gene="Tbc1d10a"
FT                   /locus_tag="mCG_140352"
FT                   /product="TBC1 domain family, member 10a"
FT                   /note="gene_id=mCG140352.0 transcript_id=mCT169061.0
FT                   protein_id=mCP91783.0"
FT                   /protein_id="EDL40466.1"
FT                   /translation="MAKSSRENGPREPAAGGSLSGTRESLAQGPDAATADELSSLGSDS
FT                   EANGFAERRIDKFGFIVGSQGAEGALEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKKI
FT                   RLRCQKGIPPSLRGRAWQYLSGGKVKLQQNPGKFDELDMSPGDPKWLDVIERDLHRQFP
FT                   FHEMFVSRGGHGQQDLFRVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAEQAFWCLVQV
FT                   CEKYLPGYYSEKLEAIQLDGEILFSLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFAR
FT                   TLPWSSVLRVWDMFFCEGVKIIFRVGLVLLKHALGSPEKLKACQGQYETIEQLRSLSPK
FT                   IMQEAFLVQEVIELPVTERQIEREHLIQLRRWQETRGELECRSLPRMHGAKAILDAEPG
FT                   PRPALQPSPSIRLPPDAALLSSKAKPHKQAQKEQKRTKTSAQLDKSPGLSQATVVTAAG
FT                   DACPPQGVSPKDPVPQDPTPQNLACHHSQESLTSQESEDTYL"
FT   gene            1151592..1155746
FT                   /gene="2410008K03Rik"
FT                   /locus_tag="mCG_140350"
FT                   /note="gene_id=mCG140350.0"
FT   mRNA            join(1151592..1151750,1152272..1152342,1153432..1153616,
FT                   1153699..1153831,1154007..1154130,1154470..1154583,
FT                   1154748..1154830,1154925..1155019,1155167..1155746)
FT                   /gene="2410008K03Rik"
FT                   /locus_tag="mCG_140350"
FT                   /product="RIKEN cDNA 2410008K03"
FT                   /note="gene_id=mCG140350.0 transcript_id=mCT169059.0
FT                   created on 17-MAY-2002"
FT   CDS             join(1151638..1151750,1152272..1152342,1153432..1153616,
FT                   1153699..1153831,1154007..1154130,1154470..1154583,
FT                   1154748..1154830,1154925..1155019,1155167..1155244)
FT                   /codon_start=1
FT                   /gene="2410008K03Rik"
FT                   /locus_tag="mCG_140350"
FT                   /product="RIKEN cDNA 2410008K03"
FT                   /note="gene_id=mCG140350.0 transcript_id=mCT169059.0
FT                   protein_id=mCP91793.0"
FT                   /protein_id="EDL40467.1"
FT                   /translation="MELHILEHRVRVLSIARPGLWLYTHPLIKLLFLPCRSRCKFFSLT
FT                   ETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVMNVSHSGSVVQAAGVTKIARSVIAPL
FT                   AEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFQIYREVGGEPVPVTGDDSSNGFP
FT                   QIQHGPSPTVHPIQSPQNRFCVLTLDPETLPAVATTLIDVLFYSHSVPKEAASGGPEST
FT                   SIPFFAFSLIEGYISIVMDAEIQRKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVA
FT                   QIAGPLAAVDISAYYISTFNFDHALVPEDEIGCVIDILQRRQESQASKDP"
FT   assembly_gap    1158855..1158874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1160066..1160085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1161206..1161225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1166277..1166788)
FT                   /pseudo
FT                   /locus_tag="mCG_9610"
FT                   /note="gene_id=mCG9610.1"
FT   mRNA            complement(1166277..1166788)
FT                   /pseudo
FT                   /locus_tag="mCG_9610"
FT                   /note="gene_id=mCG9610.1 transcript_id=mCT9965.1 created on
FT                   17-MAY-2002"
FT   assembly_gap    1167991..1168045
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   gene            <1171965..1176569
FT                   /gene="Osm"
FT                   /locus_tag="mCG_9621"
FT                   /note="gene_id=mCG9621.1"
FT   mRNA            join(<1171965..1172458,1174931..1176569)
FT                   /gene="Osm"
FT                   /locus_tag="mCG_9621"
FT                   /product="oncostatin M, transcript variant mCT169109"
FT                   /note="gene_id=mCG9621.1 transcript_id=mCT169109.0 created
FT                   on 17-MAY-2002"
FT   mRNA            join(1172387..1172462,1173964..1174087,1174931..1176569)
FT                   /gene="Osm"
FT                   /locus_tag="mCG_9621"
FT                   /product="oncostatin M, transcript variant mCT9976"
FT                   /note="gene_id=mCG9621.1 transcript_id=mCT9976.1 created on
FT                   17-MAY-2002"
FT   CDS             join(1172428..1172462,1173964..1174087,1174931..1175554)
FT                   /codon_start=1
FT                   /gene="Osm"
FT                   /locus_tag="mCG_9621"
FT                   /product="oncostatin M, isoform CRA_b"
FT                   /note="gene_id=mCG9621.1 transcript_id=mCT9976.1
FT                   protein_id=mCP7778.1 isoform=CRA_b"
FT                   /protein_id="EDL40469.1"
FT                   /translation="MQTRLLRTLLSNLLILSMALANRGCSNSSSQLLSQLQNQANLTGN
FT                   TESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQL
FT                   DALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTT
FT                   PDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRRQSPLRARRKGTRRIRVRHK
FT                   GTRRIRVRRKGTRRIWVRRKGSRKIRPSRSTQSPTTRA"
FT   CDS             join(<1172447..1172458,1174931..1175554)
FT                   /codon_start=1
FT                   /gene="Osm"
FT                   /locus_tag="mCG_9621"
FT                   /product="oncostatin M, isoform CRA_a"
FT                   /note="gene_id=mCG9621.1 transcript_id=mCT169109.0
FT                   protein_id=mCP91782.0 isoform=CRA_a"
FT                   /protein_id="EDL40468.1"
FT                   /translation="EHCSIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVY
FT                   TTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQT
FT                   DSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRRQSPLRARRK
FT                   GTRRIRVRHKGTRRIRVRRKGTRRIWVRRKGSRKIRPSRSTQSPTTRA"
FT   assembly_gap    1183481..1184849
FT                   /estimated_length=1369
FT                   /gap_type="unknown"
FT   assembly_gap    1187375..1187594
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   gene            1201978..1208063
FT                   /gene="Lif"
FT                   /locus_tag="mCG_9620"
FT                   /note="gene_id=mCG9620.2"
FT   mRNA            join(1201978..1202167,1203734..1203915,1204474..1208063)
FT                   /gene="Lif"
FT                   /locus_tag="mCG_9620"
FT                   /product="leukemia inhibitory factor"
FT                   /note="gene_id=mCG9620.2 transcript_id=mCT9975.3 created on
FT                   29-NOV-2004"
FT   CDS             join(1202149..1202167,1203734..1203915,1204474..1204884)
FT                   /codon_start=1
FT                   /gene="Lif"
FT                   /locus_tag="mCG_9620"
FT                   /product="leukemia inhibitory factor"
FT                   /note="gene_id=mCG9620.2 transcript_id=mCT9975.3
FT                   protein_id=mCP7769.2"
FT                   /protein_id="EDL40470.1"
FT                   /translation="MKVLAAGIVPLLLLVLHWKHGAGSPLPITPVNATCAIRHPCHGNL
FT                   MNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLV
FT                   ELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVG
FT                   HVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF"
FT   gene            1209637..1217477
FT                   /locus_tag="mCG_1051121"
FT                   /note="gene_id=mCG1051121.0"
FT   mRNA            join(1209637..1210060,1210508..1210589,1217263..1217477)
FT                   /locus_tag="mCG_1051121"
FT                   /product="mCG1051121"
FT                   /note="gene_id=mCG1051121.0 transcript_id=mCT194910.0
FT                   created on 27-JAN-2005"
FT   CDS             1209784..1210005
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051121"
FT                   /product="mCG1051121"
FT                   /note="gene_id=mCG1051121.0 transcript_id=mCT194910.0
FT                   protein_id=mCP115939.0"
FT                   /protein_id="EDL40471.1"
FT                   /translation="MSCELHVSPGLACLAKDGRDRKQGECHSPAACFAVRVSWLPDGCG
FT                   REGSANSESKGCQGQSGEGQPISQQLLP"
FT   gene            <1251724..1255364
FT                   /locus_tag="mCG_57341"
FT                   /note="gene_id=mCG57341.1"
FT   mRNA            join(<1251724..1251782,1254999..1255364)
FT                   /locus_tag="mCG_57341"
FT                   /product="mCG57341, transcript variant mCT57524"
FT                   /note="gene_id=mCG57341.1 transcript_id=mCT57524.1 created
FT                   on 17-MAY-2002"
FT   mRNA            join(<1251724..1251782,1255031..1255363)
FT                   /locus_tag="mCG_57341"
FT                   /product="mCG57341, transcript variant mCT169101"
FT                   /note="gene_id=mCG57341.1 transcript_id=mCT169101.0 created
FT                   on 17-MAY-2002"
FT   mRNA            join(<1251724..1251782,1255113..1255300)
FT                   /locus_tag="mCG_57341"
FT                   /product="mCG57341, transcript variant mCT169102"
FT                   /note="gene_id=mCG57341.1 transcript_id=mCT169102.0 created
FT                   on 17-MAY-2002"
FT   CDS             join(<1251724..1251782,1255113..1255290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57341"
FT                   /product="mCG57341, isoform CRA_b"
FT                   /note="gene_id=mCG57341.1 transcript_id=mCT169102.0
FT                   protein_id=mCP91815.0 isoform=CRA_b"
FT                   /protein_id="EDL40473.1"
FT                   /translation="ARKGARSRPESCRRESIPITITETMQKDQDQRALACMVLTAELTR
FT                   LKLRLKKRTDSCKLPSDCHMCTHPHTHLEKTKL"
FT   CDS             <1255093..1255290
FT                   /codon_start=1
FT                   /locus_tag="mCG_57341"
FT                   /product="mCG57341, isoform CRA_a"
FT                   /note="gene_id=mCG57341.1 transcript_id=mCT169101.0
FT                   protein_id=mCP91803.0 isoform=CRA_a"
FT                   /protein_id="EDL40472.1"
FT                   /translation="STSPLHRITETMQKDQDQRALACMVLTAELTRLKLRLKKRTDSCK
FT                   LPSDCHMCTHPHTHLEKTKL"
FT   CDS             <1255093..1255290
FT                   /codon_start=1
FT                   /locus_tag="mCG_57341"
FT                   /product="mCG57341, isoform CRA_a"
FT                   /note="gene_id=mCG57341.1 transcript_id=mCT57524.1
FT                   protein_id=mCP30248.1 isoform=CRA_a"
FT                   /protein_id="EDL40474.1"
FT                   /translation="STSPLHRITETMQKDQDQRALACMVLTAELTRLKLRLKKRTDSCK
FT                   LPSDCHMCTHPHTHLEKTKL"
FT   assembly_gap    1256758..1257469
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   assembly_gap    1259493..1259512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1261426..1261707
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   gene            complement(1281277..1377000)
FT                   /locus_tag="mCG_121947"
FT                   /note="gene_id=mCG121947.1"
FT   mRNA            complement(join(1281277..1282129,1344474..1344727,
FT                   1344891..1345042,1348140..1348207,1356647..1356697,
FT                   1360214..1360250,1360699..1360762,1363187..1363328,
FT                   1370897..1370984,1376911..1377000))
FT                   /locus_tag="mCG_121947"
FT                   /product="mCG121947, transcript variant mCT169063"
FT                   /note="gene_id=mCG121947.1 transcript_id=mCT169063.0
FT                   created on 17-MAY-2002"
FT   mRNA            complement(join(1281277..1282129,1344474..1344727,
FT                   1344891..1345042,1348140..1348207,1356647..1356673,
FT                   1357532..1357552,1360214..1360250,1360699..1360762,
FT                   1361449..1361569,1363187..1363328,1370897..1370984,
FT                   1376911..1377000))
FT                   /locus_tag="mCG_121947"
FT                   /product="mCG121947, transcript variant mCT123161"
FT                   /note="gene_id=mCG121947.1 transcript_id=mCT123161.1
FT                   created on 17-MAY-2002"
FT   CDS             complement(join(1282025..1282129,1344474..1344727,
FT                   1344891..1345042,1348140..1348207,1356647..1356697,
FT                   1360214..1360250,1360699..1360762,1363187..1363328,
FT                   1370897..1370947))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121947"
FT                   /product="mCG121947, isoform CRA_c"
FT                   /note="gene_id=mCG121947.1 transcript_id=mCT169063.0
FT                   protein_id=mCP91806.0 isoform=CRA_c"
FT                   /protein_id="EDL40477.1"
FT                   /translation="MATAQLSHNTRTLKASKNTIFPSQVTNEHESLVVVKKLFATCISC
FT                   ITYLRGLFPESSYRDRRLDDLSLKILREDKKCPGSLHIIKWIQGCFDALEKRYCFLFSL
FT                   KQLYTNPKEPEKVTEIYQFRFKYTKKGTTMDFDSSSTSFESGTDSEDIKKACSLLIRQL
FT                   YILMQNLGPLPNDVILTMKLHYYNSVTPHDYQPPGFKEAVNSHFLLFEGEPVSLRMGSV
FT                   SSGFHSMKVKVTTEATRMLDGENSVSQDDGTTEIAHQGLDCDEEEEACGSQVQRMNFVH
FT                   IEPSFESSRKKKKVSEPVTVFIPNRK"
FT   CDS             complement(join(1282025..1282129,1344474..1344727,
FT                   1344891..1345042,1348140..1348207,1356647..1356673,
FT                   1357532..1357552,1360214..1360250,1360699..1360762,
FT                   1361449..1361464))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121947"
FT                   /product="mCG121947, isoform CRA_a"
FT                   /note="gene_id=mCG121947.1 transcript_id=mCT123161.1
FT                   protein_id=mCP59275.1 isoform=CRA_a"
FT                   /protein_id="EDL40475.1"
FT                   /translation="MRRDPNLSLKILREDKKCPGSLHIIKWIQGCFDALEKRYLHMAVL
FT                   TLYTNPKEPEKVTEIYQFRFKYTKKGTTMDFDSSSTSFESGTDSEDIKKACSLLIRQLY
FT                   ILMQNLGPLPNDVILTMKLHYYNSVTPHDYQPPGFKEAVNSHFLLFEGEPVSLRMGSVS
FT                   SGFHSMKVKVTTEATRMLDGENSVSQDDGTTEIAHQGLDCDEEEEACGSQVQRMNFVHI
FT                   EPSFESSRKKKKVSEPVTVFIPNRK"
FT   assembly_gap    1284794..1284813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1291753..1292553
FT                   /estimated_length=801
FT                   /gap_type="unknown"
FT   assembly_gap    1307609..1307628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1347906..1347925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1360011..1360250,1360699..1360762,
FT                   1363187..1363328,1370897..1370984,1376911..1377000))
FT                   /locus_tag="mCG_121947"
FT                   /product="mCG121947, transcript variant mCT169064"
FT                   /note="gene_id=mCG121947.1 transcript_id=mCT169064.0
FT                   created on 17-MAY-2002"
FT   CDS             complement(join(1360181..1360250,1360699..1360762,
FT                   1363187..1363328,1370897..1370947))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121947"
FT                   /product="mCG121947, isoform CRA_b"
FT                   /note="gene_id=mCG121947.1 transcript_id=mCT169064.0
FT                   protein_id=mCP91780.0 isoform=CRA_b"
FT                   /protein_id="EDL40476.1"
FT                   /translation="MATAQLSHNTRTLKASKNTIFPSQVTNEHESLVVVKKLFATCISC
FT                   ITYLRGLFPESSYRDRRLDDLSLKILREDKKCPGSLHIIKWIQGCFDALEKRYVRIFEN
FT                   LPPN"
FT   assembly_gap    1377300..1377367
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    1385200..1385219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1389121..1389145
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    1403121..1403246
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    1405748..1405812
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(1416706..1532026)
FT                   /locus_tag="mCG_9626"
FT                   /note="gene_id=mCG9626.4"
FT   mRNA            complement(join(1416706..1418773,1421197..1421285,
FT                   1423068..1424466,1425456..1425601,1426812..1426982,
FT                   1427641..1427826,1428553..1428748,1433062..1433173,
FT                   1433655..1433786,1434612..1434817,1439756..1439869,
FT                   1445200..1445296,1455563..1455729,1458656..1458738,
FT                   1465615..1465731,1466096..1466185,1469005..1469088,
FT                   1531766..1532026))
FT                   /locus_tag="mCG_9626"
FT                   /product="mCG9626, transcript variant mCT9982"
FT                   /note="gene_id=mCG9626.4 transcript_id=mCT9982.4 created on
FT                   10-JUN-2004"
FT   mRNA            complement(join(1416706..1418773,1421197..1421285,
FT                   1421713..1421823,1423068..1424466,1425456..1425601,
FT                   1426812..1426982,1427641..1427826,1428553..1428748,
FT                   1433062..1433173,1433655..1433786,1434612..1434817,
FT                   1439756..1439869,1445200..1445296,1455563..1455729,
FT                   1458656..1458738,1465615..1465731,1466096..1466185,
FT                   1469005..1469088,1531766..1532026))
FT                   /locus_tag="mCG_9626"
FT                   /product="mCG9626, transcript variant mCT179894"
FT                   /note="gene_id=mCG9626.4 transcript_id=mCT179894.1 created
FT                   on 10-JUN-2004"
FT   mRNA            complement(join(1416706..1418773,1421197..1421285,
FT                   1423059..1424466,1425456..1425601,1426812..1426982,
FT                   1427641..1427826,1428553..1428748,1433062..1433173,
FT                   1433655..1433786,1434612..1434817,1439756..1439869,
FT                   1445200..1445296,1455563..1455729,1458656..1458738,
FT                   1465615..1465731,1466096..1466185,1469005..1469088,
FT                   1531766..1532026))
FT                   /locus_tag="mCG_9626"
FT                   /product="mCG9626, transcript variant mCT193947"
FT                   /note="gene_id=mCG9626.4 transcript_id=mCT193947.1 created
FT                   on 10-JUN-2004"
FT   mRNA            complement(join(1416706..1418773,1421197..1421285,
FT                   1423068..1424466,1425456..1425601,1426812..1426982,
FT                   1427641..1427826,1428553..1428748,1433062..1433173,
FT                   1433655..1433786,1434612..1434817,1439756..1439869,
FT                   1445200..1445296,1455563..1455729,1458656..1458738,
FT                   1465615..1465731,1466096..1466185,1469005..1469088,
FT                   1483974..1484053,1531766..1532026))
FT                   /locus_tag="mCG_9626"
FT                   /product="mCG9626, transcript variant mCT179895"
FT                   /note="gene_id=mCG9626.4 transcript_id=mCT179895.1 created
FT                   on 10-JUN-2004"
FT   CDS             complement(join(1418602..1418773,1421197..1421285,
FT                   1423068..1424466,1425456..1425601,1426812..1426982,
FT                   1427641..1427826,1428553..1428748,1433062..1433173,
FT                   1433655..1433786,1434612..1434817,1439756..1439869,
FT                   1445200..1445296,1455563..1455729,1458656..1458738,
FT                   1465615..1465731,1466096..1466185,1469005..1469007))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9626"
FT                   /product="mCG9626, isoform CRA_b"
FT                   /note="gene_id=mCG9626.4 transcript_id=mCT179895.1
FT                   protein_id=mCP102817.1 isoform=CRA_b"
FT                   /db_xref="GOA:B1ATD5"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="MGI:MGI:1921552"
FT                   /db_xref="UniProtKB/TrEMBL:B1ATD5"
FT                   /protein_id="EDL40479.1"
FT                   /translation="MDEEMRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYV
FT                   GRAEEAIIALSNYRLHIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFPTF
FT                   EQCQDWLKRLNNAIRPPGKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKN
FT                   EVERMGFDMNNAWRISNINEKYKLCGSYPQELIVPAWITDKELESVAGFRSWKRIPAVI
FT                   YRHQSNGAVIARCGQPEVSWWGWRNADDEHLVQSVARACASDSQSSISKVSTRNSCRDF
FT                   PNAGDLSDVEFDSSLSNTSGAESLALQPQKLLILDARSYAAAVANRAKGGGCECPEYYP
FT                   NCEVVFMGMANIHSIRRSFQSLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVV
FT                   HAVDRDQRPVLVHCSDGWDRTPQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFAD
FT                   RCGHGEDSDDLNERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFL
FT                   CNNAKERGEKQTQERTCSVWSLLRAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVY
FT                   LPCPSPSTPTDDSCAPYPVPGTSPDEPPLSRLPKTRSFDNLTTTCENMVPLASRRSSDP
FT                   SLNEKWQEHGRSLELSSFASAGEEVPAMDSLRKPSRLLGGAELSVAAGVAEGQMENILQ
FT                   EATKEESGVEEPTHRGHTEVPEVKEEAPLAKESSMAAEGPVVLYQEPQLDDATLRSHQG
FT                   PSLSLFSQGIPEHQDGHNVLSSSLQAPLRGEDSQEVPVEQPQVENIAEDRENVAPAVPV
FT                   DAKVGLGISQSSSLLPSQVPFETRGPHINNSVHMLLEDKVKSESGPQLHHRPCPASSGR
FT                   FSGKDMLPVAPEPRSAERPQWDSVLHRTSSPGNTLSLLQAPCALPLDKCRQGIVCNGAL
FT                   ETENKASEQPAGFDTLQKYPTPNGHCANWEAGRSKDSLSHQLSATSCSSAHLYSRNLHH
FT                   KWLNSHSGRPSTTSSPDQPSRSHLDDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQ
FT                   ELKSRLESQYLTSSLRFNGDFGDEVMTRWLPDHLAAHCYACDSAFWLASRKHHCRNCGN
FT                   VFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAATSN"
FT   CDS             complement(join(1418602..1418773,1421197..1421285,
FT                   1423068..1424466,1425456..1425601,1426812..1426982,
FT                   1427641..1427826,1428553..1428748,1433062..1433173,
FT                   1433655..1433786,1434612..1434817,1439756..1439869,
FT                   1445200..1445296,1455563..1455729,1458656..1458738,
FT                   1465615..1465731,1466096..1466185,1469005..1469007))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9626"
FT                   /product="mCG9626, isoform CRA_b"
FT                   /note="gene_id=mCG9626.4 transcript_id=mCT9982.4
FT                   protein_id=mCP7800.4 isoform=CRA_b"
FT                   /db_xref="GOA:B1ATD5"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="MGI:MGI:1921552"
FT                   /db_xref="UniProtKB/TrEMBL:B1ATD5"
FT                   /protein_id="EDL40481.1"
FT                   /translation="MDEEMRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYV
FT                   GRAEEAIIALSNYRLHIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFPTF
FT                   EQCQDWLKRLNNAIRPPGKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKN
FT                   EVERMGFDMNNAWRISNINEKYKLCGSYPQELIVPAWITDKELESVAGFRSWKRIPAVI
FT                   YRHQSNGAVIARCGQPEVSWWGWRNADDEHLVQSVARACASDSQSSISKVSTRNSCRDF
FT                   PNAGDLSDVEFDSSLSNTSGAESLALQPQKLLILDARSYAAAVANRAKGGGCECPEYYP
FT                   NCEVVFMGMANIHSIRRSFQSLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVV
FT                   HAVDRDQRPVLVHCSDGWDRTPQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFAD
FT                   RCGHGEDSDDLNERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFL
FT                   CNNAKERGEKQTQERTCSVWSLLRAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVY
FT                   LPCPSPSTPTDDSCAPYPVPGTSPDEPPLSRLPKTRSFDNLTTTCENMVPLASRRSSDP
FT                   SLNEKWQEHGRSLELSSFASAGEEVPAMDSLRKPSRLLGGAELSVAAGVAEGQMENILQ
FT                   EATKEESGVEEPTHRGHTEVPEVKEEAPLAKESSMAAEGPVVLYQEPQLDDATLRSHQG
FT                   PSLSLFSQGIPEHQDGHNVLSSSLQAPLRGEDSQEVPVEQPQVENIAEDRENVAPAVPV
FT                   DAKVGLGISQSSSLLPSQVPFETRGPHINNSVHMLLEDKVKSESGPQLHHRPCPASSGR
FT                   FSGKDMLPVAPEPRSAERPQWDSVLHRTSSPGNTLSLLQAPCALPLDKCRQGIVCNGAL
FT                   ETENKASEQPAGFDTLQKYPTPNGHCANWEAGRSKDSLSHQLSATSCSSAHLYSRNLHH
FT                   KWLNSHSGRPSTTSSPDQPSRSHLDDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQ
FT                   ELKSRLESQYLTSSLRFNGDFGDEVMTRWLPDHLAAHCYACDSAFWLASRKHHCRNCGN
FT                   VFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAATSN"
FT   CDS             complement(join(1418602..1418773,1421197..1421285,
FT                   1421713..1421823,1423068..1424466,1425456..1425601,
FT                   1426812..1426982,1427641..1427826,1428553..1428748,
FT                   1433062..1433173,1433655..1433786,1434612..1434817,
FT                   1439756..1439869,1445200..1445296,1455563..1455729,
FT                   1458656..1458738,1465615..1465731,1466096..1466185,
FT                   1469005..1469007))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9626"
FT                   /product="mCG9626, isoform CRA_a"
FT                   /note="gene_id=mCG9626.4 transcript_id=mCT179894.1
FT                   protein_id=mCP102816.1 isoform=CRA_a"
FT                   /protein_id="EDL40478.1"
FT                   /translation="MDEEMRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYV
FT                   GRAEEAIIALSNYRLHIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFPTF
FT                   EQCQDWLKRLNNAIRPPGKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKN
FT                   EVERMGFDMNNAWRISNINEKYKLCGSYPQELIVPAWITDKELESVAGFRSWKRIPAVI
FT                   YRHQSNGAVIARCGQPEVSWWGWRNADDEHLVQSVARACASDSQSSISKVSTRNSCRDF
FT                   PNAGDLSDVEFDSSLSNTSGAESLALQPQKLLILDARSYAAAVANRAKGGGCECPEYYP
FT                   NCEVVFMGMANIHSIRRSFQSLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVV
FT                   HAVDRDQRPVLVHCSDGWDRTPQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFAD
FT                   RCGHGEDSDDLNERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFL
FT                   CNNAKERGEKQTQERTCSVWSLLRAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVY
FT                   LPCPSPSTPTDDSCAPYPVPGTSPDEPPLSRLPKTRSFDNLTTTCENMVPLASRRSSDP
FT                   SLNEKWQEHGRSLELSSFASAGEEVPAMDSLRKPSRLLGGAELSVAAGVAEGQMENILQ
FT                   EATKEESGVEEPTHRGHTEVPEVKEEAPLAKESSMAAEGPVVLYQEPQLDDATLRSHQG
FT                   PSLSLFSQGIPEHQDGHNVLSSSLQAPLRGEDSQEVPVEQPQVENIAEDRENVAPAVPV
FT                   DAKVGLGISQSSSLLPSQVPFETRGPHINNSVHMLLEDKVKSESGPQLHHRPCPASSGR
FT                   FSGKDMLPVAPEPRSAERPQWDSVLHRTSSPGNTLSLLQAPCALPLDKCRQGIVCNGAL
FT                   ETENKASEQPAGFDTLQKYPTPNGHCANWEAGRSKDSLSHQLSATSCSSAHLYSRNLHH
FT                   KWLNSHSGRPSTTSSPDQPSRSHLDDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQ
FT                   ELKSRLESQYLTSSLRFNGDFGDEVTSIPDSESNLDQNCVSRCSTEIFSEASWEQVDKQ
FT                   DTEMTRWLPDHLAAHCYACDSAFWLASRKHHCRNCGNVFCSSCCNQKVPVPSQQLFEPS
FT                   RVCKSCYSSLHPTSSSIDLELDKPIAATSN"
FT   CDS             complement(join(1423059..1424466,1425456..1425601,
FT                   1426812..1426982,1427641..1427826,1428553..1428748,
FT                   1433062..1433173,1433655..1433786,1434612..1434817,
FT                   1439756..1439869,1445200..1445296,1455563..1455729,
FT                   1458656..1458738,1465615..1465731,1466096..1466185,
FT                   1469005..1469007))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9626"
FT                   /product="mCG9626, isoform CRA_c"
FT                   /note="gene_id=mCG9626.4 transcript_id=mCT193947.1
FT                   protein_id=mCP114911.1 isoform=CRA_c"
FT                   /db_xref="GOA:M0QW74"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="MGI:MGI:1921552"
FT                   /db_xref="UniProtKB/TrEMBL:M0QW74"
FT                   /protein_id="EDL40480.1"
FT                   /translation="MDEEMRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYV
FT                   GRAEEAIIALSNYRLHIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFPTF
FT                   EQCQDWLKRLNNAIRPPGKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKN
FT                   EVERMGFDMNNAWRISNINEKYKLCGSYPQELIVPAWITDKELESVAGFRSWKRIPAVI
FT                   YRHQSNGAVIARCGQPEVSWWGWRNADDEHLVQSVARACASDSQSSISKVSTRNSCRDF
FT                   PNAGDLSDVEFDSSLSNTSGAESLALQPQKLLILDARSYAAAVANRAKGGGCECPEYYP
FT                   NCEVVFMGMANIHSIRRSFQSLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVV
FT                   HAVDRDQRPVLVHCSDGWDRTPQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFAD
FT                   RCGHGEDSDDLNERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFL
FT                   CNNAKERGEKQTQERTCSVWSLLRAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVY
FT                   LPCPSPSTPTDDSCAPYPVPGTSPDEPPLSRLPKTRSFDNLTTTCENMVPLASRRSSDP
FT                   SLNEKWQEHGRSLELSSFASAGEEVPAMDSLRKPSRLLGGAELSVAAGVAEGQMENILQ
FT                   EATKEESGVEEPTHRGHTEVPEVKEEAPLAKESSMAAEGPVVLYQEPQLDDATLRSHQG
FT                   PSLSLFSQGIPEHQDGHNVLSSSLQAPLRGEDSQEVPVEQPQVENIAEDRENVAPAVPV
FT                   DAKVGLGISQSSSLLPSQVPFETRGPHINNSVHMLLEDKVKSESGPQLHHRPCPASSGR
FT                   FSGKDMLPVAPEPRSAERPQWDSVLHRTSSPGNTLSLLQAPCALPLDKCRQGIVCNGAL
FT                   ETENKASEQPAGFDTLQKYPTPNGHCANWEAGRSKDSLSHQLSATSCSSAHLYSRNLHH
FT                   KWLNSHSGRPSTTSSPDQPSRSHLDDDGMPVYTDTIQQRLRQIESGHQQEVETLKKQVQ
FT                   ELKSRLESQYLTSSLRFNGDFGDEVVS"
FT   assembly_gap    1430448..1431122
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   assembly_gap    1440815..1440834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1442120..1442139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1459766..1459785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1482784..1482803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1501393..1502319
FT                   /pseudo
FT                   /locus_tag="mCG_9617"
FT                   /note="gene_id=mCG9617.1"
FT   mRNA            1501393..1502319
FT                   /pseudo
FT                   /locus_tag="mCG_9617"
FT                   /note="gene_id=mCG9617.1 transcript_id=mCT9972.1 created on
FT                   20-MAY-2002"
FT   assembly_gap    1531311..1531347
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    1535086..1535768
FT                   /estimated_length=683
FT                   /gap_type="unknown"
FT   assembly_gap    1543807..1543826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1557822..>1565314)
FT                   /gene="RP23-280J3.2"
FT                   /locus_tag="mCG_145063"
FT                   /note="gene_id=mCG145063.0"
FT   mRNA            complement(join(1557822..1558538,1563964..1564480,
FT                   1565227..>1565314))
FT                   /gene="RP23-280J3.2"
FT                   /locus_tag="mCG_145063"
FT                   /product="hypothetical protein A930010I02"
FT                   /note="gene_id=mCG145063.0 transcript_id=mCT184487.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(1564156..1564480,1565227..>1565312))
FT                   /codon_start=1
FT                   /gene="RP23-280J3.2"
FT                   /locus_tag="mCG_145063"
FT                   /product="hypothetical protein A930010I02"
FT                   /note="gene_id=mCG145063.0 transcript_id=mCT184487.0
FT                   protein_id=mCP105943.0"
FT                   /protein_id="EDL40482.1"
FT                   /translation="CDLEMGNLPRAVQLHPAPCYLLVAIDYTRQDFFVEPCLSWNSLCR
FT                   PGYSGTQTFAYFCLLRAEVKGMNPHTWLIICLLNKRLPTEKGFHSWVHEEMLRSMYPWS
FT                   CTKSYREHISVERLKTLIQPGNECPPKTLVWG"
FT   assembly_gap    1573417..1573764
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   gene            <1575145..1618115
FT                   /gene="Ascc2"
FT                   /locus_tag="mCG_9625"
FT                   /note="gene_id=mCG9625.3"
FT   mRNA            join(<1575145..1575222,1577786..1577883,1583957..1584115,
FT                   1584458..1584628,1587135..1587264,1593687..1593754,
FT                   1595651..1595761,1596708..1596820,1601669..1601743,
FT                   1602994..1603101,1603259..1603327,1603541..1603615,
FT                   1604955..1605141,1606963..1607177,1613924..1614017,
FT                   1614103..1614224,1614755..1614854,1616111..1616190,
FT                   1617579..1618115)
FT                   /gene="Ascc2"
FT                   /locus_tag="mCG_9625"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   2, transcript variant mCT193946"
FT                   /note="gene_id=mCG9625.3 transcript_id=mCT193946.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1575173..1575222,1577786..1577883,1583957..1584115,
FT                   1584458..1584628,1587135..1587264,1593687..1593754,
FT                   1595651..1595761,1596708..1596820,1601669..1601743,
FT                   1602994..1603101,1603259..1603327,1603541..1603615,
FT                   1604955..1605141,1606963..1607177,1608008..1608127,
FT                   1613924..1614017,1614103..1614224,1614755..1614854,
FT                   1616111..1616190,1617579..1618055)
FT                   /gene="Ascc2"
FT                   /locus_tag="mCG_9625"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   2, transcript variant mCT9981"
FT                   /note="gene_id=mCG9625.3 transcript_id=mCT9981.2 created on
FT                   20-MAY-2002"
FT   CDS             join(<1575198..1575222,1577786..1577883,1583957..1584115,
FT                   1584458..1584628,1587135..1587264,1593687..1593754,
FT                   1595651..1595761,1596708..1596820,1601669..1601743,
FT                   1602994..1603101,1603259..1603327,1603541..1603615,
FT                   1604955..1605141,1606963..1607177,1613924..1614017,
FT                   1614103..1614224,1614755..1614854,1616111..1616190,
FT                   1617579..1617750)
FT                   /codon_start=1
FT                   /gene="Ascc2"
FT                   /locus_tag="mCG_9625"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG9625.3 transcript_id=mCT193946.0
FT                   protein_id=mCP114910.0 isoform=CRA_a"
FT                   /protein_id="EDL40483.1"
FT                   /translation="TSRVWSRGGGSHSTMPALPLDQLQITHKDPKTGQPKTSAALNPEQ
FT                   KADRYFVLYKPPPKDNIPALVEEYLERANFVANDLDWLLALPHDKFWCQVIFDETLQKC
FT                   LDSYLHYVPRKFDEWVAPTPEVADMQNHLHRSVFLTFLRMSTHKESKDHFISPSAFGEI
FT                   LYNNFLFDIPKILDLCVLFGKGNSPLLQKMIGNIFTQQPSYYTDLDETIPTILQVFSNI
FT                   LQHCGLQGDGTSTTPQKLGERSPLTPSDMPLLELKDIVLYLCDTSTTLWAFLDIFPLAC
FT                   QTFQKHDFCYRLASFYEMAIPELESAIKKRRLEDSKLLGDMWQRLSHSKKKLMEVFHII
FT                   LNQICLLPILESSCDNIQGFIEEFLQIFSSLLQEKRFLRDYDTFSPVAEDISLLQQASS
FT                   ALDETRTAYILQAVESAWEGVDRQKIKDIKDPPRAKGSNNEVTVTAEPVSEMPSQLENL
FT                   EEDEECMGAAAALGPAVSGVELDSLISQVKDLLPDLGEGFILACLEHYSYDSEQVINNI
FT                   LEDRLAPELSQLDRGLERKEENVRSLVNDKQAVVAQWQRYQKYSVVVEEVPLQPGEYQA
FT                   DDYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKMPGEVQEEEWDEEDEVE
FT                   EEAPKPDHFIQDPAVLREKAEARRMAFLARKGYRPENSTAVTGGPRGHGQSRETTQERR
FT                   KKEANKAARANHNRRTMADRKRSKGMIPS"
FT   CDS             join(1577803..1577883,1583957..1584115,1584458..1584628,
FT                   1587135..1587264,1593687..1593754,1595651..1595761,
FT                   1596708..1596820,1601669..1601743,1602994..1603101,
FT                   1603259..1603327,1603541..1603615,1604955..1605141,
FT                   1606963..1607177,1608008..1608127,1613924..1614017,
FT                   1614103..1614224,1614755..1614854,1616111..1616190,
FT                   1617579..1617750)
FT                   /codon_start=1
FT                   /gene="Ascc2"
FT                   /locus_tag="mCG_9625"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG9625.3 transcript_id=mCT9981.2
FT                   protein_id=mCP7804.2 isoform=CRA_b"
FT                   /protein_id="EDL40484.1"
FT                   /translation="MPALPLDQLQITHKDPKTGQPKTSAALNPEQKADRYFVLYKPPPK
FT                   DNIPALVEEYLERANFVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLHYVPRKFDE
FT                   WVAPTPEVADMQNHLHRSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILD
FT                   LCVLFGKGNSPLLQKMIGNIFTQQPSYYTDLDETIPTILQVFSNILQHCGLQGDGTSTT
FT                   PQKLGERSPLTPSDMPLLELKDIVLYLCDTSTTLWAFLDIFPLACQTFQKHDFCYRLAS
FT                   FYEMAIPELESAIKKRRLEDSKLLGDMWQRLSHSKKKLMEVFHIILNQICLLPILESSC
FT                   DNIQGFIEEFLQIFSSLLQEKRFLRDYDTFSPVAEDISLLQQASSALDETRTAYILQAV
FT                   ESAWEGVDRQKIKDIKDPPRAKGSNNEVTVTAEPVSEMPSQLENLEEDEECMGAAAALG
FT                   PAVSGVELDSLISQVKDLLPDLGEGFILACLEHYSYDSEQVINNILEDRLAPELSQLDR
FT                   GLERQVKPDPTPLLSSRHNIFQNDEFDVFSRDSVDLSRVHKGRRKEENVRSLVNDKQAV
FT                   VAQWQRYQKYSVVVEEVPLQPGEYQADDYEDEYDDTYDGNQVGANDADSDDELISRRPF
FT                   TIPQVLRTKMPGEVQEEEWDEEDEVEEEAPKPDHFIQDPAVLREKAEARRMAFLARKGY
FT                   RPENSTAVTGGPRGHGQSRETTQERRKKEANKAARANHNRRTMADRKRSKGMIPS"
FT   assembly_gap    1631837..1631856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1633924..1633943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1634494..1634513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1637246..1639609)
FT                   /gene="1110020P15Rik"
FT                   /locus_tag="mCG_1041147"
FT                   /note="gene_id=mCG1041147.1"
FT   mRNA            complement(join(1637246..1637493,1639177..1639262,
FT                   1639430..1639594))
FT                   /gene="1110020P15Rik"
FT                   /locus_tag="mCG_1041147"
FT                   /product="RIKEN cDNA 1110020P15, transcript variant
FT                   mCT158851"
FT                   /note="gene_id=mCG1041147.1 transcript_id=mCT158851.1
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(1637248..1637493,1639430..1639609))
FT                   /gene="1110020P15Rik"
FT                   /locus_tag="mCG_1041147"
FT                   /product="RIKEN cDNA 1110020P15, transcript variant
FT                   mCT169478"
FT                   /note="gene_id=mCG1041147.1 transcript_id=mCT169478.0
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(<1637248..1637493,1639374..1639507))
FT                   /gene="1110020P15Rik"
FT                   /locus_tag="mCG_1041147"
FT                   /product="RIKEN cDNA 1110020P15, transcript variant
FT                   mCT169477"
FT                   /note="gene_id=mCG1041147.1 transcript_id=mCT169477.0
FT                   created on 27-FEB-2003"
FT   CDS             complement(1637248..1637373)
FT                   /codon_start=1
FT                   /gene="1110020P15Rik"
FT                   /locus_tag="mCG_1041147"
FT                   /product="RIKEN cDNA 1110020P15, isoform CRA_c"
FT                   /note="gene_id=mCG1041147.1 transcript_id=mCT169477.0
FT                   protein_id=mCP92114.0 isoform=CRA_c"
FT                   /protein_id="EDL40487.1"
FT                   /translation="MSFKLPFTDRQCVGKLWLHCTNRLTSAVFEYSCQQINAKCS"
FT   CDS             complement(join(1637449..1637493,1639430..1639579))
FT                   /codon_start=1
FT                   /gene="1110020P15Rik"
FT                   /locus_tag="mCG_1041147"
FT                   /product="RIKEN cDNA 1110020P15, isoform CRA_b"
FT                   /note="gene_id=mCG1041147.1 transcript_id=mCT169478.0
FT                   protein_id=mCP92128.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5NCJ9"
FT                   /db_xref="InterPro:IPR008027"
FT                   /db_xref="MGI:MGI:1913402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NCJ9"
FT                   /protein_id="EDL40486.1"
FT                   /translation="MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYE
FT                   HINEGKLWKHIKHKYENKE"
FT   CDS             complement(join(1639236..1639262,1639430..1639579))
FT                   /codon_start=1
FT                   /gene="1110020P15Rik"
FT                   /locus_tag="mCG_1041147"
FT                   /product="RIKEN cDNA 1110020P15, isoform CRA_a"
FT                   /note="gene_id=mCG1041147.1 transcript_id=mCT158851.1
FT                   protein_id=mCP59495.1 isoform=CRA_a"
FT                   /protein_id="EDL40485.1"
FT                   /translation="MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYE
FT                   HINEGFHIFICES"
FT   gene            1639949..1674539
FT                   /gene="Zmat5"
FT                   /locus_tag="mCG_9614"
FT                   /note="gene_id=mCG9614.2"
FT   mRNA            join(1639949..1639994,1659234..1659387,1665462..1665524,
FT                   1667064..1667144,1668941..1669052,1674203..1674539)
FT                   /gene="Zmat5"
FT                   /locus_tag="mCG_9614"
FT                   /product="zinc finger, matrin type 5, transcript variant
FT                   mCT9969"
FT                   /note="gene_id=mCG9614.2 transcript_id=mCT9969.2 created on
FT                   06-FEB-2003"
FT   mRNA            join(1639954..1639985,1659234..1659387,1665462..1665524,
FT                   1667064..1667144,1668941..1669052,1674203..1674539)
FT                   /gene="Zmat5"
FT                   /locus_tag="mCG_9614"
FT                   /product="zinc finger, matrin type 5, transcript variant
FT                   mCT179893"
FT                   /note="gene_id=mCG9614.2 transcript_id=mCT179893.0 created
FT                   on 06-FEB-2003"
FT   gene            <1640476..1643299
FT                   /locus_tag="mCG_140434"
FT                   /note="gene_id=mCG140434.0"
FT   mRNA            join(<1640476..1640820,1643231..1643299)
FT                   /locus_tag="mCG_140434"
FT                   /product="mCG140434"
FT                   /note="gene_id=mCG140434.0 transcript_id=mCT169520.0
FT                   created on 20-MAY-2002"
FT   CDS             <1640668..1640790
FT                   /codon_start=1
FT                   /locus_tag="mCG_140434"
FT                   /product="mCG140434"
FT                   /note="gene_id=mCG140434.0 transcript_id=mCT169520.0
FT                   protein_id=mCP92125.0"
FT                   /protein_id="EDL40490.1"
FT                   /translation="IPSWVRSHSFPNCTRESLNGFKLECFEVYLHFNVIVLTSC"
FT   assembly_gap    1650191..1650648
FT                   /estimated_length=458
FT                   /gap_type="unknown"
FT   CDS             join(1659261..1659387,1665462..1665524,1667064..1667144,
FT                   1668941..1669052,1674203..1674332)
FT                   /codon_start=1
FT                   /gene="Zmat5"
FT                   /locus_tag="mCG_9614"
FT                   /product="zinc finger, matrin type 5, isoform CRA_a"
FT                   /note="gene_id=mCG9614.2 transcript_id=mCT179893.0
FT                   protein_id=mCP102815.0 isoform=CRA_a"
FT                   /protein_id="EDL40488.1"
FT                   /translation="MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAA
FT                   AILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSEQDLQELSVQVEEERRAREWPLETAE
FT                   LPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPMQELPPSLRAPPPGGWSV
FT                   LSKVQWG"
FT   CDS             join(1659261..1659387,1665462..1665524,1667064..1667144,
FT                   1668941..1669052,1674203..1674332)
FT                   /codon_start=1
FT                   /gene="Zmat5"
FT                   /locus_tag="mCG_9614"
FT                   /product="zinc finger, matrin type 5, isoform CRA_a"
FT                   /note="gene_id=mCG9614.2 transcript_id=mCT9969.2
FT                   protein_id=mCP7881.1 isoform=CRA_a"
FT                   /protein_id="EDL40489.1"
FT                   /translation="MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAA
FT                   AILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSEQDLQELSVQVEEERRAREWPLETAE
FT                   LPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPMQELPPSLRAPPPGGWSV
FT                   LSKVQWG"
FT   gene            complement(<1675692..>1683923)
FT                   /gene="Cabp7"
FT                   /locus_tag="mCG_9611"
FT                   /note="gene_id=mCG9611.2"
FT   mRNA            complement(join(<1675692..1675819,1675995..1676148,
FT                   1676697..1676809,1677512..1677655,1683762..>1683923))
FT                   /gene="Cabp7"
FT                   /locus_tag="mCG_9611"
FT                   /product="calcium binding protein 7"
FT                   /note="gene_id=mCG9611.2 transcript_id=mCT9966.2 created on
FT                   20-MAY-2002"
FT   CDS             complement(join(1675692..1675819,1675995..1676148,
FT                   1676697..1676809,1677512..1677655,1683762..>1683840))
FT                   /codon_start=1
FT                   /gene="Cabp7"
FT                   /locus_tag="mCG_9611"
FT                   /product="calcium binding protein 7"
FT                   /note="gene_id=mCG9611.2 transcript_id=mCT9966.2
FT                   protein_id=mCP7799.2"
FT                   /protein_id="EDL40491.1"
FT                   /translation="CTGASTPCPTCCRSSARWYIPEDELEEIREAFKVFDRDGNGFISK
FT                   QELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGT
FT                   DFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVE
FT                   TCSNQQIRQTCVRKSLICAFAIAFIISVMLIAANQVLRSGMK"
FT   assembly_gap    1676328..1676347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1684048..1684153
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   gene            complement(1702630..1786358)
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /note="gene_id=mCG14695.2"
FT   mRNA            complement(join(1702630..1705061,1718982..1719147,
FT                   1721231..1721358,1724241..1724346,1726452..1726669,
FT                   1727880..1728002,1731201..1731314,1731647..1731721,
FT                   1736674..1736808,1740488..1740563,1743064..1743146,
FT                   1745068..1745136,1752892..1752975,1755315..1755437,
FT                   1757178..1757303,1785679..1786358))
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, transcript variant mCT19734"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT19734.2 created
FT                   on 20-MAY-2002"
FT   mRNA            complement(join(1702672..1705061,1717365..1717409,
FT                   1718982..1719147,1721231..1721358,1724241..1724346,
FT                   1726452..1726669,1727880..1728002,1731201..1731314,
FT                   1731647..1731721,1736674..1736808,1740488..1740563,
FT                   1743064..1743146,1745068..1745136,1752892..1752975,
FT                   1755315..1755437,1757178..1757303,1785679..1786358))
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, transcript variant
FT                   mCT169498"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169498.0 created
FT                   on 20-MAY-2002"
FT   mRNA            complement(join(1702817..1703320,1727938..1728002,
FT                   1731201..1731314,1731647..1731721,1736674..1736808,
FT                   1740488..1740563,1743064..1743146,1745068..1745136,
FT                   1752892..1752975,1755315..1755437,1757178..1757303,
FT                   1785679..1786358))
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, transcript variant
FT                   mCT169495"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169495.0 created
FT                   on 20-MAY-2002"
FT   CDS             complement(join(1703242..1703320,1727938..1728002,
FT                   1731201..1731314,1731647..1731721,1736674..1736808,
FT                   1740488..1740563,1743064..1743146,1745068..1745136,
FT                   1752892..1752975,1755315..1755437,1757178..1757303,
FT                   1785679..1785792))
FT                   /codon_start=1
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, isoform CRA_b"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169495.0
FT                   protein_id=mCP92134.0 isoform=CRA_b"
FT                   /protein_id="EDL40493.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLA
FT                   REKQMREEAERTRDEERGAGGRERESSNGSPECLQPALSL"
FT   mRNA            complement(join(<1703250..1703318,1731201..1731314,
FT                   1731647..1731721,1736674..1736808,1740488..1740563,
FT                   1743064..1743146,1745068..1745136,1752892..1752975,
FT                   1755315..1755437,1757178..1757303,1785679..>1785792))
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, transcript variant
FT                   mCT169496"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169496.0 created
FT                   on 20-MAY-2002"
FT   CDS             complement(join(1703250..1703318,1731201..1731314,
FT                   1731647..1731721,1736674..1736808,1740488..1740563,
FT                   1743064..1743146,1745068..1745136,1752892..1752975,
FT                   1755315..1755437,1757178..1757303,1785679..1785792))
FT                   /codon_start=1
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, isoform CRA_c"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169496.0
FT                   protein_id=mCP92117.0 isoform=CRA_c"
FT                   /protein_id="EDL40494.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQRGGRGGE
FT                   RERARMGPQNVSSLL"
FT   mRNA            complement(join(1705002..1705061,1718966..1719147,
FT                   1721231..1721358,1724241..1724346,1726452..1726669,
FT                   1727880..1728002,1731201..1731314,1731647..1731721,
FT                   1736674..1736808,1740488..1740563,1743064..1743146,
FT                   1745068..1745136,1752892..1752975,1755315..1755437,
FT                   1757178..1757303,1785679..>1785809))
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, transcript variant
FT                   mCT193926"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT193926.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(1705002..1705061,1718982..1719147,
FT                   1721231..1721902))
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, transcript variant
FT                   mCT169494"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169494.0 created
FT                   on 20-MAY-2002"
FT   CDS             complement(join(1705011..1705061,1718982..1719147,
FT                   1721231..1721358,1724241..1724346,1726452..1726669,
FT                   1727880..1728002,1731201..1731314,1731647..1731721,
FT                   1736674..1736808,1740488..1740563,1743064..1743146,
FT                   1745068..1745136,1752892..1752975,1755315..1755437,
FT                   1757178..1757303,1785679..1785792))
FT                   /codon_start=1
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, isoform CRA_f"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT19734.2
FT                   protein_id=mCP7808.2 isoform=CRA_f"
FT                   /protein_id="EDL40498.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLA
FT                   REKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLA
FT                   QKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDL
FT                   QEAREAERRAKQKLLEIATKPTYPPMNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRL
FT                   SMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGGPSSKHN
FT                   TIKKLTLQSAKSRVAFFEEL"
FT   CDS             complement(join(1705011..1705061,1718982..1719147,
FT                   1721231..1721355))
FT                   /codon_start=1
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, isoform CRA_a"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169494.0
FT                   protein_id=mCP92108.0 isoform=CRA_a"
FT                   /protein_id="EDL40492.1"
FT                   /translation="MNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRLSMEIEKEKVEY
FT                   MEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGGPSSKHNTIKKLTLQSAK
FT                   SRVAFFEEL"
FT   mRNA            complement(join(1709122..1709426,1717365..1717409,
FT                   1718982..1719147,1721231..1721358,1724241..1724346,
FT                   1726452..1726669,1727880..1728002,1731201..1731314,
FT                   1731647..1731721,1736674..1736808,1740488..1740563,
FT                   1743064..1743146,1745068..1745136,1752892..1752975,
FT                   1755315..1755437,1757178..1757303,1785679..1786358))
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, transcript variant
FT                   mCT169497"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169497.0 created
FT                   on 20-MAY-2002"
FT   CDS             complement(join(1717374..1717409,1718982..1719147,
FT                   1721231..1721358,1724241..1724346,1726452..1726669,
FT                   1727880..1728002,1731201..1731314,1731647..1731721,
FT                   1736674..1736808,1740488..1740563,1743064..1743146,
FT                   1745068..1745136,1752892..1752975,1755315..1755437,
FT                   1757178..1757303,1785679..1785792))
FT                   /codon_start=1
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, isoform CRA_d"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169497.0
FT                   protein_id=mCP92127.0 isoform=CRA_d"
FT                   /protein_id="EDL40495.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLA
FT                   REKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLA
FT                   QKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDL
FT                   QEAREAERRAKQKLLEIATKPTYPPMNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRL
FT                   SMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGGPSSKHN
FT                   TIKKPQAQGRRPICI"
FT   CDS             complement(join(1717374..1717409,1718982..1719147,
FT                   1721231..1721358,1724241..1724346,1726452..1726669,
FT                   1727880..1728002,1731201..1731314,1731647..1731721,
FT                   1736674..1736808,1740488..1740563,1743064..1743146,
FT                   1745068..1745136,1752892..1752975,1755315..1755437,
FT                   1757178..1757303,1785679..1785792))
FT                   /codon_start=1
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, isoform CRA_d"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT169498.0
FT                   protein_id=mCP92109.0 isoform=CRA_d"
FT                   /protein_id="EDL40496.1"
FT                   /translation="MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKD
FT                   LFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPEN
FT                   AEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFL
FT                   AQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
FT                   TIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKID
FT                   VFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLA
FT                   REKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLA
FT                   QKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDL
FT                   QEAREAERRAKQKLLEIATKPTYPPMNPIPPPLPPDIPSFDIIADSLSFDFKDTDMKRL
FT                   SMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGGPSSKHN
FT                   TIKKPQAQGRRPICI"
FT   CDS             complement(join(1718967..1719147,1721231..1721358,
FT                   1724241..1724346,1726452..1726669,1727880..1728002,
FT                   1731201..1731314,1731647..1731721,1736674..1736808,
FT                   1740488..1740563,1743064..1743146,1745068..1745136,
FT                   1752892..1752975,1755315..1755437,1757178..1757303,
FT                   1785679..>1785807))
FT                   /codon_start=1
FT                   /gene="Nf2"
FT                   /locus_tag="mCG_14695"
FT                   /product="neurofibromatosis 2, isoform CRA_e"
FT                   /note="gene_id=mCG14695.2 transcript_id=mCT193926.0
FT                   protein_id=mCP114917.0 isoform=CRA_e"
FT                   /protein_id="EDL40497.1"
FT                   /translation="PVPRAMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMK
FT                   WKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAK
FT                   FYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVH
FT                   KRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMY
FT                   GVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPL
FT                   DKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQME
FT                   RQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEE
FT                   AKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQ
FT                   LKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPPPLPPDIPSFDIIADSLSFDFKDT
FT                   DMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDVLHSESSDRGGP
FT                   SSKHNTIKKVPEM"
FT   assembly_gap    1795700..1801546
FT                   /estimated_length=5847
FT                   /gap_type="unknown"
FT   assembly_gap    1802915..1802934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1807385..1827430
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /note="gene_id=mCG14685.3"
FT   mRNA            join(1807385..1807537,1816774..1816901,1817132..1817177,
FT                   1817428..1817522,1823166..1823223,1824626..1824709,
FT                   1826343..1827430)
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), transcript
FT                   variant mCT169489"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT169489.1 created
FT                   on 06-FEB-2003"
FT   mRNA            join(1807385..1807537,1816774..1816901,1817132..1817177,
FT                   1817428..1817522,1822116..1822186,1822333..1822473,
FT                   1822769..1822800,1823129..1823223,1824626..1824709,
FT                   1826343..1827423)
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), transcript
FT                   variant mCT19724"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT19724.3 created
FT                   on 06-FEB-2003"
FT   mRNA            join(1807385..1807537,1816774..1816901,1817132..1817177,
FT                   1817428..1817522,1822116..1822186,1822336..1822473,
FT                   1822769..1822800,1823129..1823223,1824626..1824709,
FT                   1826343..1826871)
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), transcript
FT                   variant mCT179864"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT179864.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(1807385..1807537,1816774..1816901,1817132..1817177,
FT                   1817428..1817448,1823154..1823223,1824626..1824709,
FT                   1826343..1826871)
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), transcript
FT                   variant mCT179863"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT179863.0 created
FT                   on 06-FEB-2003"
FT   CDS             join(1807440..1807537,1816774..1816901,1817132..1817177,
FT                   1817428..1817522,1822116..1822186,1822333..1822473,
FT                   1822769..1822800,1823129..1823223,1824626..1824709,
FT                   1826343..1826407)
FT                   /codon_start=1
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), isoform CRA_f"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT19724.3
FT                   protein_id=mCP7856.2 isoform=CRA_f"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="MGI:MGI:1278344"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVF7"
FT                   /protein_id="EDL40504.1"
FT                   /translation="MAPRLCIISAAARRLFTKPRPRAGDLAAAGAVRFYSKDSEGSWFR
FT                   SLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKPECLDAYNSLTEAVLPKLHLDEDY
FT                   PCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRKERSKMLLSRR
FT                   NQLLLEFSFWNEPQPRAGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFF
FT                   SQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKIS
FT                   PLQ"
FT   CDS             join(1807440..1807537,1816774..1816901,1817132..1817177,
FT                   1817428..1817522,1822116..1822186,1822336..1822473,
FT                   1822769..1822800,1823129..1823223,1824626..1824709,
FT                   1826343..1826407)
FT                   /codon_start=1
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), isoform CRA_e"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT179864.0
FT                   protein_id=mCP102785.0 isoform=CRA_e"
FT                   /protein_id="EDL40503.1"
FT                   /translation="MAPRLCIISAAARRLFTKPRPRAGDLAAAGAVRFYSKDSEGSWFR
FT                   SLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKPECLDAYNSLTEAVLPKLHLDEDY
FT                   PCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKYLEFRKERSKMLLSRRN
FT                   QLLLEFSFWNEPQPRAGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFS
FT                   QIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISP
FT                   LQ"
FT   CDS             join(1807440..1807537,1816774..1816901,1817132..1817177,
FT                   1817428..1817522,1823166..1823223,1824626..1824692)
FT                   /codon_start=1
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), isoform CRA_c"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT169489.1
FT                   protein_id=mCP92111.1 isoform=CRA_c"
FT                   /protein_id="EDL40501.1"
FT                   /translation="MAPRLCIISAAARRLFTKPRPRAGDLAAAGAVRFYSKDSEGSWFR
FT                   SLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKPECLDAYNSLTEAVLPKLHLDEDY
FT                   PCSLVGNWNTWYGEQDQAGGGRLLFTNRRALRGTPLMGLQRFAISGGDSKCGLEKEGLG
FT                   "
FT   CDS             join(1807440..1807537,1816774..1816901,1817132..1817177,
FT                   1817428..1817448,1823154..1823193)
FT                   /codon_start=1
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), isoform CRA_d"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT179863.0
FT                   protein_id=mCP102786.0 isoform=CRA_d"
FT                   /protein_id="EDL40502.1"
FT                   /translation="MAPRLCIISAAARRLFTKPRPRAGDLAAAGAVRFYSKDSEGSWFR
FT                   SLFVHKVDPRKDAHSTLLSKKETSNLYKIQFHNVKPECLDAYNSLTEAVLPKLRTRRRW
FT                   EASFHK"
FT   mRNA            join(1816609..1816659,1816774..1816901,1817132..1817177,
FT                   1817428..1817522,1822333..1822473,1822769..1822800,
FT                   1823129..1823223,1824626..1824709,1826343..1827430)
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), transcript
FT                   variant mCT169487"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT169487.0 created
FT                   on 06-FEB-2003"
FT   mRNA            join(1816713..1816901,1817132..1817177,1817428..1817522,
FT                   1822116..1822186,1822333..1822473,1822769..1822800,
FT                   1823129..1823223,1824626..1824709,1826343..1827430)
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), transcript
FT                   variant mCT169488"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT169488.0 created
FT                   on 06-FEB-2003"
FT   CDS             join(1817457..1817522,1822333..1822473,1822769..1822800,
FT                   1823129..1823223,1824626..1824709,1826343..1826407)
FT                   /codon_start=1
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT169487.0
FT                   protein_id=mCP92118.0 isoform=CRA_a"
FT                   /protein_id="EDL40499.1"
FT                   /translation="MRTIPARLWATGTRGTGSRTRQEYLEFRKERSKMLLSRRNQLLLE
FT                   FSFWNEPQPRAGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGEL
FT                   YVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ"
FT   CDS             join(1822154..1822186,1822333..1822473,1822769..1822800,
FT                   1823129..1823223,1824626..1824709,1826343..1826407)
FT                   /codon_start=1
FT                   /gene="Nipsnap1"
FT                   /locus_tag="mCG_14685"
FT                   /product="4-nitrophenylphosphatase domain and non-neuronal
FT                   SNAP25-like protein homolog 1 (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG14685.3 transcript_id=mCT169488.0
FT                   protein_id=mCP92132.0 isoform=CRA_b"
FT                   /protein_id="EDL40500.1"
FT                   /translation="MDCMNKLKNNKEYLEFRKERSKMLLSRRNQLLLEFSFWNEPQPRA
FT                   GPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKD
FT                   LQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKISPLQ"
FT   gene            1828539..1862729
FT                   /gene="Thoc5"
FT                   /locus_tag="mCG_14688"
FT                   /note="gene_id=mCG14688.2"
FT   mRNA            join(1828539..1828585,1832993..1833108,1834354..1834497,
FT                   1835288..1835401,1835537..1835634,1837298..1837444,
FT                   1838840..1838954,1844505..1844637,1846659..1846736,
FT                   1848148..1848188,1848400..1848499,1849367..1849475,
FT                   1852012..1852113,1853601..1853697,1854245..1854359,
FT                   1855790..1855893,1856007..1856094,1858616..1858731,
FT                   1859914..1860104,1862543..1862728)
FT                   /gene="Thoc5"
FT                   /locus_tag="mCG_14688"
FT                   /product="THO complex 5, transcript variant mCT19727"
FT                   /note="gene_id=mCG14688.2 transcript_id=mCT19727.1 created
FT                   on 20-MAY-2002"
FT   mRNA            join(1828548..1828585,1832993..1833108,1834354..1834497,
FT                   1835288..1835401,1835537..1835634,1837298..1837444,
FT                   1838840..1838954,1844505..1844637,1845313..1845348,
FT                   1846659..1846736,1848148..1848188,1848400..1848499,
FT                   1849367..1849475,1852012..1852113,1853601..1853697,
FT                   1854245..1854359,1855790..1855893,1856007..1856094,
FT                   1858616..1858731,1859914..1860104,1862543..1862729)
FT                   /gene="Thoc5"
FT                   /locus_tag="mCG_14688"
FT                   /product="THO complex 5, transcript variant mCT169491"
FT                   /note="gene_id=mCG14688.2 transcript_id=mCT169491.0 created
FT                   on 20-MAY-2002"
FT   CDS             join(1833013..1833108,1834354..1834497,1835288..1835401,
FT                   1835537..1835634,1837298..1837444,1838840..1838954,
FT                   1844505..1844637,1845313..1845348,1846659..1846736,
FT                   1848148..1848188,1848400..1848499,1849367..1849475,
FT                   1852012..1852113,1853601..1853697,1854245..1854359,
FT                   1855790..1855893,1856007..1856094,1858616..1858731,
FT                   1859914..1860104,1862543..1862606)
FT                   /codon_start=1
FT                   /gene="Thoc5"
FT                   /locus_tag="mCG_14688"
FT                   /product="THO complex 5, isoform CRA_b"
FT                   /note="gene_id=mCG14688.2 transcript_id=mCT169491.0
FT                   protein_id=mCP92139.0 isoform=CRA_b"
FT                   /protein_id="EDL40506.1"
FT                   /translation="MSSESSKKRKPKVIRSDGTPTEGKRNRSDTEQEGKYYSEEAEVDL
FT                   RDPGRDYELYKYTCQELQRLMAEIQDLKSKGSKDVAIEIEERRIQSCVHFMTLKKLNRL
FT                   AHIRLKKGRDQTHEAKQKVDAYHLQLQNLLYEVMHLQKEITKCLEFKSKHEEIDLVSLE
FT                   EFYSEAPPSISKAEITMGDPHQQTLARLDWELEQRKRLAEKYRECLSNKEKILKEIEVK
FT                   RDYLSSLQPRLNSIMQASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQA
FT                   CAHMKSSSQPPRQDKTLSVAIEGSVDEAKALFKPPEDSQDDESDSDAEEEQTTKRRRPT
FT                   LGVQLDDKRKEMLKRHPLSVLLDLKCKDNSVLHLTFYYLMNLNIMTVKAKVTTAVELIT
FT                   PISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLRDYVLELGHPYLWVQK
FT                   LGGLHFPKEQPQQTVMPDHSQSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTS
FT                   DCQDLFPAKVVSRLVKWVIITHEDYMELHFTKDIVEAGLAGDTNLYYLALIERGTAKLQ
FT                   AAVVLNPGYSSIPPVFRLCLNWKGEKTNSNDDNIRAMESEVNVCYKELCGPRPSHQLLT
FT                   NQLQRLCVLLDVYLETESHDDSFEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSH
FT                   R"
FT   CDS             join(1833013..1833108,1834354..1834497,1835288..1835401,
FT                   1835537..1835634,1837298..1837444,1838840..1838954,
FT                   1844505..1844637,1846659..1846736,1848148..1848188,
FT                   1848400..1848499,1849367..1849475,1852012..1852113,
FT                   1853601..1853697,1854245..1854359,1855790..1855893,
FT                   1856007..1856094,1858616..1858731,1859914..1860104,
FT                   1862543..1862606)
FT                   /codon_start=1
FT                   /gene="Thoc5"
FT                   /locus_tag="mCG_14688"
FT                   /product="THO complex 5, isoform CRA_a"
FT                   /note="gene_id=mCG14688.2 transcript_id=mCT19727.1
FT                   protein_id=mCP7762.2 isoform=CRA_a"
FT                   /protein_id="EDL40505.1"
FT                   /translation="MSSESSKKRKPKVIRSDGTPTEGKRNRSDTEQEGKYYSEEAEVDL
FT                   RDPGRDYELYKYTCQELQRLMAEIQDLKSKGSKDVAIEIEERRIQSCVHFMTLKKLNRL
FT                   AHIRLKKGRDQTHEAKQKVDAYHLQLQNLLYEVMHLQKEITKCLEFKSKHEEIDLVSLE
FT                   EFYSEAPPSISKAEITMGDPHQQTLARLDWELEQRKRLAEKYRECLSNKEKILKEIEVK
FT                   RDYLSSLQPRLNSIMQASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQA
FT                   CDKTLSVAIEGSVDEAKALFKPPEDSQDDESDSDAEEEQTTKRRRPTLGVQLDDKRKEM
FT                   LKRHPLSVLLDLKCKDNSVLHLTFYYLMNLNIMTVKAKVTTAVELITPISAGDLLSPDS
FT                   VLSCLYPGDHGKKTPNPANQYQFDKVGILTLRDYVLELGHPYLWVQKLGGLHFPKEQPQ
FT                   QTVMPDHSQSASHMETTMKLLKTRVQSRLALHKQFASLEHGIVPVTSDCQDLFPAKVVS
FT                   RLVKWVIITHEDYMELHFTKDIVEAGLAGDTNLYYLALIERGTAKLQAAVVLNPGYSSI
FT                   PPVFRLCLNWKGEKTNSNDDNIRAMESEVNVCYKELCGPRPSHQLLTNQLQRLCVLLDV
FT                   YLETESHDDSFEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR"
FT   assembly_gap    1840461..1840480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1872638..1882010)
FT                   /gene="Nefh"
FT                   /locus_tag="mCG_14692"
FT                   /note="gene_id=mCG14692.2"
FT   mRNA            complement(join(1872638..1875241,1877677..1877801,
FT                   1878937..1879136,1880884..1881354,1881987..1882010))
FT                   /gene="Nefh"
FT                   /locus_tag="mCG_14692"
FT                   /product="neurofilament, heavy polypeptide"
FT                   /note="gene_id=mCG14692.2 transcript_id=mCT19732.2 created
FT                   on 20-MAY-2002"
FT   CDS             complement(join(1873225..1875241,1877677..1877801,
FT                   1878937..1879136,1880884..1881343))
FT                   /codon_start=1
FT                   /gene="Nefh"
FT                   /locus_tag="mCG_14692"
FT                   /product="neurofilament, heavy polypeptide"
FT                   /note="gene_id=mCG14692.2 transcript_id=mCT19732.2
FT                   protein_id=mCP7868.2"
FT                   /protein_id="EDL40507.1"
FT                   /translation="MGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAHVRQRLD
FT                   EEARQREEAEAAARALARFAQEAEAARVELQKKAQALQEECGYLRRHHQEEVGELLGQI
FT                   QGCGAAQAQAQAEARDALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRLSEAA
FT                   KVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKESLERQRSELEDRHQADIASYQDA
FT                   IQQLDSELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPSPFSL
FT                   TEGLPKIPSISTHIKVKSEEMIKVVEKSEKETVIVEGQTEEIRVTEGVTEEEDKEAQGQ
FT                   EGEEAEEGEEKEEEEGAAATSPPAEEAASPEKETKSRVKEEAKSPGEAKSPGEAKSPGE
FT                   AKSPAEAKSPGEAKSPGEAKSPGEAKSPAEPKSPAEPKSPAEAKSPAEPKSPATVKSPG
FT                   EAKSPSEAKSPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPAEAKSPATVKSPGEAKSP
FT                   SEAKSPAEAKSPAEAKSPAEAKSPAEVKSPGEAKSPAEPKSPAEAKSPAAVKSPAEAKS
FT                   PAAVKSPGEAKSPGEAKSPAEAKSPAEAKSPIEVKSPEKAKTPVKEGAKSPAEAKSPEK
FT                   AKSPVKEDIKPPAEAKSPEKAKSPMKEGAKPPEKAKPLDVKSPEAQTPVQEEAKHPTDI
FT                   RPPEQVKSPAKEKAKSPEKEEAKTSEKVAPKKEEVKSPVKEEVKAKEPPKKVEEEKTLP
FT                   TPKTEAKESKKDEAPKEAPKPKVEEKKETPTEKPKDSTAEAKKEEAGEKKKAVASEEET
FT                   PAKLGVKEEAKPKEKTETTKTEAEDTKAKEPSKPTETEKPKKEEMPAAPEKKDTKEEKT
FT                   TESRKPEEKPKMEAKVKEDDKSLSKEPSKPKTEKAEKSSSTDQKESQPPEKTTEDKATK
FT                   GEK"
FT   assembly_gap    1881355..1881570
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    1885123..1885349
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    1887615..1887865
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    1909705..1909774
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1913727..1913875
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1915966..1916233
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   gene            1921099..1976559
FT                   /gene="Ap1b1"
FT                   /locus_tag="mCG_14701"
FT                   /note="gene_id=mCG14701.2"
FT   mRNA            join(1921099..1921243,1943716..1943778,1947068..1947173,
FT                   1949790..1949925,1950790..1951035,1952200..1952390,
FT                   1953465..1953686,1956926..1957046,1958201..1958296,
FT                   1959423..1959538,1960072..1960237,1964789..1964887,
FT                   1965458..1965717,1966246..1966447,1967515..1967670,
FT                   1971460..1971605,1972953..1973082,1973347..1973431,
FT                   1973922..1974008,1974095..1974249,1975546..1976559)
FT                   /gene="Ap1b1"
FT                   /locus_tag="mCG_14701"
FT                   /product="adaptor protein complex AP-1, beta 1 subunit,
FT                   transcript variant mCT19742"
FT                   /note="gene_id=mCG14701.2 transcript_id=mCT19742.2 created
FT                   on 20-MAY-2002"
FT   mRNA            join(1921099..1921243,1943716..1943778,1949790..1949925,
FT                   1950790..1951035,1952200..1952390,1953465..1953686,
FT                   1956926..1957046,1958201..1958296,1959423..1959538,
FT                   1960072..1960237,1964789..1964887,1965458..1965717,
FT                   1966246..1966447,1967515..1967670,1971460..1971605,
FT                   1972953..1973082,1973347..1973431,1973922..1974008,
FT                   1974095..1974249,1975546..1976559)
FT                   /gene="Ap1b1"
FT                   /locus_tag="mCG_14701"
FT                   /product="adaptor protein complex AP-1, beta 1 subunit,
FT                   transcript variant mCT169501"
FT                   /note="gene_id=mCG14701.2 transcript_id=mCT169501.0 created
FT                   on 20-MAY-2002"
FT   CDS             join(1943742..1943778,1947068..1947173,1949790..1949925,
FT                   1950790..1951035,1952200..1952390,1953465..1953686,
FT                   1956926..1957046,1958201..1958296,1959423..1959538,
FT                   1960072..1960237,1964789..1964887,1965458..1965717,
FT                   1966246..1966447,1967515..1967670,1971460..1971605,
FT                   1972953..1973082,1973347..1973431,1973922..1974008,
FT                   1974095..1974249,1975546..1975620)
FT                   /codon_start=1
FT                   /gene="Ap1b1"
FT                   /locus_tag="mCG_14701"
FT                   /product="adaptor protein complex AP-1, beta 1 subunit,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG14701.2 transcript_id=mCT19742.2
FT                   protein_id=mCP7803.1 isoform=CRA_b"
FT                   /db_xref="GOA:O35643"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="MGI:MGI:1096368"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35643"
FT                   /protein_id="EDL40509.1"
FT                   /translation="MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGK
FT                   DVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLD
FT                   TLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFI
FT                   LDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYATLL
FT                   KKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVYHK
FT                   PPNAFVEGGRGVVHKSLPPRTASSESTESPETAPAGAPAGDQPDVIPAQGDLLGDLLNL
FT                   DLGPPVSGPPLAASSVQMGAVDLLGGGLDSLIGDSNFGAPSASVAAAPAPARLGAPISS
FT                   GLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQAGSISMDLQLTNKAL
FT                   QVMTDFAIQFNRNSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLKMEPLNNLQVA
FT                   VKNNIDVFYFSTLYPLHVLFVEDGKMDRQMFLATWKDIANENEAQFQIRDCPLNTEAAS
FT                   NKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAPEVS
FT                   QHVYQAYETILKN"
FT   CDS             join(1949818..1949925,1950790..1951035,1952200..1952390,
FT                   1953465..1953686,1956926..1957046,1958201..1958296,
FT                   1959423..1959538,1960072..1960237,1964789..1964887,
FT                   1965458..1965717,1966246..1966447,1967515..1967670,
FT                   1971460..1971605,1972953..1973082,1973347..1973431,
FT                   1973922..1974008,1974095..1974249,1975546..1975620)
FT                   /codon_start=1
FT                   /gene="Ap1b1"
FT                   /locus_tag="mCG_14701"
FT                   /product="adaptor protein complex AP-1, beta 1 subunit,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14701.2 transcript_id=mCT169501.0
FT                   protein_id=mCP92112.0 isoform=CRA_a"
FT                   /protein_id="EDL40508.1"
FT                   /translation="MQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLI
FT                   RALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGF
FT                   LDTLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQI
FT                   FILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYAT
FT                   LLKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEK
FT                   LDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLD
FT                   LIQTKVNYVVQEAIVVIKDIFRKYPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYA
FT                   ERIDNADELLESFLEGFHDESTQVQLQLLTAIVKLFLKKPTETQELVQQVLSLATQDSD
FT                   NPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLLDELICYIGTLASVY
FT                   HKPPNAFVEGGRGVVHKSLPPRTASSESTESPETAPAGAPAGDQPDVIPAQGDLLGDLL
FT                   NLDLGPPVSGPPLAASSVQMGAVDLLGGGLDSLIGDSNFGAPSASVAAAPAPARLGAPI
FT                   SSGLSDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQAGSISMDLQLTNK
FT                   ALQVMTDFAIQFNRNSFGLAPAAPLQVHVPLSPNQTVEISLPLNTVGSVLKMEPLNNLQ
FT                   VAVKNNIDVFYFSTLYPLHVLFVEDGKMDRQMFLATWKDIANENEAQFQIRDCPLNTEA
FT                   ASNKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLAELRIQPGNPSFTLSLKCRAPE
FT                   VSQHVYQAYETILKN"
FT   assembly_gap    1954714..1954771
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            <1987404..>1988170
FT                   /locus_tag="mCG_1041177"
FT                   /note="gene_id=mCG1041177.1"
FT   mRNA            join(<1987404..1987778,1987850..>1988170)
FT                   /locus_tag="mCG_1041177"
FT                   /product="mCG1041177"
FT                   /note="gene_id=mCG1041177.1 transcript_id=mCT158881.1
FT                   created on 20-MAY-2002"
FT   CDS             <1987867..>1988170
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041177"
FT                   /product="mCG1041177"
FT                   /note="gene_id=mCG1041177.1 transcript_id=mCT158881.1
FT                   protein_id=mCP59282.1"
FT                   /protein_id="EDL40510.1"
FT                   /translation="LTSSWQPLFFYFADKVSPQSKQPSNSWSPRLSLLCGGYRRHCTRL
FT                   MVASWSPRLSLLCGGYRRHCTRLMVASPQPAVWGLQAPLYSPHGRLMVASPQPAVW"
FT   gene            complement(1988681..1998573)
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /note="gene_id=mCG14684.2"
FT   mRNA            complement(join(1988681..1989992,1995425..1995596,
FT                   1995685..1995781,1995864..1995971,1997096..1997748,
FT                   1998107..1998364,1998485..1998573))
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /product="growth arrest-specific 2 like 1, transcript
FT                   variant mCT169486"
FT                   /note="gene_id=mCG14684.2 transcript_id=mCT169486.0 created
FT                   on 20-MAY-2002"
FT   CDS             complement(join(1989968..1989992,1995425..1995596,
FT                   1995685..1995781,1995864..1995971,1997096..1997728))
FT                   /codon_start=1
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /product="growth arrest-specific 2 like 1, isoform CRA_b"
FT                   /note="gene_id=mCG14684.2 transcript_id=mCT169486.0
FT                   protein_id=mCP92140.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D2H3"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003108"
FT                   /db_xref="InterPro:IPR029931"
FT                   /db_xref="MGI:MGI:1926176"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D2H3"
FT                   /protein_id="EDL40514.1"
FT                   /translation="MANPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGL
FT                   PGSGDGFLTGLATGTTLCQHANAVTEAARALAAARPTRGVAFQAHSVAPGSFMARDNVA
FT                   SFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQE
FT                   IERELRATPQVSSVPAAEEDVTEIATVPGVPTRTPRMTPNDLRNLDELVREILGRCTCP
FT                   DQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSSTH
FT                   RLPQQRTGTFSPQRGSPTPSPRPGSPVPGSERRSSRPEVTPISLRGTKEGPETPLRFPG
FT                   FWGL"
FT   gene            1991429..1993647
FT                   /gene="2210403B10Rik"
FT                   /locus_tag="mCG_14686"
FT                   /note="gene_id=mCG14686.2"
FT   mRNA            join(1991429..1991827,1992702..1992826,1993068..1993647)
FT                   /gene="2210403B10Rik"
FT                   /locus_tag="mCG_14686"
FT                   /product="RIKEN cDNA 2210403B10, transcript variant
FT                   mCT19725"
FT                   /note="gene_id=mCG14686.2 transcript_id=mCT19725.2 created
FT                   on 20-MAY-2002"
FT   CDS             join(1991609..1991827,1992702..1992826,1993068..1993335)
FT                   /codon_start=1
FT                   /gene="2210403B10Rik"
FT                   /locus_tag="mCG_14686"
FT                   /product="RIKEN cDNA 2210403B10, isoform CRA_b"
FT                   /note="gene_id=mCG14686.2 transcript_id=mCT19725.2
FT                   protein_id=mCP7759.2 isoform=CRA_b"
FT                   /protein_id="EDL40516.1"
FT                   /translation="MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDSPCLYRPA
FT                   VLLDGAVYDLSIRDGDVAGPGSSPRSLEEWPDPKDWSLQDTDAFVLVYDICSPDSFDYV
FT                   KALRQRIAENRPAGAPEAPILVVGNKRDRQRLRFGPRRALATLVRRGWRCGYLECSAKY
FT                   NWHVLRLFRELLRCALVRTRPAHPTLRLQGALHPARCSLM"
FT   mRNA            join(<1992255..1992537,1992702..1992826,1993068..1993647)
FT                   /gene="2210403B10Rik"
FT                   /locus_tag="mCG_14686"
FT                   /product="RIKEN cDNA 2210403B10, transcript variant
FT                   mCT169490"
FT                   /note="gene_id=mCG14686.2 transcript_id=mCT169490.0 created
FT                   on 20-MAY-2002"
FT   CDS             join(<1992523..1992537,1992702..1992826,1993068..1993335)
FT                   /codon_start=1
FT                   /gene="2210403B10Rik"
FT                   /locus_tag="mCG_14686"
FT                   /product="RIKEN cDNA 2210403B10, isoform CRA_a"
FT                   /note="gene_id=mCG14686.2 transcript_id=mCT169490.0
FT                   protein_id=mCP92130.0 isoform=CRA_a"
FT                   /protein_id="EDL40515.1"
FT                   /translation="GSRSIEWPDPKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAE
FT                   NRPAGAPEAPILVVGNKRDRQRLRFGPRRALATLVRRGWRCGYLECSAKYNWHVLRLFR
FT                   ELLRCALVRTRPAHPTLRLQGALHPARCSLM"
FT   mRNA            complement(join(1993648..1995087,1995425..1995596,
FT                   1995685..1995781,1995864..1995971,1997096..1997748,
FT                   1998107..1998364,1998485..1998573))
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /product="growth arrest-specific 2 like 1, transcript
FT                   variant mCT19723"
FT                   /note="gene_id=mCG14684.2 transcript_id=mCT19723.2 created
FT                   on 20-MAY-2002"
FT   mRNA            complement(join(1993648..1995087,1995425..1995596,
FT                   1995685..1995781,1995864..1995971,1997096..1998364,
FT                   1998485..1998564))
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /product="growth arrest-specific 2 like 1, transcript
FT                   variant mCT169485"
FT                   /note="gene_id=mCG14684.2 transcript_id=mCT169485.0 created
FT                   on 20-MAY-2002"
FT   mRNA            complement(join(1993648..1995087,1995425..1995596,
FT                   1995685..1995781,1995864..1995971,1997096..1997748,
FT                   1998485..1998546))
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /product="growth arrest-specific 2 like 1, transcript
FT                   variant mCT169484"
FT                   /note="gene_id=mCG14684.2 transcript_id=mCT169484.0 created
FT                   on 20-MAY-2002"
FT   CDS             complement(join(1994061..1995087,1995425..1995596,
FT                   1995685..1995781,1995864..1995971,1997096..1997728))
FT                   /codon_start=1
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /product="growth arrest-specific 2 like 1, isoform CRA_a"
FT                   /note="gene_id=mCG14684.2 transcript_id=mCT169484.0
FT                   protein_id=mCP92124.0 isoform=CRA_a"
FT                   /protein_id="EDL40511.1"
FT                   /translation="MANPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGL
FT                   PGSGDGFLTGLATGTTLCQHANAVTEAARALAAARPTRGVAFQAHSVAPGSFMARDNVA
FT                   SFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQE
FT                   IERELRATPQVSSVPAAEEDVTEIATVPGVPTRTPRMTPNDLRNLDELVREILGRCTCP
FT                   DQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSSTH
FT                   RLPQQRTGTFSPQRGSPTPSPRPGSPVPGSERRSSRPEVTPISLRGTKEGPETPLRPRD
FT                   QLPPLPRSRRYSGDSDSSASSAQSGPMGARSDDSATGSRRERPSHRPTSCLPASPRRPT
FT                   APRSQSRDRLDRGRPRVAPGGRGAQLSTSSPARRTRSQSREEQAVLMVRRDRDGQHSWV
FT                   ARGRGGGGSGGSGRSTPQTPRALSPAAPRPSRGPSPGPELAATPASIFRTPLQLDPQQE
FT                   QQLFRRLEEEFLANARALEAAASHTPMGSAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQ
FT                   PGESGRTANGLPGPRSQALSSSSDEGSPYLAVGGALDATRSSLAGPEPSLTWARGRMDT
FT                   QPDRKPSRIPTPRGPRRPSGPIELGAWHAQHSVTPRTEPDSSM"
FT   CDS             complement(join(1994061..1995087,1995425..1995596,
FT                   1995685..1995781,1995864..1995971,1997096..1997728))
FT                   /codon_start=1
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /product="growth arrest-specific 2 like 1, isoform CRA_a"
FT                   /note="gene_id=mCG14684.2 transcript_id=mCT169485.0
FT                   protein_id=mCP92133.0 isoform=CRA_a"
FT                   /protein_id="EDL40512.1"
FT                   /translation="MANPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGL
FT                   PGSGDGFLTGLATGTTLCQHANAVTEAARALAAARPTRGVAFQAHSVAPGSFMARDNVA
FT                   SFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQE
FT                   IERELRATPQVSSVPAAEEDVTEIATVPGVPTRTPRMTPNDLRNLDELVREILGRCTCP
FT                   DQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSSTH
FT                   RLPQQRTGTFSPQRGSPTPSPRPGSPVPGSERRSSRPEVTPISLRGTKEGPETPLRPRD
FT                   QLPPLPRSRRYSGDSDSSASSAQSGPMGARSDDSATGSRRERPSHRPTSCLPASPRRPT
FT                   APRSQSRDRLDRGRPRVAPGGRGAQLSTSSPARRTRSQSREEQAVLMVRRDRDGQHSWV
FT                   ARGRGGGGSGGSGRSTPQTPRALSPAAPRPSRGPSPGPELAATPASIFRTPLQLDPQQE
FT                   QQLFRRLEEEFLANARALEAAASHTPMGSAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQ
FT                   PGESGRTANGLPGPRSQALSSSSDEGSPYLAVGGALDATRSSLAGPEPSLTWARGRMDT
FT                   QPDRKPSRIPTPRGPRRPSGPIELGAWHAQHSVTPRTEPDSSM"
FT   CDS             complement(join(1994061..1995087,1995425..1995596,
FT                   1995685..1995781,1995864..1995971,1997096..1997728))
FT                   /codon_start=1
FT                   /gene="Gas2l1"
FT                   /locus_tag="mCG_14684"
FT                   /product="growth arrest-specific 2 like 1, isoform CRA_a"
FT                   /note="gene_id=mCG14684.2 transcript_id=mCT19723.2
FT                   protein_id=mCP7870.2 isoform=CRA_a"
FT                   /protein_id="EDL40513.1"
FT                   /translation="MANPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLADWLNALYSLGL
FT                   PGSGDGFLTGLATGTTLCQHANAVTEAARALAAARPTRGVAFQAHSVAPGSFMARDNVA
FT                   SFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQE
FT                   IERELRATPQVSSVPAAEEDVTEIATVPGVPTRTPRMTPNDLRNLDELVREILGRCTCP
FT                   DQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSSTH
FT                   RLPQQRTGTFSPQRGSPTPSPRPGSPVPGSERRSSRPEVTPISLRGTKEGPETPLRPRD
FT                   QLPPLPRSRRYSGDSDSSASSAQSGPMGARSDDSATGSRRERPSHRPTSCLPASPRRPT
FT                   APRSQSRDRLDRGRPRVAPGGRGAQLSTSSPARRTRSQSREEQAVLMVRRDRDGQHSWV
FT                   ARGRGGGGSGGSGRSTPQTPRALSPAAPRPSRGPSPGPELAATPASIFRTPLQLDPQQE
FT                   QQLFRRLEEEFLANARALEAAASHTPMGSAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQ
FT                   PGESGRTANGLPGPRSQALSSSSDEGSPYLAVGGALDATRSSLAGPEPSLTWARGRMDT
FT                   QPDRKPSRIPTPRGPRRPSGPIELGAWHAQHSVTPRTEPDSSM"
FT   gene            complement(2002595..2032742)
FT                   /locus_tag="mCG_14699"
FT                   /note="gene_id=mCG14699.3"
FT   mRNA            complement(join(2002595..2003372,2003497..2003749,
FT                   2003895..2003992,2004244..2004406,2004768..2004890,
FT                   2006060..2006189,2011731..2011849,2012178..2012210,
FT                   2012743..2012777,2015511..2015691,2016622..2016833,
FT                   2019365..2019532,2021429..2021615,2025328..2025451,
FT                   2027150..2027201,2027338..2027374,2032485..2032742))
FT                   /locus_tag="mCG_14699"
FT                   /product="mCG14699, transcript variant mCT19738"
FT                   /note="gene_id=mCG14699.3 transcript_id=mCT19738.3 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(2002967..2003372,2003497..2003749,
FT                   2003895..2003992,2004244..2004406,2004768..2004890,
FT                   2006060..2006189,2011731..2011837,2015542..2015691,
FT                   2016622..2016833,2019365..2019532,2021429..2021615,
FT                   2025328..2025451,2027150..2027201,2027338..2027374,
FT                   2032485..>2032544))
FT                   /locus_tag="mCG_14699"
FT                   /product="mCG14699, transcript variant mCT193929"
FT                   /note="gene_id=mCG14699.3 transcript_id=mCT193929.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2003212..2003372,2003497..2003527,
FT                   2016736..2016833,2019365..2019532,2021429..2022115))
FT                   /locus_tag="mCG_14699"
FT                   /product="mCG14699, transcript variant mCT169500"
FT                   /note="gene_id=mCG14699.3 transcript_id=mCT169500.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(2003275..2003372,2003497..2003527,
FT                   2016736..2016833,2019365..2019452))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14699"
FT                   /product="mCG14699, isoform CRA_a"
FT                   /note="gene_id=mCG14699.3 transcript_id=mCT169500.0
FT                   protein_id=mCP92116.0 isoform=CRA_a"
FT                   /protein_id="EDL40517.1"
FT                   /translation="MDRVTTAIPRYLGATQCSQSPHLHLILLPATPLHSRLVTIRAVTL
FT                   SRTPMGSRAAMDNRVAMADVEDLGKWIKASTVRNAETGPTRDLQSCIDDQIYFLNQKMF
FT                   "
FT   CDS             complement(join(2003333..2003372,2003497..2003749,
FT                   2003895..2003992,2004244..2004406,2004768..2004890,
FT                   2006060..2006189,2011731..2011837,2015542..2015691,
FT                   2016622..2016833,2019365..2019532,2021429..2021615,
FT                   2025328..2025451,2027150..2027201,2027338..2027374,
FT                   2032485..>2032521))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14699"
FT                   /product="mCG14699, isoform CRA_b"
FT                   /note="gene_id=mCG14699.3 transcript_id=mCT193929.0
FT                   protein_id=mCP114920.0 isoform=CRA_b"
FT                   /protein_id="EDL40518.1"
FT                   /translation="ENEEEGEKMASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYG
FT                   QQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYSTPTAPQAYSQPVQGYGTG
FT                   TYDSTTATVTTTQASYAAQTAYGTQPAYPTYGQQPTATAPTRPQDGNKPAETSQPQSST
FT                   GGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSSQPTSYDQSSYSQQNTY
FT                   GQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPS
FT                   SMGVYGQESGGFSGPGENRSLSGPDNRGRGRGGFDRGGMSRDPDEDSDNSAIYVQGLND
FT                   NVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEW
FT                   FDGKDFQGSKLKVSLARKKPPMNSMRGGMPPREGRGMPPPLRGGPGGPGGPGGPMGRMG
FT                   GRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPK
FT                   PEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMD
FT                   RGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY"
FT   CDS             complement(join(2003333..2003372,2003497..2003749,
FT                   2003895..2003992,2004244..2004406,2004768..2004890,
FT                   2006060..2006189,2011731..2011849,2012178..2012210,
FT                   2012743..2012777,2015511..2015691,2016622..2016833,
FT                   2019365..2019532,2021429..2021615,2025328..2025451,
FT                   2027150..2027201,2027338..2027374,2032485..2032497))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14699"
FT                   /product="mCG14699, isoform CRA_c"
FT                   /note="gene_id=mCG14699.3 transcript_id=mCT19738.3
FT                   protein_id=mCP7765.3 isoform=CRA_c"
FT                   /db_xref="GOA:Q61545"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR033109"
FT                   /db_xref="MGI:MGI:99960"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61545"
FT                   /protein_id="EDL40519.1"
FT                   /translation="MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYG
FT                   QPTDVSYTQAQTTATYGQTAYATSYGQPPTGYSTPTAPQAYSQPVQGYGTGTYDSTTAT
FT                   VTTTQASYAAQTAYGTQPAYPTYGQQPTATAPTRPQDGNKPAETSQPQSSTGGYNQPSL
FT                   GYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSSQPTSYDQSSYSQQNTYGQPSSYGQ
FT                   QSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQE
FT                   SGGFSGPGENRSLSGPDNRGRGRGGFDRGGMSRGGRGGGRGGLGAGERGGFNKPGGPMD
FT                   EGPDLDLGLPIDPDEDSDNSAIYVQGLNDNVTLDDLADFFKQCGVVKMNKRTGQPMIHI
FT                   YLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGMP
FT                   PREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHR
FT                   AGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGG
FT                   LMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGR
FT                   GGPGKMDKGEHRQERRDRPY"
FT   gene            2031791..2039567
FT                   /gene="Rhbdd3"
FT                   /locus_tag="mCG_14694"
FT                   /note="gene_id=mCG14694.2"
FT   mRNA            join(2031791..2033042,2033224..2033374,2033873..2034063,
FT                   2035345..2035381,2036637..2036825,2037497..2037880,
FT                   2038661..2038823,2038909..2039193,2039276..2039567)
FT                   /gene="Rhbdd3"
FT                   /locus_tag="mCG_14694"
FT                   /product="rhomboid domain containing 3, transcript variant
FT                   mCT19733"
FT                   /note="gene_id=mCG14694.2 transcript_id=mCT19733.2 created
FT                   on 20-MAY-2002"
FT   mRNA            join(2031843..2032281,2032555..2032748,2033224..2033374,
FT                   2033873..2034063,2035345..2035381,2036637..2036825,
FT                   2037497..2038271)
FT                   /gene="Rhbdd3"
FT                   /locus_tag="mCG_14694"
FT                   /product="rhomboid domain containing 3, transcript variant
FT                   mCT169493"
FT                   /note="gene_id=mCG14694.2 transcript_id=mCT169493.0 created
FT                   on 20-MAY-2002"
FT   mRNA            join(<2032914..2033042,2033224..2033374,2033873..2034063,
FT                   2035345..2035381,2036637..2036825,2037497..2037880,
FT                   2038657..2038789,2038909..2039193,2039276..2039567)
FT                   /gene="Rhbdd3"
FT                   /locus_tag="mCG_14694"
FT                   /product="rhomboid domain containing 3, transcript variant
FT                   mCT193922"
FT                   /note="gene_id=mCG14694.2 transcript_id=mCT193922.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2034052..2034063,2035345..2035381,2036637..2036825,
FT                   2037497..2037880,2038657..2038789,2038909..2039193,
FT                   2039276..2039453)
FT                   /codon_start=1
FT                   /gene="Rhbdd3"
FT                   /locus_tag="mCG_14694"
FT                   /product="rhomboid domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG14694.2 transcript_id=mCT193922.0
FT                   protein_id=mCP114916.0 isoform=CRA_b"
FT                   /protein_id="EDL40521.1"
FT                   /translation="PCLQHWEANPGACAWLAYSLRTTFDYHQPNMHAWEAPGSLSRALP
FT                   LASSVLMLLLSCLWLLGAGPSLRLAPELLMEPWQVHRLLTHALGHTALPGLLLSLLLLP
FT                   TLGWWQECHLGTVRFLHNSTVLALATGLLAVLLAGLGVSGAAGGCGYMPVHLAMLAGQS
FT                   HHPGWPQRTLPPWLLPWLLLALTLLLSSEPPFLQLLCGLLTGLACRCCWGLPVAGALRA
FT                   ETAGVTGRCPLQVSGPMLAAEALSHPGQSGPATPRPPYLASSDSWPHSDGSAQLPPRLG
FT                   PGQLTWKNSERGLDWAGSSFASATTMWAALDEQMLQEGIQASLLDVSVQGSQSSLWLPK
FT                   PSVSSLRLQQLQHMGFPTEQAAVALAATGRVEGAVSLLVEGLVDTEALVTEGRSSPAHC
FT                   TGTGAS"
FT   CDS             join(2036678..2036825,2037497..2037880,2038661..2038823,
FT                   2038909..2039193,2039276..2039453)
FT                   /codon_start=1
FT                   /gene="Rhbdd3"
FT                   /locus_tag="mCG_14694"
FT                   /product="rhomboid domain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG14694.2 transcript_id=mCT19733.2
FT                   protein_id=mCP7795.2 isoform=CRA_c"
FT                   /db_xref="GOA:B7ZNJ8"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="MGI:MGI:2444684"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZNJ8"
FT                   /protein_id="EDL40522.1"
FT                   /translation="MHAWEAPGSLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLM
FT                   EPWQVHRLLTHALGHTALPGLLLSLLLLPTLGWWQECHLGTVRFLHNSTVLALATGLLA
FT                   VLLAGLGVSGAAGGCGYMPVHLAMLAGQSHHPGWPQRTLPPWLLPWLLLALTLLLSSEP
FT                   PFLQLLCGLLTGLAYAAGAFQWLELSEQRLQVLQEGVLCKSLARCWPLRLFPTPGSLGE
FT                   LPVTYPAGVRPATPRPPYLASSDSWPHSDGSAQLPPRLGPGQLTWKNSERGLDWAGSSF
FT                   ASATTMWAALDEQMLQEGIQASLLDVSVQGSQSSLWLPKPSVSSLRLQQLQHMGFPTEQ
FT                   AAVALAATGRVEGAVSLLVEGLVDTEALVTEGRSSPAHCTGTGAS"
FT   CDS             join(2036678..2036825,2037497..2037912)
FT                   /codon_start=1
FT                   /gene="Rhbdd3"
FT                   /locus_tag="mCG_14694"
FT                   /product="rhomboid domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG14694.2 transcript_id=mCT169493.0
FT                   protein_id=mCP92120.0 isoform=CRA_a"
FT                   /protein_id="EDL40520.1"
FT                   /translation="MHAWEAPGSLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLM
FT                   EPWQVHRLLTHALGHTALPGLLLSLLLLPTLGWWQECHLGTVRFLHNSTVLALATGLLA
FT                   VLLAGLGVSGAAGGCGYMPVHLAMLAGQSHHPGWPQRTLPPWLLPWLLLALTLLLSSEP
FT                   PFLQLLCGLLTGLACILCLSPEPT"
FT   gene            complement(2039742..>2085854)
FT                   /gene="Emid1"
FT                   /locus_tag="mCG_142504"
FT                   /note="gene_id=mCG142504.0"
FT   mRNA            complement(join(2039742..2040445,2044168..2044252,
FT                   2050458..2050502,2062460..2062504,2062599..2062661,
FT                   2063018..2063070,2063212..2063310,2064222..2064368,
FT                   2065072..2065161,2065510..2065630,2067939..2068000,
FT                   2068944..2069021,2077404..2077507,2077872..2077985,
FT                   2085754..>2085854))
FT                   /gene="Emid1"
FT                   /locus_tag="mCG_142504"
FT                   /product="EMI domain containing 1, transcript variant
FT                   mCT180554"
FT                   /note="gene_id=mCG142504.0 transcript_id=mCT180554.0
FT                   created on 13-FEB-2003"
FT   mRNA            complement(join(2039742..2040445,2044168..2044252,
FT                   2050458..2050502,2062460..2062504,2062599..2062661,
FT                   2063018..2063070,2063212..2063310,2064222..2064368,
FT                   2065072..2065161,2065510..2065630,2067939..2068000,
FT                   2068944..2069021,2077404..2077507,2077872..2077985,
FT                   2083554..2083916))
FT                   /gene="Emid1"
FT                   /locus_tag="mCG_142504"
FT                   /product="EMI domain containing 1, transcript variant
FT                   mCT180556"
FT                   /note="gene_id=mCG142504.0 transcript_id=mCT180556.0
FT                   created on 13-FEB-2003"
FT   mRNA            complement(join(2039888..2040445,2043020..2043110,
FT                   2050458..2050502,2062460..2062504,2062599..2062661,
FT                   2063018..2063070,2063212..2063310,2064222..2064368,
FT                   2065072..2065161,2065510..2065630,2067939..2068000,
FT                   2068944..2069021,2077404..2077507,2077872..2077985,
FT                   2085754..>2085854))
FT                   /gene="Emid1"
FT                   /locus_tag="mCG_142504"
FT                   /product="EMI domain containing 1, transcript variant
FT                   mCT180555"
FT                   /note="gene_id=mCG142504.0 transcript_id=mCT180555.0
FT                   created on 13-FEB-2003"
FT   CDS             complement(join(2040318..2040445,2043020..2043110,
FT                   2050458..2050502,2062460..2062504,2062599..2062661,
FT                   2063018..2063070,2063212..2063310,2064222..2064368,
FT                   2065072..2065161,2065510..2065630,2067939..2068000,
FT                   2068944..2069021,2077404..2077507,2077872..2077985,
FT                   2085754..2085854))
FT                   /codon_start=1
FT                   /gene="Emid1"
FT                   /locus_tag="mCG_142504"
FT                   /product="EMI domain containing 1, isoform CRA_a"
FT                   /note="gene_id=mCG142504.0 transcript_id=mCT180555.0
FT                   protein_id=mCP103477.0 isoform=CRA_a"
FT                   /protein_id="EDL40523.1"
FT                   /translation="MGGPRAWTLLCLGLLLPGGGAAWSVPGARFSGRRNWCSYVVTRTV
FT                   SCHVQNGTYLQRVLQNCPWPMGCPGNSYRTVVRPLYKVTYKTVTAREWRCCPGHSGVTC
FT                   EEGSPGLLEPTWTDSGMRRMAVRPTALSGCLNCSKVSELTERLKALEAKVAVLSVTEQT
FT                   VPSVPATPEDSALLWGSPAARGSPGDGSLQDRLDSWGLPGPTGPKGGTDSQSPVRIRGP
FT                   PGPQGPPGRPGQTGAAGTPGKMGPPGPPGPPGPPGPPAPVGPPYGQVSLHGDPLLSNTF
FT                   TEMGSHWPQGPTGPPGPPGPPGPMGPPGLPGPMGAPGSPGHMGIPGPSGPKGTSGHPGE
FT                   KGERGLPGEPGPQGLMGVPGEPGPKGDPGEKSHWAPSLQSFLQQQAQLELLARRVTLLE
FT                   AIIWPEPDLGSGAGPDGTGTPSLLRGKRGGHPTNYPIITPRRRSERS"
FT   CDS             complement(join(2040318..2040445,2044168..2044252,
FT                   2050458..2050502,2062460..2062504,2062599..2062661,
FT                   2063018..2063070,2063212..2063310,2064222..2064368,
FT                   2065072..2065161,2065510..2065630,2067939..2068000,
FT                   2068944..2069021,2077404..2077507,2077872..2077985,
FT                   2085754..2085854))
FT                   /codon_start=1
FT                   /gene="Emid1"
FT                   /locus_tag="mCG_142504"
FT                   /product="EMI domain containing 1, isoform CRA_c"
FT                   /note="gene_id=mCG142504.0 transcript_id=mCT180554.0
FT                   protein_id=mCP103478.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR011489"
FT                   /db_xref="MGI:MGI:2155091"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUT2"
FT                   /protein_id="EDL40525.1"
FT                   /translation="MGGPRAWTLLCLGLLLPGGGAAWSVPGARFSGRRNWCSYVVTRTV
FT                   SCHVQNGTYLQRVLQNCPWPMGCPGNSYRTVVRPLYKVTYKTVTAREWRCCPGHSGVTC
FT                   EEGSPGLLEPTWTDSGMRRMAVRPTALSGCLNCSKVSELTERLKALEAKVAVLSVTEQT
FT                   VPSVPATPEDSALLWGSPAARGSPGDGSLQDRLDSWGLPGPTGPKGGTDSQSPVRIRGP
FT                   PGPQGPPGRPGQTGAAGTPGKMGPPGPPGPPGPPGPPAPVGPPYGQVSLHGDPLLSNTF
FT                   TEMGSHWPQGPTGPPGPPGPPGPMGPPGLPGPMGAPGSPGHMGIPGPSGPKGTSGHPGE
FT                   KGERGLPGEPGPQGLMGVPGEPGPKGDPGEKSHWGEGLHQLREALKILAERVLILETMI
FT                   GLYEPDLGSGAGPDGTGTPSLLRGKRGGHPTNYPIITPRRRSERS"
FT   CDS             complement(join(2040318..2040445,2044168..2044252,
FT                   2050458..2050502,2062460..2062504,2062599..2062661,
FT                   2063018..2063070,2063212..2063310,2064222..2064368,
FT                   2065072..2065161,2065510..2065630,2067939..2068000,
FT                   2068944..2069021,2077404..2077507,2077872..2077891))
FT                   /codon_start=1
FT                   /gene="Emid1"
FT                   /locus_tag="mCG_142504"
FT                   /product="EMI domain containing 1, isoform CRA_b"
FT                   /note="gene_id=mCG142504.0 transcript_id=mCT180556.0
FT                   protein_id=mCP103476.0 isoform=CRA_b"
FT                   /protein_id="EDL40524.1"
FT                   /translation="MGCPGNSYRTVVRPLYKVTYKTVTAREWRCCPGHSGVTCEEGSPG
FT                   LLEPTWTDSGMRRMAVRPTALSGCLNCSKVSELTERLKALEAKVAVLSVTEQTVPSVPA
FT                   TPEDSALLWGSPAARGSPGDGSLQDRLDSWGLPGPTGPKGGTDSQSPVRIRGPPGPQGP
FT                   PGRPGQTGAAGTPGKMGPPGPPGPPGPPGPPAPVGPPYGQVSLHGDPLLSNTFTEMGSH
FT                   WPQGPTGPPGPPGPPGPMGPPGLPGPMGAPGSPGHMGIPGPSGPKGTSGHPGEKGERGL
FT                   PGEPGPQGLMGVPGEPGPKGDPGEKSHWGEGLHQLREALKILAERVLILETMIGLYEPD
FT                   LGSGAGPDGTGTPSLLRGKRGGHPTNYPIITPRRRSERS"
FT   assembly_gap    2046427..2046799
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    2080584..2080603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2085890..2085909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2102775..2104178
FT                   /estimated_length=1404
FT                   /gap_type="unknown"
FT   gene            complement(2127543..>2197432)
FT                   /gene="Kremen1"
FT                   /locus_tag="mCG_14693"
FT                   /note="gene_id=mCG14693.2"
FT   mRNA            complement(join(2127543..2131107,2134297..2134381,
FT                   2135489..2135698,2137684..2138016,2145917..2146070,
FT                   2151375..2151499,2174383..2174474,2179747..2179909,
FT                   2197409..>2197432))
FT                   /gene="Kremen1"
FT                   /locus_tag="mCG_14693"
FT                   /product="kringle containing transmembrane protein 1"
FT                   /note="gene_id=mCG14693.2 transcript_id=mCT19730.2 created
FT                   on 21-MAY-2002"
FT   CDS             complement(join(2130939..2131107,2134297..2134381,
FT                   2135489..2135698,2137684..2138016,2145917..2146070,
FT                   2151375..2151499,2174383..2174474,2179747..2179909,
FT                   2197409..>2197430))
FT                   /codon_start=1
FT                   /gene="Kremen1"
FT                   /locus_tag="mCG_14693"
FT                   /product="kringle containing transmembrane protein 1"
FT                   /note="gene_id=mCG14693.2 transcript_id=mCT19730.2
FT                   protein_id=mCP7884.1"
FT                   /protein_id="EDL40526.1"
FT                   /translation="PGPRSGPECFTANGADYRGTQSWTALQGGKPCLFWNETFQHPYNT
FT                   LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHG
FT                   NPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKHGEAASTEC
FT                   NSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMAAVVYSPDFPDTYATGRVCYWTIR
FT                   VPGASRIHFNFTLFDIRDSADMVELLDGYTHRVLVRLSGRSRPPLSFNVSLDFVILYFF
FT                   SDRINQAQGFAVLYQATKEEPPQERPAVNQTLAEVITEQANLSVSAAHSSKVLYVITPS
FT                   PSHPPQTAPGSHSWAPSVGANSHRVEGWTVYGLATLLILTVTAVVAKILLHVTFKSHRV
FT                   PASGDLRDCRQPGASGDIWTIFYEPSTTISIFKKKLKGQSQQDDRNPLVSD"
FT   assembly_gap    2153921..2153940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2158802..2158848
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    2197433..2197778
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   gene            complement(<2199865..2274875)
FT                   /locus_tag="mCG_14691"
FT                   /note="gene_id=mCG14691.2"
FT   mRNA            complement(join(<2199865..2199887,2219440..2219542,
FT                   2222196..2222363,2223475..2223585,2225128..2225259,
FT                   2225765..2225839,2274744..2274875))
FT                   /locus_tag="mCG_14691"
FT                   /product="mCG14691, transcript variant mCT169492"
FT                   /note="gene_id=mCG14691.2 transcript_id=mCT169492.0 created
FT                   on 21-MAY-2002"
FT   CDS             complement(join(<2199865..2199887,2219440..2219542,
FT                   2222196..2222363,2223475..2223585,2225128..2225259,
FT                   2225765..2225839,2274744..2274869))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14691"
FT                   /product="mCG14691, isoform CRA_a"
FT                   /note="gene_id=mCG14691.2 transcript_id=mCT169492.0
FT                   protein_id=mCP92123.0 isoform=CRA_a"
FT                   /protein_id="EDL40527.1"
FT                   /translation="MHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKR
FT                   AVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARAR
FT                   IQHLPPRQPTEYFDMGIFLAFFVVVSLVCLILLVKIKLKQRRSQNSMNRLAVQALEKME
FT                   TRKFNSKSKGRREGSCGALDTLSSGSTSDCAICLEKYIDGEELRVIPCTHRFHRKCVDP
FT                   WLLQHHTCPHCRHNIIAVGRSSLL"
FT   mRNA            complement(join(2212426..2213037,2216910..2218607,
FT                   2219440..2219542,2222196..2222363,2223475..2223585,
FT                   2225128..2225259,2225765..2225839,2274744..2274874))
FT                   /locus_tag="mCG_14691"
FT                   /product="mCG14691, transcript variant mCT19731"
FT                   /note="gene_id=mCG14691.2 transcript_id=mCT19731.1 created
FT                   on 21-MAY-2002"
FT   CDS             complement(join(2213006..2213037,2216910..2218607,
FT                   2219440..2219542,2222196..2222363,2223475..2223585,
FT                   2225128..2225259,2225765..2225839,2274744..2274869))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14691"
FT                   /product="mCG14691, isoform CRA_b"
FT                   /note="gene_id=mCG14691.2 transcript_id=mCT19731.1
FT                   protein_id=mCP7839.1 isoform=CRA_b"
FT                   /protein_id="EDL40528.1"
FT                   /translation="MHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKR
FT                   AVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARAR
FT                   IQHLPPRQPTEYFDMGIFLAFFVVVSLVCLILLVKIKLKQRRSQNSMNRLAVQALEKME
FT                   TRKFNSKSKGRREGSCGALDTLSSGSTSDCAICLEKYIDGEELRVIPCTHRFHRKCVDP
FT                   WLLQHHTCPHCRHNIIEQKGNPGAVCVETSNLTRGRQPRVTLPVHYPGRVHRTNAIPAY
FT                   PTRTSMDSHGNPVTLLTMDRHGEQNLYSPQTPTYVRGYPPLHLDHTLAPHRCSLEHRAY
FT                   SPAHPFRRPKFSSRSFSKAACFSQYETMYQHYYFQGLSYPEQEGQTIPSVTPRGQSRAF
FT                   PPSGASSLLFPTMVHVAPPTHVESGSTSSFSCYHGHRSVCSGYLADCPGSDSSSNSSGQ
FT                   CRCSSSDSVVDCTEVSNQGVYGSCSTFRSSLSSDYDPFIYRSRGPAVHLEGSPPPEELP
FT                   AGHSQSAGRGEPWLGPASPSGDQLSTCSLEMNYSSNSSLEPRGPNSSTSEVGLEVSPGA
FT                   ALDLRRTWKGGPEGPSCACCFEPQPFPPGSGIETTAGGSSLFLGPRLLEDCNPPSGEPQ
FT                   LGSSQGLYGLHSDHYPRTDGVKYEGLPCCFYEEKQVAHSAGRGNGCYTEDYSVSVQYTL
FT                   TEEPPPTCYAGPRDLSQRIPIIPEDVDCDLGLPQDCHGMHNHSPWGGALSLDVPRLHWS
FT                   LGTTREEEQAPCYQAEVQPGCSPEEAGASRASLSSAPQDTQESHALAAEASGPDRCIRV
FT                   PL"
FT   assembly_gap    2232569..2232596
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    2235179..2235700
FT                   /estimated_length=522
FT                   /gap_type="unknown"
FT   assembly_gap    2243509..2245620
FT                   /estimated_length=2112
FT                   /gap_type="unknown"
FT   assembly_gap    2260124..2260164
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    2261717..2261736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2263282..2263667
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   assembly_gap    2269499..2269815
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   gene            complement(2294669..3158068)
FT                   /locus_tag="mCG_148406"
FT                   /note="gene_id=mCG148406.0"
FT   mRNA            complement(join(2294669..2297328,3157726..3158068))
FT                   /locus_tag="mCG_148406"
FT                   /product="mCG148406"
FT                   /note="gene_id=mCG148406.0 transcript_id=mCT188669.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2295876..2296124)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148406"
FT                   /product="mCG148406"
FT                   /note="gene_id=mCG148406.0 transcript_id=mCT188669.0
FT                   protein_id=mCP108586.0"
FT                   /protein_id="EDL40529.1"
FT                   /translation="MFGSVYVCTPYLCMVAPPTPNPRGQQRAGTRVRDGYESLRVMEME
FT                   PRSSERAARAVIQCAISPVPTLHFYQPCVKVSNFAIV"
FT   assembly_gap    2319214..2319233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2321008..2321027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2322291..2322310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2331119..2331351
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    2336148..2336392
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    2366470..2366489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2374672..2375505
FT                   /estimated_length=834
FT                   /gap_type="unknown"
FT   assembly_gap    2378026..2378681
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   assembly_gap    2380850..2386372
FT                   /estimated_length=5523
FT                   /gap_type="unknown"
FT   assembly_gap    2387572..2387826
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    2395901..2395920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2409883..2410046
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    2416521..2416564
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            <2427696..2434860
FT                   /locus_tag="mCG_1041180"
FT                   /note="gene_id=mCG1041180.0"
FT   mRNA            join(<2427696..2427837,2431641..2431785,2434641..2434860)
FT                   /locus_tag="mCG_1041180"
FT                   /product="mCG1041180"
FT                   /note="gene_id=mCG1041180.0 transcript_id=mCT158884.0
FT                   created on 21-MAY-2002"
FT   CDS             join(<2427696..2427837,2431641..2431669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041180"
FT                   /product="mCG1041180"
FT                   /note="gene_id=mCG1041180.0 transcript_id=mCT158884.0
FT                   protein_id=mCP59289.0"
FT                   /protein_id="EDL40530.1"
FT                   /translation="GSAPSLEPKAEITGEVLPPSSHRTGPASFHACEACRTLHKSCSCR
FT                   ESETRKQALRD"
FT   assembly_gap    2430286..2430509
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    2432397..2432575
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    2435737..2435756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2439945..2440082
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    2443762..2443935
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   gene            <2450008..2455343
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /note="gene_id=mCG14698.3"
FT   mRNA            join(<2450008..2450567,2451290..2451386,2452708..2452842,
FT                   2453612..2453653,2453681..2453757,2454058..2455243)
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /product="X-box binding protein 1, transcript variant
FT                   mCT193927"
FT                   /note="gene_id=mCG14698.3 transcript_id=mCT193927.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<2450043..2450567,2451290..2451386,2452708..2452842,
FT                   2453681..2453757,2454058..2455247)
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /product="X-box binding protein 1, transcript variant
FT                   mCT193928"
FT                   /note="gene_id=mCG14698.3 transcript_id=mCT193928.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(2450064..2450567,2451290..2451386,2452708..2452842,
FT                   2453612..2453757,2454058..2455343)
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /product="X-box binding protein 1, transcript variant
FT                   mCT19737"
FT                   /note="gene_id=mCG14698.3 transcript_id=mCT19737.2 created
FT                   on 21-MAY-2002"
FT   CDS             join(<2450299..2450567,2451290..2451386,2452708..2452842,
FT                   2453612..2453653,2453681..2453757,2454058..2454277)
FT                   /codon_start=1
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /product="X-box binding protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG14698.3 transcript_id=mCT193927.0
FT                   protein_id=mCP114918.0 isoform=CRA_b"
FT                   /protein_id="EDL40532.1"
FT                   /translation="KGWARQEATGRWRRWRRRFLAMVVVAAAPSAATAAPKVLLLSGQP
FT                   ASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDR
FT                   KKARMSELEQQVVDLEEENHKLQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPE
FT                   VEAKGSGVRLVAGSAESAQVQAQLSPPQNIFPWTLTLLPLQILSLISFWAFWTSWTLSC
FT                   FSNVLPQSLLVWRNSQRSTQKDLVPYQPPFLCQWGPHQPSWKPLMNSFVLTMYTPSL"
FT   CDS             join(<2450299..2450567,2451290..2451386,2452708..2452842,
FT                   2453681..2453757,2454058..2454277)
FT                   /codon_start=1
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /product="X-box binding protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG14698.3 transcript_id=mCT193928.0
FT                   protein_id=mCP114919.0 isoform=CRA_c"
FT                   /protein_id="EDL40533.1"
FT                   /translation="KGWARQEATGRWRRWRRRFLAMVVVAAAPSAATAAPKVLLLSGQP
FT                   ASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDR
FT                   KKARMSELEQQVVDLEEENHKLQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPE
FT                   VEAKQVQAQLSPPQNIFPWTLTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLVWRN
FT                   SQRSTQKDLVPYQPPFLCQWGPHQPSWKPLMNSFVLTMYTPSL"
FT   CDS             join(2450362..2450567,2451290..2451386,2452708..2452842,
FT                   2453612..2453757,2454058..2454277)
FT                   /codon_start=1
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /product="X-box binding protein 1, isoform CRA_d"
FT                   /note="gene_id=mCG14698.3 transcript_id=mCT19737.2
FT                   protein_id=mCP7761.2 isoform=CRA_d"
FT                   /protein_id="EDL40534.1"
FT                   /translation="MVVVAAAPSAATAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEA
FT                   SGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENHK
FT                   LQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPEVEAKGSGVRLVAGSAESAALR
FT                   LCAPLQQVQAQLSPPQNIFPWTLTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLVW
FT                   RNSQRSTQKDLVPYQPPFLCQWGPHQPSWKPLMNSFVLTMYTPSL"
FT   mRNA            join(2451098..2451386,2452708..2452842,2453612..2454004)
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /product="X-box binding protein 1, transcript variant
FT                   mCT169499"
FT                   /note="gene_id=mCG14698.3 transcript_id=mCT169499.0 created
FT                   on 21-MAY-2002"
FT   CDS             join(2451243..2451386,2452708..2452842,2453612..2453761)
FT                   /codon_start=1
FT                   /gene="Xbp1"
FT                   /locus_tag="mCG_14698"
FT                   /product="X-box binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG14698.3 transcript_id=mCT169499.0
FT                   protein_id=mCP92136.0 isoform=CRA_a"
FT                   /protein_id="EDL40531.1"
FT                   /translation="MKAGDDSVMFPVSSPRKLKNRVAAQTARDRKKARMSELEQQVVDL
FT                   EEENHKLQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPEVEAKGSGVRLVAGSA
FT                   ESAALRLCAPLQQVQAQLSPPQNIFPWTLTLLPLQILR"
FT   gene            complement(2457781..2471944)
FT                   /gene="Ccdc117"
FT                   /locus_tag="mCG_14706"
FT                   /note="gene_id=mCG14706.2"
FT   mRNA            complement(join(2457781..2460905,2463615..2463752,
FT                   2464136..2464360,2470748..2470798,2471252..2471944))
FT                   /gene="Ccdc117"
FT                   /locus_tag="mCG_14706"
FT                   /product="coiled-coil domain containing 117"
FT                   /note="gene_id=mCG14706.2 transcript_id=mCT19745.2 created
FT                   on 21-MAY-2002"
FT   CDS             complement(join(2460668..2460905,2463615..2463752,
FT                   2464136..2464360,2470748..2470798,2471252..2471433))
FT                   /codon_start=1
FT                   /gene="Ccdc117"
FT                   /locus_tag="mCG_14706"
FT                   /product="coiled-coil domain containing 117"
FT                   /note="gene_id=mCG14706.2 transcript_id=mCT19745.2
FT                   protein_id=mCP7857.2"
FT                   /protein_id="EDL40535.1"
FT                   /translation="MAALGRPFSGLPLSGSADFLQPPPAFAGRAFPPGAAGHDLAPRPG
FT                   VRGAPSSPGGRTARGRVSIHCRKKHKRLAEDDECPVRKKRLTEAELGAVTDEWALGAHQ
FT                   GREGHGVNTCPSSLSMPSMLDVVCEEMDQTTGEPQCEVARRRLQEIEDRIIDEDEEVES
FT                   DRNVSHLPSLVLSDTMKTGLKREFDEVFTKRMIESMSRPSMELVLWKPLPELLPEKPKP
FT                   SSSPKNYRRESQAKHAAPGTAFPQRTEGLLEPQCADAPLYRSLEAATSTEEEMEL"
FT   gene            complement(2487935..2488280)
FT                   /pseudo
FT                   /locus_tag="mCG_1041181"
FT                   /note="gene_id=mCG1041181.0"
FT   mRNA            complement(2487935..2488280)
FT                   /pseudo
FT                   /locus_tag="mCG_1041181"
FT                   /note="gene_id=mCG1041181.0 transcript_id=mCT158885.1
FT                   created on 21-MAY-2002"
FT   gene            2493686..2508631
FT                   /locus_tag="mCG_14689"
FT                   /note="gene_id=mCG14689.2"
FT   mRNA            join(2493686..2494134,2495062..2495176,2495291..2495464,
FT                   2498232..2498338,2499653..2499790,2502598..2502667,
FT                   2507972..2508631)
FT                   /locus_tag="mCG_14689"
FT                   /product="mCG14689"
FT                   /note="gene_id=mCG14689.2 transcript_id=mCT19728.2 created
FT                   on 21-MAY-2002"
FT   CDS             join(2493932..2494134,2495062..2495176,2495291..2495464,
FT                   2498232..2498338,2499653..2499790,2502598..2502667,
FT                   2507972..2508067)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14689"
FT                   /product="mCG14689"
FT                   /note="gene_id=mCG14689.2 transcript_id=mCT19728.2
FT                   protein_id=mCP7872.1"
FT                   /db_xref="GOA:Q9EQ29"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1923639"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQ29"
FT                   /protein_id="EDL40536.1"
FT                   /translation="MKKIFKGHSPWGFLSFRHAENQEPPRYLTGYMPVKRIHKAASVGD
FT                   IPQVQKMLEFGDIDVNVTDRKKRTALHYACAHGQSEMVSLLLWYDCNIEARDREESTAL
FT                   IKATQRQHEICVKILLENGADSNAVDIHQNTSLHYTVYNKDTTIAAKLLAFNADTEVKT
FT                   KNGYTPLILAVLENKQEMVELLLQAAANINALDNCKRSALIHAVRTQSKNMISLLLQQG
FT                   ANASLVDIYGATAQSYAVFETFQVLSQGPGPRPELTTKEARHSFDTKDGLVPCSPRFKE
FT                   DNKRMEENTDAVDELGRYN"
FT   assembly_gap    2511853..2511872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2512889..2512908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2514829..2514848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2517137..2517156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2556757..2573179
FT                   /locus_tag="mCG_14690"
FT                   /note="gene_id=mCG14690.1"
FT   mRNA            join(2556757..2557435,2558731..2558824,2560165..2560238,
FT                   2563057..2563416,2567128..2567213,2571710..2571880,
FT                   2572936..2573179)
FT                   /locus_tag="mCG_14690"
FT                   /product="mCG14690"
FT                   /note="gene_id=mCG14690.1 transcript_id=mCT19729.1 created
FT                   on 21-MAY-2002"
FT   CDS             join(2556887..2557435,2558731..2558824,2560165..2560238,
FT                   2563057..2563416,2567128..2567213,2571710..2571880,
FT                   2572936..2572978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14690"
FT                   /product="mCG14690"
FT                   /note="gene_id=mCG14690.1 transcript_id=mCT19729.1
FT                   protein_id=mCP7813.2"
FT                   /protein_id="EDL40537.1"
FT                   /translation="MRNKLDCENNASELGESFHKRKEKSSKNIESRKVKGKCPEVRMGE
FT                   KQEGHEFKSQSQKTMKPKRTDWQLDIRHMLKSSDANRLSNAKERSHVTEVKSWGDSALA
FT                   SDMYRKSKGTQDLFLKPLPCKGNFEAPARTLGTASDAPPGGPTTRAFADEELRGRLSDS
FT                   EFRILEEEILAWEKVHLESESVSENLLNKCEGIISDATDQQGRYLDMEQATAEVDSEGT
FT                   SQLEQKNLDSSENTQPSNPDLSKTCPQAQSAPADPTTLIQPLPEEESKQTHPPSLRLKK
FT                   MSEDLEINTKDDKECAPGHPEVPSVKAYGRESLTGDTRGQNRESKQSCPELQHTAADGL
FT                   ESICPVEDPLPGGCRSHFKVEEVSRKQQRMDLEVSELSPADEKDEPARSVPDSCIKDAK
FT                   GSEKEAWSPREPVVTPEFEKSPPAGADLLLLKDGHLLTKMDRVEGRSEADPGEAGLQAE
FT                   "
FT   gene            <2562089..2562792
FT                   /locus_tag="mCG_14687"
FT                   /note="gene_id=mCG14687.2"
FT   mRNA            <2562089..2562792
FT                   /locus_tag="mCG_14687"
FT                   /product="mCG14687"
FT                   /note="gene_id=mCG14687.2 transcript_id=mCT19726.2 created
FT                   on 21-MAY-2002"
FT   CDS             <2562117..2562611
FT                   /codon_start=1
FT                   /locus_tag="mCG_14687"
FT                   /product="mCG14687"
FT                   /note="gene_id=mCG14687.2 transcript_id=mCT19726.2
FT                   protein_id=mCP7871.0"
FT                   /protein_id="EDL40538.1"
FT                   /translation="VLSSCQSCQTDRCPCRAMAESDWDTVTVLCKKGPTAAQAKSKQAI
FT                   LAAQRREDVETSKKWAAGQNKQHSITKNTAKLDWETEELHHDRVALEVGKVIQRGRQSK
FT                   GLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKTERAIGLKLRGKDVGKPIEKGPKA
FT                   E"
FT   assembly_gap    2616363..2616562
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    2625885..2625904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2630871..2642562)
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /note="gene_id=mCG14705.2"
FT   mRNA            complement(join(2630871..2631620,2634185..2634296,
FT                   2634374..2634442,2634511..2634574))
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /product="mitochondrial ribosomal protein S24, transcript
FT                   variant mCT19743"
FT                   /note="gene_id=mCG14705.2 transcript_id=mCT19743.1 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(2630871..2631620,2634185..2634442,
FT                   2634511..2634574))
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /product="mitochondrial ribosomal protein S24, transcript
FT                   variant mCT169509"
FT                   /note="gene_id=mCG14705.2 transcript_id=mCT169509.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(2630871..2631620,2634185..2634296,
FT                   2634374..2634442,2634532..2634568))
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /product="mitochondrial ribosomal protein S24, transcript
FT                   variant mCT169508"
FT                   /note="gene_id=mCG14705.2 transcript_id=mCT169508.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(2631212..2631620,2634185..2634296,
FT                   2634374..2634442,2639374..2639470,2642329..2642562))
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /product="mitochondrial ribosomal protein S24, transcript
FT                   variant mCT178270"
FT                   /note="gene_id=mCG14705.2 transcript_id=mCT178270.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(2631337..2631620,2634185..2634296,
FT                   2634374..2634442,2634532..2634549))
FT                   /codon_start=1
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /product="mitochondrial ribosomal protein S24, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG14705.2 transcript_id=mCT169508.0
FT                   protein_id=mCP92113.0 isoform=CRA_a"
FT                   /protein_id="EDL40539.1"
FT                   /translation="MAWSASVLACSRELPGAWRTLHTSAVCAKNRAARVRVAKGNKPVS
FT                   YEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTLEDVFLRKFMMGTFPGCLADQIVLK
FT                   RRANQVDICALVLRQLPAHKFYFLVGYSETLLSHFYKCPVRLHLQTVPSKVVYKYI"
FT   CDS             complement(join(2631337..2631620,2634185..2634296,
FT                   2634374..2634442,2634511..2634549))
FT                   /codon_start=1
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /product="mitochondrial ribosomal protein S24, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG14705.2 transcript_id=mCT19743.1
FT                   protein_id=mCP7841.2 isoform=CRA_d"
FT                   /protein_id="EDL40542.1"
FT                   /translation="MAWSASVRGLGQRVLACSRELPGAWRTLHTSAVCAKNRAARVRVA
FT                   KGNKPVSYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTLEDVFLRKFMMGTFPGCL
FT                   ADQIVLKRRANQVDICALVLRQLPAHKFYFLVGYSETLLSHFYKCPVRLHLQTVPSKVV
FT                   YKYI"
FT   CDS             complement(2631337..2631555)
FT                   /codon_start=1
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /product="mitochondrial ribosomal protein S24, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG14705.2 transcript_id=mCT178270.0
FT                   protein_id=mCP101192.0 isoform=CRA_c"
FT                   /protein_id="EDL40541.1"
FT                   /translation="MMGTFPGCLADQIVLKRRANQVDICALVLRQLPAHKFYFLVGYSE
FT                   TLLSHFYKCPVRLHLQTVPSKVVYKYI"
FT   CDS             complement(join(2634251..2634442,2634511..2634549))
FT                   /codon_start=1
FT                   /gene="Mrps24"
FT                   /locus_tag="mCG_14705"
FT                   /product="mitochondrial ribosomal protein S24, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG14705.2 transcript_id=mCT169509.0
FT                   protein_id=mCP92121.0 isoform=CRA_b"
FT                   /protein_id="EDL40540.1"
FT                   /translation="MAWSASVRGLGQRVLACSRELPGAWRTLHTSAVCAKVSAAAGSGG
FT                   REGGWAGSPRDRTFAPRIGRRESAWPRGTSR"
FT   assembly_gap    2634577..2634661
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            complement(2640300..2689149)
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /note="gene_id=mCG53703.3"
FT   mRNA            complement(join(2640300..2645137,2649683..2649721,
FT                   2649992..2650042,2653239..2653309,2653726..2653752,
FT                   2668090..2668137))
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, transcript variant
FT                   mCT53886"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT53886.2 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(2641845..2645137,2649683..2649721,
FT                   2649992..2650042,2653239..2653309,2653726..2653752,
FT                   2688648..2689143))
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, transcript variant
FT                   mCT169522"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT169522.1 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(2641845..2645137,2649683..2649721,
FT                   2649992..2650042,2668090..2668118))
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, transcript variant
FT                   mCT180592"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT180592.0 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(2641859..2645137,2649683..2649721,
FT                   2649992..2650042,2653726..2653752,2688648..>2688856))
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, transcript variant
FT                   mCT193923"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT193923.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(2641860..2645137,2649683..2649721,
FT                   2649992..2650042,2653239..2653309,2653726..2653752,
FT                   2658921..2659167,2688648..2689149))
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, transcript variant
FT                   mCT180593"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT180593.0 created
FT                   on 10-FEB-2003"
FT   mRNA            complement(join(2641860..2645137,2649683..2649721,
FT                   2649992..2650042,2653726..2653752,2668090..2668141))
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, transcript variant
FT                   mCT180594"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT180594.0 created
FT                   on 10-FEB-2003"
FT   CDS             complement(join(2642559..2645137,2649683..2649721,
FT                   2649992..2650042,2653239..2653309,2653726..2653752,
FT                   2668090..2668103))
FT                   /codon_start=1
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, isoform CRA_c"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT53886.2
FT                   protein_id=mCP30238.2 isoform=CRA_c"
FT                   /protein_id="EDL40548.1"
FT                   /translation="MASPGIEVELLVKGHSDLGEVAPEVKPSDSQTSVAIADLEWREME
FT                   GDDCGFHYGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQKLTLQDSLQISFDSMK
FT                   NWAPQVPKDLPWHFLRKLQALNAEARNTTMVLDVPPEAWPAEKESQAEEEMMYWDPAED
FT                   VAADIYSFSELPMPDTPVNPLDLLCALLLSSDTFLQQEVLLKMSLCQFALPLVLPDSEN
FT                   HYHTFLLWALRGVVRTWWFQPLRSLGSFREDSVVLSRVPTFAFVRMDVSSNSKSQLLNA
FT                   VLSPARRQWDCFWHRDLNLGTNPREISDGLVEISWFFPSGKEDLDVFPEPMAFLNLRGD
FT                   IGSHWLQFKLLTEVSSAVFILTDNISKKEYKLLYSMKESTTKYYFILSPYRGKRNTNLR
FT                   FLNRLIPVLKIDHSHVLVKVSSTDSEGFVRRIRAIMCSVARSPCRRVSVEDMAHAARKL
FT                   GLRVDEDFEECQKAKDRMEKILRKIKDVDAYKRDELRLQGEPARRAAQAEREFCQLQWV
FT                   PEPPEKHRAELRRRVLELRVQQNGQEPTSGVQEFILGISSPSPSERQYFLRWMEWGLAR
FT                   LGQPRPRQPPETLLTLRPKLGGPSDLTEPLWPEPLGVEHFLREMGQFYEAESCLIEAGR
FT                   LPAGQRRFAHFPGVAVELLLGGLPLELVDGATLSIPVRWVTGLLKELHTRLDRRSRLVV
FT                   LSALGVPGTGKSTLLNTMFGLKFATGRSCSPRGAFMQLLPVAEGFSQDLGCDQILVIDS
FT                   GGLISGALASAGDRFELEASLATLLMGLSNVTVVSLAETKDIPPAVLHAFLRLEKMGHM
FT                   PNYQFVYQNLHDLPVPSPKPRDRRQLLDPPSDLSRATHLEKQGGGFRTLAGLAERQHVW
FT                   HIPALWHGAPPMAAVSLGYSEAIFELKRCLLENIRNGLSNQNQNIQQLIELLRRL"
FT   CDS             complement(join(2642559..2645137,2649683..2649721,
FT                   2649992..2650042,2653726..>2653747))
FT                   /codon_start=1
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, isoform CRA_b"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT193923.0
FT                   protein_id=mCP114907.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q6ZPP3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030383"
FT                   /db_xref="MGI:MGI:1919296"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZPP3"
FT                   /protein_id="EDL40547.1"
FT                   /translation="KWNYWSKDLEWREMEGDDCGFHYGDGTNEAQDNDFPTVERSRLQE
FT                   MLSLLGLETYQAQKLTLQDSLQISFDSMKNWAPQVPKDLPWHFLRKLQALNAEARNTTM
FT                   VLDVPPEAWPAEKESQAEEEMMYWDPAEDVAADIYSFSELPMPDTPVNPLDLLCALLLS
FT                   SDTFLQQEVLLKMSLCQFALPLVLPDSENHYHTFLLWALRGVVRTWWFQPLRSLGSFRE
FT                   DSVVLSRVPTFAFVRMDVSSNSKSQLLNAVLSPARRQWDCFWHRDLNLGTNPREISDGL
FT                   VEISWFFPSGKEDLDVFPEPMAFLNLRGDIGSHWLQFKLLTEVSSAVFILTDNISKKEY
FT                   KLLYSMKESTTKYYFILSPYRGKRNTNLRFLNRLIPVLKIDHSHVLVKVSSTDSEGFVR
FT                   RIRAIMCSVARSPCRRVSVEDMAHAARKLGLRVDEDFEECQKAKDRMEKILRKIKDVDA
FT                   YKRDELRLQGEPARRAAQAEREFCQLQWVPEPPEKHRAELRRRVLELRVQQNGQEPTSG
FT                   VQEFILGISSPSPSERQYFLRWMEWGLARLGQPRPRQPPETLLTLRPKLGGPSDLTEPL
FT                   WPEPLGVEHFLREMGQFYEAESCLIEAGRLPAGQRRFAHFPGVAVELLLGGLPLELVDG
FT                   ATLSIPVRWVTGLLKELHTRLDRRSRLVVLSALGVPGTGKSTLLNTMFGLKFATGRSCS
FT                   PRGAFMQLLPVAEGFSQDLGCDQILVIDSGGLISGALASAGDRFELEASLATLLMGLSN
FT                   VTVVSLAETKDIPPAVLHAFLRLEKMGHMPNYQFVYQNLHDLPVPSPKPRDRRQLLDPP
FT                   SDLSRATHLEKQGGGFRTLAGLAERQHVWHIPALWHGAPPMAAVSLGYSEAIFELKRCL
FT                   LENIRNGLSNQNQNIQQLIELLRRL"
FT   CDS             complement(join(2642559..2645137,2649683..2649721,
FT                   2649992..2650025))
FT                   /codon_start=1
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, isoform CRA_a"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT169522.1
FT                   protein_id=mCP92138.1 isoform=CRA_a"
FT                   /protein_id="EDL40543.1"
FT                   /translation="MEGDDCGFHYGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQ
FT                   KLTLQDSLQISFDSMKNWAPQVPKDLPWHFLRKLQALNAEARNTTMVLDVPPEAWPAEK
FT                   ESQAEEEMMYWDPAEDVAADIYSFSELPMPDTPVNPLDLLCALLLSSDTFLQQEVLLKM
FT                   SLCQFALPLVLPDSENHYHTFLLWALRGVVRTWWFQPLRSLGSFREDSVVLSRVPTFAF
FT                   VRMDVSSNSKSQLLNAVLSPARRQWDCFWHRDLNLGTNPREISDGLVEISWFFPSGKED
FT                   LDVFPEPMAFLNLRGDIGSHWLQFKLLTEVSSAVFILTDNISKKEYKLLYSMKESTTKY
FT                   YFILSPYRGKRNTNLRFLNRLIPVLKIDHSHVLVKVSSTDSEGFVRRIRAIMCSVARSP
FT                   CRRVSVEDMAHAARKLGLRVDEDFEECQKAKDRMEKILRKIKDVDAYKRDELRLQGEPA
FT                   RRAAQAEREFCQLQWVPEPPEKHRAELRRRVLELRVQQNGQEPTSGVQEFILGISSPSP
FT                   SERQYFLRWMEWGLARLGQPRPRQPPETLLTLRPKLGGPSDLTEPLWPEPLGVEHFLRE
FT                   MGQFYEAESCLIEAGRLPAGQRRFAHFPGVAVELLLGGLPLELVDGATLSIPVRWVTGL
FT                   LKELHTRLDRRSRLVVLSALGVPGTGKSTLLNTMFGLKFATGRSCSPRGAFMQLLPVAE
FT                   GFSQDLGCDQILVIDSGGLISGALASAGDRFELEASLATLLMGLSNVTVVSLAETKDIP
FT                   PAVLHAFLRLEKMGHMPNYQFVYQNLHDLPVPSPKPRDRRQLLDPPSDLSRATHLEKQG
FT                   GGFRTLAGLAERQHVWHIPALWHGAPPMAAVSLGYSEAIFELKRCLLENIRNGLSNQNQ
FT                   NIQQLIELLRRL"
FT   CDS             complement(join(2642559..2645137,2649683..2649721,
FT                   2649992..2650025))
FT                   /codon_start=1
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, isoform CRA_a"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT180592.0
FT                   protein_id=mCP103514.0 isoform=CRA_a"
FT                   /protein_id="EDL40544.1"
FT                   /translation="MEGDDCGFHYGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQ
FT                   KLTLQDSLQISFDSMKNWAPQVPKDLPWHFLRKLQALNAEARNTTMVLDVPPEAWPAEK
FT                   ESQAEEEMMYWDPAEDVAADIYSFSELPMPDTPVNPLDLLCALLLSSDTFLQQEVLLKM
FT                   SLCQFALPLVLPDSENHYHTFLLWALRGVVRTWWFQPLRSLGSFREDSVVLSRVPTFAF
FT                   VRMDVSSNSKSQLLNAVLSPARRQWDCFWHRDLNLGTNPREISDGLVEISWFFPSGKED
FT                   LDVFPEPMAFLNLRGDIGSHWLQFKLLTEVSSAVFILTDNISKKEYKLLYSMKESTTKY
FT                   YFILSPYRGKRNTNLRFLNRLIPVLKIDHSHVLVKVSSTDSEGFVRRIRAIMCSVARSP
FT                   CRRVSVEDMAHAARKLGLRVDEDFEECQKAKDRMEKILRKIKDVDAYKRDELRLQGEPA
FT                   RRAAQAEREFCQLQWVPEPPEKHRAELRRRVLELRVQQNGQEPTSGVQEFILGISSPSP
FT                   SERQYFLRWMEWGLARLGQPRPRQPPETLLTLRPKLGGPSDLTEPLWPEPLGVEHFLRE
FT                   MGQFYEAESCLIEAGRLPAGQRRFAHFPGVAVELLLGGLPLELVDGATLSIPVRWVTGL
FT                   LKELHTRLDRRSRLVVLSALGVPGTGKSTLLNTMFGLKFATGRSCSPRGAFMQLLPVAE
FT                   GFSQDLGCDQILVIDSGGLISGALASAGDRFELEASLATLLMGLSNVTVVSLAETKDIP
FT                   PAVLHAFLRLEKMGHMPNYQFVYQNLHDLPVPSPKPRDRRQLLDPPSDLSRATHLEKQG
FT                   GGFRTLAGLAERQHVWHIPALWHGAPPMAAVSLGYSEAIFELKRCLLENIRNGLSNQNQ
FT                   NIQQLIELLRRL"
FT   CDS             complement(join(2642559..2645137,2649683..2649721,
FT                   2649992..2650025))
FT                   /codon_start=1
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, isoform CRA_a"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT180593.0
FT                   protein_id=mCP103516.0 isoform=CRA_a"
FT                   /protein_id="EDL40545.1"
FT                   /translation="MEGDDCGFHYGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQ
FT                   KLTLQDSLQISFDSMKNWAPQVPKDLPWHFLRKLQALNAEARNTTMVLDVPPEAWPAEK
FT                   ESQAEEEMMYWDPAEDVAADIYSFSELPMPDTPVNPLDLLCALLLSSDTFLQQEVLLKM
FT                   SLCQFALPLVLPDSENHYHTFLLWALRGVVRTWWFQPLRSLGSFREDSVVLSRVPTFAF
FT                   VRMDVSSNSKSQLLNAVLSPARRQWDCFWHRDLNLGTNPREISDGLVEISWFFPSGKED
FT                   LDVFPEPMAFLNLRGDIGSHWLQFKLLTEVSSAVFILTDNISKKEYKLLYSMKESTTKY
FT                   YFILSPYRGKRNTNLRFLNRLIPVLKIDHSHVLVKVSSTDSEGFVRRIRAIMCSVARSP
FT                   CRRVSVEDMAHAARKLGLRVDEDFEECQKAKDRMEKILRKIKDVDAYKRDELRLQGEPA
FT                   RRAAQAEREFCQLQWVPEPPEKHRAELRRRVLELRVQQNGQEPTSGVQEFILGISSPSP
FT                   SERQYFLRWMEWGLARLGQPRPRQPPETLLTLRPKLGGPSDLTEPLWPEPLGVEHFLRE
FT                   MGQFYEAESCLIEAGRLPAGQRRFAHFPGVAVELLLGGLPLELVDGATLSIPVRWVTGL
FT                   LKELHTRLDRRSRLVVLSALGVPGTGKSTLLNTMFGLKFATGRSCSPRGAFMQLLPVAE
FT                   GFSQDLGCDQILVIDSGGLISGALASAGDRFELEASLATLLMGLSNVTVVSLAETKDIP
FT                   PAVLHAFLRLEKMGHMPNYQFVYQNLHDLPVPSPKPRDRRQLLDPPSDLSRATHLEKQG
FT                   GGFRTLAGLAERQHVWHIPALWHGAPPMAAVSLGYSEAIFELKRCLLENIRNGLSNQNQ
FT                   NIQQLIELLRRL"
FT   CDS             complement(join(2642559..2645137,2649683..2649721,
FT                   2649992..2650025))
FT                   /codon_start=1
FT                   /gene="2010005J08Rik"
FT                   /locus_tag="mCG_53703"
FT                   /product="RIKEN cDNA 2010005J08, isoform CRA_a"
FT                   /note="gene_id=mCG53703.3 transcript_id=mCT180594.0
FT                   protein_id=mCP103515.0 isoform=CRA_a"
FT                   /protein_id="EDL40546.1"
FT                   /translation="MEGDDCGFHYGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQ
FT                   KLTLQDSLQISFDSMKNWAPQVPKDLPWHFLRKLQALNAEARNTTMVLDVPPEAWPAEK
FT                   ESQAEEEMMYWDPAEDVAADIYSFSELPMPDTPVNPLDLLCALLLSSDTFLQQEVLLKM
FT                   SLCQFALPLVLPDSENHYHTFLLWALRGVVRTWWFQPLRSLGSFREDSVVLSRVPTFAF
FT                   VRMDVSSNSKSQLLNAVLSPARRQWDCFWHRDLNLGTNPREISDGLVEISWFFPSGKED
FT                   LDVFPEPMAFLNLRGDIGSHWLQFKLLTEVSSAVFILTDNISKKEYKLLYSMKESTTKY
FT                   YFILSPYRGKRNTNLRFLNRLIPVLKIDHSHVLVKVSSTDSEGFVRRIRAIMCSVARSP
FT                   CRRVSVEDMAHAARKLGLRVDEDFEECQKAKDRMEKILRKIKDVDAYKRDELRLQGEPA
FT                   RRAAQAEREFCQLQWVPEPPEKHRAELRRRVLELRVQQNGQEPTSGVQEFILGISSPSP
FT                   SERQYFLRWMEWGLARLGQPRPRQPPETLLTLRPKLGGPSDLTEPLWPEPLGVEHFLRE
FT                   MGQFYEAESCLIEAGRLPAGQRRFAHFPGVAVELLLGGLPLELVDGATLSIPVRWVTGL
FT                   LKELHTRLDRRSRLVVLSALGVPGTGKSTLLNTMFGLKFATGRSCSPRGAFMQLLPVAE
FT                   GFSQDLGCDQILVIDSGGLISGALASAGDRFELEASLATLLMGLSNVTVVSLAETKDIP
FT                   PAVLHAFLRLEKMGHMPNYQFVYQNLHDLPVPSPKPRDRRQLLDPPSDLSRATHLEKQG
FT                   GGFRTLAGLAERQHVWHIPALWHGAPPMAAVSLGYSEAIFELKRCLLENIRNGLSNQNQ
FT                   NIQQLIELLRRL"
FT   gene            <2688893..2711441
FT                   /locus_tag="mCG_14703"
FT                   /note="gene_id=mCG14703.1"
FT   mRNA            join(<2688893..2689007,2692276..2692338,2706887..2706992,
FT                   2710623..2711441)
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, transcript variant mCT19740"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT19740.2 created
FT                   on 27-FEB-2003"
FT   mRNA            join(<2688894..2689007,2692276..2692338,2695820..2695851,
FT                   2695946..2696022,2706887..2706992,2708916..2709088,
FT                   2710623..2711441)
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, transcript variant mCT169506"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT169506.0 created
FT                   on 27-FEB-2003"
FT   mRNA            join(<2688917..2689007,2692276..2692338,2695653..2695851,
FT                   2695946..2696022,2706887..2707316,2708916..2709088,
FT                   2710623..2711441)
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, transcript variant mCT169504"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT169504.0 created
FT                   on 27-FEB-2003"
FT   mRNA            join(<2688917..2689007,2706887..2707334,2708916..2709088,
FT                   2710623..2711031)
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, transcript variant mCT169507"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT169507.0 created
FT                   on 27-FEB-2003"
FT   mRNA            join(2688922..2689007,2692276..2692338,2706887..2707646,
FT                   2707692..2707768)
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, transcript variant mCT169505"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT169505.0 created
FT                   on 27-FEB-2003"
FT   CDS             join(2688984..2689007,2692276..2692338,2706887..2707015)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, isoform CRA_e"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT169505.0
FT                   protein_id=mCP92107.0 isoform=CRA_e"
FT                   /protein_id="EDL40553.1"
FT                   /translation="MALKRIQKELTDYRGIPLLSVLRDLWVMTVAFTTRIYHPNINSNG
FT                   SICLDILRSQWSPALTVSKGRDTGMD"
FT   CDS             join(<2692287..2692338,2695820..2695851,2695946..2696022,
FT                   2706887..2706956)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, isoform CRA_b"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT169506.0
FT                   protein_id=mCP92110.0 isoform=CRA_b"
FT                   /protein_id="EDL40550.1"
FT                   /translation="LQRDPPAQCSAGPVGDDLSHWQAAIMRPNDSPYQGGVFSRPSTSL
FT                   QIILSSPQRLLSLPESITLISTAMAAFAWTS"
FT   CDS             join(<2692287..2692338,2695653..2695851,2695946..2696022,
FT                   2706887..2706918)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, isoform CRA_a"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT169504.0
FT                   protein_id=mCP92126.0 isoform=CRA_a"
FT                   /protein_id="EDL40549.1"
FT                   /translation="LQRDPPAQCSAGPVGDDSASKEPWSPSECFSKPHTCSRCQKQGSL
FT                   VWSLAAPFQENRHLPRGALHACLSFVLECPTGRPPSCARMTVLTKEGFFPDHPLPYRLS
FT                   FQAPKGCFHYQNLSP"
FT   assembly_gap    2698388..2698407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<2707205..2707334,2708916..2709025)
FT                   /codon_start=1
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, isoform CRA_c"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT169507.0
FT                   protein_id=mCP92122.0 isoform=CRA_c"
FT                   /protein_id="EDL40551.1"
FT                   /translation="CSELSPGYKKIASTLLAFSPKSRKANMKLFFICRPADCESSLKVL
FT                   LSICSLLCDPNPDDPLVPEIAHTYKADRAKYAPS"
FT   CDS             <2710998..2711348
FT                   /codon_start=1
FT                   /locus_tag="mCG_14703"
FT                   /product="mCG14703, isoform CRA_d"
FT                   /note="gene_id=mCG14703.1 transcript_id=mCT19740.2
FT                   protein_id=mCP7840.1 isoform=CRA_d"
FT                   /protein_id="EDL40552.1"
FT                   /translation="RGPVCPLTTCPLPLEHSDFLGAQTEWALFILCLPQNHVLRSATMS
FT                   WRLLEIGTASPESHLPPRSSIVLHAANSKRGALGHLKHITPKEEWDSQTRGDSGYACVC
FT                   NEASSTVFPLET"
FT   gene            <2715217..2727503
FT                   /gene="Dbnl"
FT                   /locus_tag="mCG_14704"
FT                   /note="gene_id=mCG14704.2"
FT   mRNA            join(<2715217..2715373,2718517..2718572,2720377..2720489,
FT                   2720964..2721038,2722175..2722321,2723474..2723551,
FT                   2723752..2723903,2724010..2724058,2724350..2724443,
FT                   2724739..2724834,2724939..2725048,2725774..2725879,
FT                   2726400..2727060)
FT                   /gene="Dbnl"
FT                   /locus_tag="mCG_14704"
FT                   /product="drebrin-like, transcript variant mCT193937"
FT                   /note="gene_id=mCG14704.2 transcript_id=mCT193937.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<2715258..2715373,2718517..2718572,2720377..2720489,
FT                   2720964..2721038,2722175..2722321,2723474..2723551,
FT                   2723752..2723903,2724010..2724058,2724350..2724443,
FT                   2724739..2724834,2724939..2725048,2725774..2725879,
FT                   2726400..2726539)
FT                   /codon_start=1
FT                   /gene="Dbnl"
FT                   /locus_tag="mCG_14704"
FT                   /product="drebrin-like, isoform CRA_b"
FT                   /note="gene_id=mCG14704.2 transcript_id=mCT193937.0
FT                   protein_id=mCP114897.0 isoform=CRA_b"
FT                   /protein_id="EDL40555.1"
FT                   /translation="SCCIAGTVGRAMAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYE
FT                   GNSNDIRVAGTGEGGLEELVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVR
FT                   KGACANHVSTMANFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESTSFQDV
FT                   GPQAPVGSVYQKTNAISEIKRVGKDNFWAKAEKEEENRRLEEKRRAEEERQRLEEERRE
FT                   RELQEAARREQRYQEQHRSAGAPRTGEPEQEAVSRTRQEWESAGQQAPHPREIFKQKER
FT                   AMSTTSVTSSQPGKLRSPFLQKQLTQPETSYGREPTAPVSRPAAGVCEEPAPSTLSSAQ
FT                   TEEEPTYEVPPEQDTLYEEPPLVQQQGAGSEHIDNYMQSQGFSGQGLCARALYDYQAAD
FT                   DTEISFDPENLITGIEVIDEGWWRGYGPDGHFGMFPANYVELIE"
FT   mRNA            join(2715261..2715373,2718517..2718572,2720377..2720489,
FT                   2720964..2721038,2722175..2722321,2723474..2723551,
FT                   2723752..2723903,2724007..2724058,2724350..2724443,
FT                   2724739..2724834,2724939..2725048,2725774..2725879,
FT                   2726400..2727503)
FT                   /gene="Dbnl"
FT                   /locus_tag="mCG_14704"
FT                   /product="drebrin-like, transcript variant mCT19744"
FT                   /note="gene_id=mCG14704.2 transcript_id=mCT19744.0 created
FT                   on 23-MAY-2002"
FT   mRNA            join(<2715291..2715373,2718517..2718572,2720377..2720489,
FT                   2720964..2721038,2722175..2722321,2723474..2723551,
FT                   2723752..2723903,2723998..2724058,2724350..2724443,
FT                   2724739..2724834,2724939..2725048,2725774..2725879,
FT                   2726400..>2726539)
FT                   /gene="Dbnl"
FT                   /locus_tag="mCG_14704"
FT                   /product="drebrin-like, transcript variant mCT193936"
FT                   /note="gene_id=mCG14704.2 transcript_id=mCT193936.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(2715291..2715373,2718517..2718572,2720377..2720489,
FT                   2720964..2721038,2722175..2722321,2723474..2723551,
FT                   2723752..2723903,2723998..2724058,2724350..2724443,
FT                   2724739..2724834,2724939..2725048,2725774..2725879,
FT                   2726400..2726539)
FT                   /codon_start=1
FT                   /gene="Dbnl"
FT                   /locus_tag="mCG_14704"
FT                   /product="drebrin-like, isoform CRA_a"
FT                   /note="gene_id=mCG14704.2 transcript_id=mCT193936.0
FT                   protein_id=mCP114896.0 isoform=CRA_a"
FT                   /protein_id="EDL40554.1"
FT                   /translation="MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGT
FT                   GEGGLEELVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTM
FT                   ANFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESTSFQDVGPQAPVGSVYQ
FT                   KTNAISEIKRVGKDNFWAKAEKEEENRRLEEKRRAEEERQRLEEERRERELQEAARREQ
FT                   RYQEQHRSAGAPSPSSRTGEPEQEAVSRTRQEWESAGQQAPHPREIFKQKERAMSTTSV
FT                   TSSQPGKLRSPFLQKQLTQPETSYGREPTAPVSRPAAGVCEEPAPSTLSSAQTEEEPTY
FT                   EVPPEQDTLYEEPPLVQQQGAGSEHIDNYMQSQGFSGQGLCARALYDYQAADDTEISFD
FT                   PENLITGIEVIDEGWWRGYGPDGHFGMFPANYVELIE"
FT   CDS             join(2715291..2715373,2718517..2718572,2720377..2720489,
FT                   2720964..2721038,2722175..2722321,2723474..2723551,
FT                   2723752..2723903,2724007..2724058,2724350..2724443,
FT                   2724739..2724834,2724939..2725048,2725774..2725879,
FT                   2726400..2726539)
FT                   /codon_start=1
FT                   /gene="Dbnl"
FT                   /locus_tag="mCG_14704"
FT                   /product="drebrin-like, isoform CRA_c"
FT                   /note="gene_id=mCG14704.2 transcript_id=mCT19744.0
FT                   protein_id=mCP7825.1 isoform=CRA_c"
FT                   /protein_id="EDL40556.1"
FT                   /translation="MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGT
FT                   GEGGLEELVEELNSGKVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTM
FT                   ANFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESTSFQDVGPQAPVGSVYQ
FT                   KTNAISEIKRVGKDNFWAKAEKEEENRRLEEKRRAEEERQRLEEERRERELQEAARREQ
FT                   RYQEQHRSAGAPSRTGEPEQEAVSRTRQEWESAGQQAPHPREIFKQKERAMSTTSVTSS
FT                   QPGKLRSPFLQKQLTQPETSYGREPTAPVSRPAAGVCEEPAPSTLSSAQTEEEPTYEVP
FT                   PEQDTLYEEPPLVQQQGAGSEHIDNYMQSQGFSGQGLCARALYDYQAADDTEISFDPEN
FT                   LITGIEVIDEGWWRGYGPDGHFGMFPANYVELIE"
FT   gene            complement(2728178..2730336)
FT                   /gene="Pgam2"
FT                   /locus_tag="mCG_14702"
FT                   /note="gene_id=mCG14702.1"
FT   mRNA            complement(join(2728178..2728380,2729539..2729719,
FT                   2729815..2729881,2729963..2730336))
FT                   /gene="Pgam2"
FT                   /locus_tag="mCG_14702"
FT                   /product="phosphoglycerate mutase 2, transcript variant
FT                   mCT169502"
FT                   /note="gene_id=mCG14702.1 transcript_id=mCT169502.0 created
FT                   on 23-MAY-2002"
FT   mRNA            complement(join(2728183..2728380,2729539..2729573,
FT                   2730129..2730200))
FT                   /gene="Pgam2"
FT                   /locus_tag="mCG_14702"
FT                   /product="phosphoglycerate mutase 2, transcript variant
FT                   mCT169503"
FT                   /note="gene_id=mCG14702.1 transcript_id=mCT169503.0 created
FT                   on 23-MAY-2002"
FT   mRNA            complement(join(2728185..2728380,2729539..2729719,
FT                   2729815..2730336))
FT                   /gene="Pgam2"
FT                   /locus_tag="mCG_14702"
FT                   /product="phosphoglycerate mutase 2, transcript variant
FT                   mCT19739"
FT                   /note="gene_id=mCG14702.1 transcript_id=mCT19739.2 created
FT                   on 23-MAY-2002"
FT   CDS             complement(join(2728214..2728380,2729539..2729719,
FT                   2729815..2729881,2729963..2730228))
FT                   /codon_start=1
FT                   /gene="Pgam2"
FT                   /locus_tag="mCG_14702"
FT                   /product="phosphoglycerate mutase 2, isoform CRA_c"
FT                   /note="gene_id=mCG14702.1 transcript_id=mCT169502.0
FT                   protein_id=mCP92106.0 isoform=CRA_c"
FT                   /protein_id="EDL40559.1"
FT                   /translation="MTTHRLVMVRHGESLWNQENRFCGWFDAELSEKGAEEAKRGATAI
FT                   KDAKIEFDICYTSVLKRAIRTLWTILDVTDQMWVPVVRTWRLNERSFDTPPPPMDEKHN
FT                   YYTSISKDRRYAGLKPEELPTCESLKDTIARALPFWNEEIAPKIKAGQRVLIAAHGNSL
FT                   RGIVKHLEGMSDQAIMELNLPTGIPIVYELDQNLKPTKPMRFLGDEETVRKAMEAVAAQ
FT                   GKAK"
FT   CDS             complement(join(2728214..2728380,2729539..2729719,
FT                   2729815..2730228))
FT                   /codon_start=1
FT                   /gene="Pgam2"
FT                   /locus_tag="mCG_14702"
FT                   /product="phosphoglycerate mutase 2, isoform CRA_b"
FT                   /note="gene_id=mCG14702.1 transcript_id=mCT19739.2
FT                   protein_id=mCP7806.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5NCI4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="MGI:MGI:1933118"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NCI4"
FT                   /protein_id="EDL40558.1"
FT                   /translation="MTTHRLVMVRHGESLWNQENRFCGWFDAELSEKGAEEAKRGATAI
FT                   KDAKIEFDICYTSVLKRAIRTLWTILDVTDQMWVPVVRTWRLNERHYGGLTGLNKAETA
FT                   AKHGEEQVKIWRRSFDTPPPPMDEKHNYYTSISKDRRYAGLKPEELPTCESLKDTIARA
FT                   LPFWNEEIAPKIKAGQRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQ
FT                   NLKPTKPMRFLGDEETVRKAMEAVAAQGKAK"
FT   CDS             complement(2728214..2728378)
FT                   /codon_start=1
FT                   /gene="Pgam2"
FT                   /locus_tag="mCG_14702"
FT                   /product="phosphoglycerate mutase 2, isoform CRA_a"
FT                   /note="gene_id=mCG14702.1 transcript_id=mCT169503.0
FT                   protein_id=mCP92119.0 isoform=CRA_a"
FT                   /protein_id="EDL40557.1"
FT                   /translation="MSDQAIMELNLPTGIPIVYELDQNLKPTKPMRFLGDEETVRKAME
FT                   AVAAQGKAK"
FT   assembly_gap    2739302..2739321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2742110..2742129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2743474..2743493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2746786..2746805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2755829..>2765935)
FT                   /gene="Polm"
FT                   /locus_tag="mCG_14700"
FT                   /note="gene_id=mCG14700.3"
FT   mRNA            complement(join(2755829..2757089,2757285..2757368,
FT                   2757451..2757699,2757800..2757902,2758042..2758174,
FT                   2759628..2759748,2762710..2762781,2763384..2763554,
FT                   2763669..2763767,2764162..2764342,2765528..2765756))
FT                   /gene="Polm"
FT                   /locus_tag="mCG_14700"
FT                   /product="polymerase (DNA directed), mu, transcript variant
FT                   mCT19741"
FT                   /note="gene_id=mCG14700.3 transcript_id=mCT19741.1 created
FT                   on 23-MAY-2002"
FT   mRNA            complement(join(2755835..2757089,2757285..2757368,
FT                   2757451..2757699,2757800..2757902,2758042..2758174,
FT                   2759628..2759748,2762710..2762781,2763384..>2765935))
FT                   /gene="Polm"
FT                   /locus_tag="mCG_14700"
FT                   /product="polymerase (DNA directed), mu, transcript variant
FT                   mCT193933"
FT                   /note="gene_id=mCG14700.3 transcript_id=mCT193933.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2757003..2757089,2757285..2757368,
FT                   2757451..2757699,2757800..2757902,2758042..2758174,
FT                   2759628..2759748,2762710..2762781,2763384..2763554,
FT                   2763669..2763767,2764162..2764342,2765528..2765718))
FT                   /codon_start=1
FT                   /gene="Polm"
FT                   /locus_tag="mCG_14700"
FT                   /product="polymerase (DNA directed), mu, isoform CRA_b"
FT                   /note="gene_id=mCG14700.3 transcript_id=mCT19741.1
FT                   protein_id=mCP7789.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9JIW4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001726"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR019843"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="InterPro:IPR027249"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR028207"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="MGI:MGI:1860191"
FT                   /db_xref="PDB:2IHM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JIW4"
FT                   /protein_id="EDL40561.1"
FT                   /translation="MLPKRRRVRAGSPHSAVASSTPPSVVRFPDVAIYLAEPRMGRSRR
FT                   AFLTRLARSKGFRVLDAYSSKVTHVVMEGTSAKEAICWQKNMDALPTGCPQPALLDISW
FT                   FTESMAAGQPVPEEGRHHLEVAEPRKEPPVSASMPAYACQRPSPLTHHNTLLSEALETL
FT                   AEAAGFEANEGRLLSFSRAASVLKSLPCPVASLSQLHGLPYFGEHSTRVIQELLEHGTC
FT                   EEVKQVRCSERYQTMKLFTQVFGVGVKTANRWYQEGLRTLDELREQPQRLTQQQKAGLQ
FT                   YYQDLSTPVRRADAEALQQLIEAAVRQTLPGATVTLTGGFRRGKLQGHDVDFLITHPEE
FT                   GQEVGLLPKVMSCLQSQGLVLYHQYHRSHLADSAHNLRQRSSTMDAFERSFCILGLPQP
FT                   QQAALAGALPPCPTWKAVRVDLVVTPSSQFPFALLGWTGSQFFERELRRFSRQEKGLWL
FT                   NSHGLFDPEQKRVFHATSEEDVFRLLGLKYLPPEQRNA"
FT   CDS             complement(join(2757003..2757089,2757285..2757368,
FT                   2757451..2757699,2757800..2757902,2758042..2758174,
FT                   2759628..2759748,2762710..2762781,2763384..>2763617))
FT                   /codon_start=1
FT                   /gene="Polm"
FT                   /locus_tag="mCG_14700"
FT                   /product="polymerase (DNA directed), mu, isoform CRA_a"
FT                   /note="gene_id=mCG14700.3 transcript_id=mCT193933.0
FT                   protein_id=mCP114895.0 isoform=CRA_a"
FT                   /protein_id="EDL40560.1"
FT                   /translation="SWLLSGKVPYPITKPPPPRPQEALETLAEAAGFEANEGRLLSFSR
FT                   AASVLKSLPCPVASLSQLHGLPYFGEHSTRVIQELLEHGTCEEVKQVRCSERYQTMKLF
FT                   TQVFGVGVKTANRWYQEGLRTLDELREQPQRLTQQQKAGLQYYQDLSTPVRRADAEALQ
FT                   QLIEAAVRQTLPGATVTLTGGFRRGKLQGHDVDFLITHPEEGQEVGLLPKVMSCLQSQG
FT                   LVLYHQYHRSHLADSAHNLRQRSSTMDAFERSFCILGLPQPQQAALAGALPPCPTWKAV
FT                   RVDLVVTPSSQFPFALLGWTGSQFFERELRRFSRQEKGLWLNSHGLFDPEQKRVFHATS
FT                   EEDVFRLLGLKYLPPEQRNA"
FT   assembly_gap    2779030..2779049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2789963..2800103
FT                   /gene="Aebp1"
FT                   /locus_tag="mCG_21382"
FT                   /note="gene_id=mCG21382.2"
FT   mRNA            join(2789963..2790414,2791955..2792293,2792840..2792911,
FT                   2793033..2793104,2793216..2793326,2793401..2793469,
FT                   2794449..2794526,2794936..2795016,2795114..2795167,
FT                   2795656..2795765,2795836..2795975,2796313..2796397,
FT                   2796491..2796635,2796747..2796832,2797081..2797204,
FT                   2797430..2797626,2797723..2797902,2798092..2798443,
FT                   2798530..2798669,2798769..2798868,2799261..2800103)
FT                   /gene="Aebp1"
FT                   /locus_tag="mCG_21382"
FT                   /product="AE binding protein 1"
FT                   /note="gene_id=mCG21382.2 transcript_id=mCT11448.1 created
FT                   on 24-MAY-2002"
FT   CDS             join(2790168..2790414,2791955..2792293,2792840..2792911,
FT                   2793033..2793104,2793216..2793326,2793401..2793469,
FT                   2794449..2794526,2794936..2795016,2795114..2795167,
FT                   2795656..2795765,2795836..2795975,2796313..2796397,
FT                   2796491..2796635,2796747..2796832,2797081..2797204,
FT                   2797430..2797626,2797723..2797902,2798092..2798443,
FT                   2798530..2798669,2798769..2798868,2799261..2799865)
FT                   /codon_start=1
FT                   /gene="Aebp1"
FT                   /locus_tag="mCG_21382"
FT                   /product="AE binding protein 1"
FT                   /note="gene_id=mCG21382.2 transcript_id=mCT11448.1
FT                   protein_id=mCP7842.1"
FT                   /protein_id="EDL40562.1"
FT                   /translation="MAPVRTASLLCGLLALLTLCPEGNPQTVLTDDEIEEFLEGFLSEL
FT                   ETQSPPREDDVEVQPLPEPTQRPRKSKAGGKQRADVEVPPEKNKDKEKKGKKDKGPKAT
FT                   KPLEGSTRPTKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKRPSA
FT                   GKKFSTVAPLETLDRLLPSPSNPSAQELPQKRDTPFPNAWQGQGEETQVEAKQPRPEPE
FT                   EETEMPTLDYNDQIEKEDYEDFEYIRRQKQPRPTPSRRRLWPERPEEKTEEPEERKEVE
FT                   PPLKPLLPPDYGDSYVIPNYDDLDYYFPHPPPQKPDVGQEVDEEKEEMKKPKKEGSSPK
FT                   EDTEDKWTVEKNKDHKGPRKGEELEEEWAPVEKIKCPPIGMESHRIEDNQIRASSMLRH
FT                   GLGAQRGRLNMQAGANEDDYYDGAWCAEDESQTQWIEVDTRRTTRFTGVITQGRDSSIH
FT                   DDFVTTFFVGFSNDSQTWVMYTNGYEEMTFYGNVDKDTPVLSELPEPVVARFIRIYPLT
FT                   WNGSLCMRLEVLGCPVTPVYSYYAQNEVVTTDSLDFRHHSYKDMRQLMKAVNEECPTIT
FT                   RTYSLGKSSRGLKIYAMEISDNPGDHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLCQ
FT                   EYRDGNPRVRNLVQDTRIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFP
FT                   DLNSVLWAAEEKKWVPYRVPNNNLPIPERYLSPDATVSTEVRAIISWMEKNPFVLGANL
FT                   NGGERLVSYPYDMARTPSQEQLLAEALAAARGEDDDGVSEAQETPDHAIFRWLAISFAS
FT                   AHLTMTEPYRGGCQAQDYTSGMGIVNGAKWNPRSGTFNDFSYLHTNCLELSVYLGCDKF
FT                   PHESELPREWENNKEALLTFMEQVHRGIKGVVTDEQGIPIANATISVSGINHGVKTASG
FT                   GDYWRILNPGEYRVTAHAEGYTSSAKICNVDYDIGATQCNFILARSNWKRIREILAMNG
FT                   NRPILRVDPSRPMTPQQRRMQQRRLQYRLRMREQMRLRRLNSTAGPATSPTPALMPPPS
FT                   PTPAITLRPWEVLPTTTAGWEESETETYTEVVTEFETEYGTDLEVEEIEEEEEEEEEEM
FT                   DTGLTFPLTTVETYTVNFGDF"
FT   gene            complement(2800204..2806232)
FT                   /gene="Pold2"
FT                   /locus_tag="mCG_21379"
FT                   /note="gene_id=mCG21379.0"
FT   mRNA            complement(join(2800204..2800434,2800686..2800787,
FT                   2801043..2801170,2801427..2801584,2801707..2801787,
FT                   2802042..2802240,2802333..2802447,2802779..2802902,
FT                   2803072..2803193,2804731..2805007,2806207..2806232))
FT                   /gene="Pold2"
FT                   /locus_tag="mCG_21379"
FT                   /product="polymerase (DNA directed), delta 2, regulatory
FT                   subunit, transcript variant mCT13103"
FT                   /note="gene_id=mCG21379.0 transcript_id=mCT13103.0 created
FT                   on 24-MAY-2002"
FT   mRNA            complement(join(2800204..2800434,2800686..2800787,
FT                   2801043..2801170,2801427..2801584,2801707..2801787,
FT                   2802042..2802240,2802333..2802447,2802779..2802824,
FT                   2804893..2805007,2806207..2806226))
FT                   /gene="Pold2"
FT                   /locus_tag="mCG_21379"
FT                   /product="polymerase (DNA directed), delta 2, regulatory
FT                   subunit, transcript variant mCT169517"
FT                   /note="gene_id=mCG21379.0 transcript_id=mCT169517.0 created
FT                   on 24-MAY-2002"
FT   mRNA            complement(join(2800214..2800434,2800686..2800708,
FT                   2801526..2801584,2801707..2801787,2802042..2802240,
FT                   2802333..2802447,2802779..2802902,2803072..2803193,
FT                   2804731..2805007,2806207..2806232))
FT                   /gene="Pold2"
FT                   /locus_tag="mCG_21379"
FT                   /product="polymerase (DNA directed), delta 2, regulatory
FT                   subunit, transcript variant mCT169518"
FT                   /note="gene_id=mCG21379.0 transcript_id=mCT169518.0 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(2800274..2800434,2800686..2800708,
FT                   2801526..2801584,2801707..2801787,2802042..2802240,
FT                   2802333..2802447,2802779..2802902,2803072..2803193,
FT                   2804731..2804950))
FT                   /codon_start=1
FT                   /gene="Pold2"
FT                   /locus_tag="mCG_21379"
FT                   /product="polymerase (DNA directed), delta 2, regulatory
FT                   subunit, isoform CRA_c"
FT                   /note="gene_id=mCG21379.0 transcript_id=mCT169518.0
FT                   protein_id=mCP92135.0 isoform=CRA_c"
FT                   /protein_id="EDL40565.1"
FT                   /translation="MFSEQAAQRAHTLLAPPSASNATFARVPVATYTNSSQPFRLGERS
FT                   FNRQYAHIYATRLIQMRPFLVSRAQQHWGSRVEVKKLCELQPGEQCCVVGTLFKAMSLQ
FT                   PSILREISEEHNLVPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVLG
FT                   SAKDDGRFQVEDHCFADLAPQKPVPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVV
FT                   TGQLGDEGEQCSAAHVSRVILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDE
FT                   ILLQLSASVPVDVMPGEFDPTNYTLPFGSKIIRGPEDQVVLLVAVPDFSSTQTACLVNL
FT                   RSLACQPISFAGFGAEQEDLEGLGLGP"
FT   CDS             complement(join(2800274..2800434,2800686..2800787,
FT                   2801043..2801170,2801427..2801584,2801707..2801787,
FT                   2802042..2802240,2802333..2802447,2802779..2802902,
FT                   2803072..2803193,2804731..2804950))
FT                   /codon_start=1
FT                   /gene="Pold2"
FT                   /locus_tag="mCG_21379"
FT                   /product="polymerase (DNA directed), delta 2, regulatory
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG21379.0 transcript_id=mCT13103.0
FT                   protein_id=mCP7811.1 isoform=CRA_a"
FT                   /db_xref="GOA:O35654"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="MGI:MGI:1097163"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35654"
FT                   /protein_id="EDL40563.1"
FT                   /translation="MFSEQAAQRAHTLLAPPSASNATFARVPVATYTNSSQPFRLGERS
FT                   FNRQYAHIYATRLIQMRPFLVSRAQQHWGSRVEVKKLCELQPGEQCCVVGTLFKAMSLQ
FT                   PSILREISEEHNLVPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVLG
FT                   SAKDDGRFQVEDHCFADLAPQKPVPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVV
FT                   TGQLGDEGEQCSAAHVSRVILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDE
FT                   ILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVR
FT                   FLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECP
FT                   HVYFCGNTPSFGSKIIRGPEDQVVLLVAVPDFSSTQTACLVNLRSLACQPISFAGFGAE
FT                   QEDLEGLGLGP"
FT   CDS             complement(join(2800274..2800434,2800686..2800787,
FT                   2801043..2801170,2801427..2801584,2801707..2801736))
FT                   /codon_start=1
FT                   /gene="Pold2"
FT                   /locus_tag="mCG_21379"
FT                   /product="polymerase (DNA directed), delta 2, regulatory
FT                   subunit, isoform CRA_b"
FT                   /note="gene_id=mCG21379.0 transcript_id=mCT169517.0
FT                   protein_id=mCP92115.0 isoform=CRA_b"
FT                   /protein_id="EDL40564.1"
FT                   /translation="MLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAY
FT                   STLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDT
FT                   LGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPEDQVVLLVAVPDFSSTQTACLV
FT                   NLRSLACQPISFAGFGAEQEDLEGLGLGP"
FT   assembly_gap    2807739..2808095
FT                   /estimated_length=357
FT                   /gap_type="unknown"
FT   gene            complement(2824851..2826995)
FT                   /gene="Myl7"
FT                   /locus_tag="mCG_21377"
FT                   /note="gene_id=mCG21377.1"
FT   mRNA            complement(join(2824851..2824996,2825341..2825389,
FT                   2825535..2825613,2826047..2826151,2826375..2826450,
FT                   2826641..2826754,2826976..2826995))
FT                   /gene="Myl7"
FT                   /locus_tag="mCG_21377"
FT                   /product="myosin, light polypeptide 7, regulatory"
FT                   /note="gene_id=mCG21377.1 transcript_id=mCT13094.1 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(2824895..2824996,2825341..2825389,
FT                   2825535..2825613,2826047..2826151,2826375..2826450,
FT                   2826641..2826754,2826976..2826978))
FT                   /codon_start=1
FT                   /gene="Myl7"
FT                   /locus_tag="mCG_21377"
FT                   /product="myosin, light polypeptide 7, regulatory"
FT                   /note="gene_id=mCG21377.1 transcript_id=mCT13094.1
FT                   protein_id=mCP7807.2"
FT                   /db_xref="GOA:Q5SVI8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:107495"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVI8"
FT                   /protein_id="EDL40566.1"
FT                   /translation="MASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCID
FT                   QNRDGIICKSDLKETYSQLGRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPE
FT                   EAILSAFRMFDPSGQGVVNKEEFKQLLMTQADKFSPAEVEQLFALTPMDLAGNIDYKSL
FT                   CYIITHGDEKEE"
FT   gene            complement(2829038..2878488)
FT                   /gene="Gck"
FT                   /locus_tag="mCG_21380"
FT                   /note="gene_id=mCG21380.2"
FT   mRNA            complement(join(2829038..2830029,2830300..2830533,
FT                   2831315..2831470,2832576..2832759,2834821..2834920,
FT                   2835027..2835122,2837424..2837543,2838619..2838773,
FT                   2839203..2839365,2877962..2878488))
FT                   /gene="Gck"
FT                   /locus_tag="mCG_21380"
FT                   /product="glucokinase, transcript variant mCT169519"
FT                   /note="gene_id=mCG21380.2 transcript_id=mCT169519.0 created
FT                   on 24-MAY-2002"
FT   mRNA            complement(join(2829038..2830029,2830300..2830533,
FT                   2831315..2831470,2832576..2832759,2834821..2834920,
FT                   2835027..2835122,2837424..2837543,2838619..2838773,
FT                   2839203..2839365,2843308..2843476))
FT                   /gene="Gck"
FT                   /locus_tag="mCG_21380"
FT                   /product="glucokinase, transcript variant mCT13104"
FT                   /note="gene_id=mCG21380.2 transcript_id=mCT13104.2 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(2829885..2830029,2830300..2830533,
FT                   2831315..2831470,2832576..2832759,2834821..2834920,
FT                   2835027..2835122,2837424..2837543,2838619..2838773,
FT                   2839203..2839365,2877962..2878006))
FT                   /codon_start=1
FT                   /gene="Gck"
FT                   /locus_tag="mCG_21380"
FT                   /product="glucokinase, isoform CRA_b"
FT                   /note="gene_id=mCG21380.2 transcript_id=mCT169519.0
FT                   protein_id=mCP92129.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SVI5"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="MGI:MGI:1270854"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVI5"
FT                   /protein_id="EDL40568.1"
FT                   /translation="MLDDRARMEATKKEKVEQILAEFQLQEEDLKKVMSRMQKEMDRGL
FT                   KLETHQEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTK
FT                   HQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGI
FT                   LLNWTKGFKASGAEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEV
FT                   GMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDESS
FT                   VNPGQQLYEKIIGGKYMGELVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVES
FT                   DSGDRRQILNILSTLGLRPSVADCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSE
FT                   DVMRITVGVDGSVYKLHPSFKERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACK
FT                   KACMLGQ"
FT   CDS             complement(join(2829885..2830029,2830300..2830533,
FT                   2831315..2831470,2832576..2832759,2834821..2834920,
FT                   2835027..2835122,2837424..2837543,2838619..2838773,
FT                   2839203..2839365,2843308..2843352))
FT                   /codon_start=1
FT                   /gene="Gck"
FT                   /locus_tag="mCG_21380"
FT                   /product="glucokinase, isoform CRA_a"
FT                   /note="gene_id=mCG21380.2 transcript_id=mCT13104.2
FT                   protein_id=mCP7836.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SVI6"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="MGI:MGI:1270854"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVI6"
FT                   /protein_id="EDL40567.1"
FT                   /translation="MAVDTTRRGAQSLTLVEQILAEFQLQEEDLKKVMSRMQKEMDRGL
FT                   KLETHQEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTK
FT                   HQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGI
FT                   LLNWTKGFKASGAEGNNIVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEV
FT                   GMIVGTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDESS
FT                   VNPGQQLYEKIIGGKYMGELVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVES
FT                   DSGDRRQILNILSTLGLRPSVADCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSE
FT                   DVMRITVGVDGSVYKLHPSFKERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACK
FT                   KACMLGQ"
FT   assembly_gap    2877521..2877597
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   gene            2884217..2896227
FT                   /gene="Ykt6"
FT                   /locus_tag="mCG_21393"
FT                   /note="gene_id=mCG21393.2"
FT   mRNA            join(2884217..2884442,2887735..2887817,2889628..2889728,
FT                   2890777..2890881,2891133..2891198,2893001..2893102,
FT                   2894449..2896227)
FT                   /gene="Ykt6"
FT                   /locus_tag="mCG_21393"
FT                   /product="YKT6 homolog (S. Cerevisiae)"
FT                   /note="gene_id=mCG21393.2 transcript_id=mCT22087.1 created
FT                   on 24-MAY-2002"
FT   CDS             join(2884339..2884442,2887735..2887817,2889628..2889728,
FT                   2890777..2890881,2891133..2891198,2893001..2893102,
FT                   2894449..2894484)
FT                   /codon_start=1
FT                   /gene="Ykt6"
FT                   /locus_tag="mCG_21393"
FT                   /product="YKT6 homolog (S. Cerevisiae)"
FT                   /note="gene_id=mCG21393.2 transcript_id=mCT22087.1
FT                   protein_id=mCP7878.1"
FT                   /protein_id="EDL40569.1"
FT                   /translation="MKLYSLSVLYKGDPKAVLLKAAYDVSSFSFFQRSSVQEFMTFTSQ
FT                   LIVERSGKGSRASVKEQEYLCHVYVRSDSLAGVVIADSEYPSRVAFTLLEKVLDEFSKQ
FT                   VDRIDWPVGSPATIQYTGLDDHLSKYQNPREADPMSKVQAELDETKIILHNTMESLLER
FT                   GEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM"
FT   gene            complement(2898108..2990010)
FT                   /gene="Camk2b"
FT                   /locus_tag="mCG_122182"
FT                   /note="gene_id=mCG122182.1"
FT   mRNA            complement(join(2898108..2900252,2900643..2900876,
FT                   2901058..2901152,2901239..2901314,2908099..2908147,
FT                   2909496..2909540,2910927..2910998,2911147..2911184,
FT                   2915483..2915557,2916527..2916569,2917381..2917464,
FT                   2917758..2917880,2918000..2918094,2918589..2918672,
FT                   2918746..2918848,2921246..2921318,2926309..2926374,
FT                   2929570..2929624,2938875..2938934,2953104..2953198,
FT                   2989734..2990010))
FT                   /gene="Camk2b"
FT                   /locus_tag="mCG_122182"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   beta, transcript variant mCT123397"
FT                   /note="gene_id=mCG122182.1 transcript_id=mCT123397.1
FT                   created on 24-MAR-2004"
FT   mRNA            complement(join(2898108..2900252,2900643..2900876,
FT                   2901058..2901152,2901239..2901314,2905191..2905319,
FT                   2906238..2906366,2906825..2906938,2908099..2908147,
FT                   2909496..2909540,2910927..2910998,2911147..2911184,
FT                   2915483..2915557,2916527..2916569,2917381..2917464,
FT                   2917758..2917880,2918000..2918094,2918589..2918672,
FT                   2918746..2918848,2921246..2921318,2926309..2926374,
FT                   2929570..2929624,2938875..2938934,2953104..2953198,
FT                   2989734..2990010))
FT                   /gene="Camk2b"
FT                   /locus_tag="mCG_122182"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   beta, transcript variant mCT186533"
FT                   /note="gene_id=mCG122182.1 transcript_id=mCT186533.1
FT                   created on 24-MAR-2004"
FT   mRNA            complement(join(2898108..2900252,2900643..2900876,
FT                   2901058..2901152,2901239..2901314,2908099..2908147,
FT                   2909496..2909540,2910927..2910998,2911147..2911184,
FT                   2915483..2915557,2916527..2916569,2917381..2917464,
FT                   2917758..2917880,2918000..2918094,2918362..2918394,
FT                   2918589..2918672,2918746..2918848,2921246..2921318,
FT                   2926309..2926374,2929570..2929624,2938875..2938934,
FT                   2953104..2953198,2989734..2990010))
FT                   /gene="Camk2b"
FT                   /locus_tag="mCG_122182"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   beta, transcript variant mCT193931"
FT                   /note="gene_id=mCG122182.1 transcript_id=mCT193931.1
FT                   created on 24-MAR-2004"
FT   CDS             complement(join(2900644..2900876,2901058..2901152,
FT                   2901239..2901314,2908099..2908147,2909496..2909540,
FT                   2910927..2910998,2911147..2911184,2915483..2915557,
FT                   2916527..2916569,2917381..2917464,2917758..2917880,
FT                   2918000..2918094,2918589..2918672,2918746..2918848,
FT                   2921246..2921318,2926309..2926374,2929570..2929624,
FT                   2938875..2938934,2953104..2953198,2989734..2989798))
FT                   /codon_start=1
FT                   /gene="Camk2b"
FT                   /locus_tag="mCG_122182"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   beta, isoform CRA_a"
FT                   /note="gene_id=mCG122182.1 transcript_id=mCT123397.1
FT                   protein_id=mCP59480.2 isoform=CRA_a"
FT                   /protein_id="EDL40570.1"
FT                   /translation="MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKII
FT                   NTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVA
FT                   REYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIE
FT                   VQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKL
FT                   YQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASM
FT                   MHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQ
FT                   AKSLLNKKADGVKPQTNSTKNSSAITSPKGSLPPAALEPQTTVIHNPVDGIKESSDSTN
FT                   TTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDF
FT                   HRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETR
FT                   VWHRRDGKWQNVHFHCSGAPVAPLQ"
FT   CDS             complement(join(2900644..2900876,2901058..2901152,
FT                   2901239..2901314,2905191..2905319,2906238..2906366,
FT                   2906825..2906938,2908099..2908147,2909496..2909540,
FT                   2910927..2910998,2911147..2911184,2915483..2915557,
FT                   2916527..2916569,2917381..2917464,2917758..2917880,
FT                   2918000..2918094,2918589..2918672,2918746..2918848,
FT                   2921246..2921318,2926309..2926374,2929570..2929624,
FT                   2938875..2938934,2953104..2953198,2989734..2989798))
FT                   /codon_start=1
FT                   /gene="Camk2b"
FT                   /locus_tag="mCG_122182"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   beta, isoform CRA_b"
FT                   /note="gene_id=mCG122182.1 transcript_id=mCT186533.1
FT                   protein_id=mCP107237.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SVJ0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013543"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="MGI:MGI:88257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVJ0"
FT                   /protein_id="EDL40571.1"
FT                   /translation="MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKII
FT                   NTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVA
FT                   REYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIE
FT                   VQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKL
FT                   YQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASM
FT                   MHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQ
FT                   AKSLLNKKADGVKPQTNSTKNSSAITSPKGSLPPAALEPQTTVIHNPVDGIKESSDSTN
FT                   TTIEDEDAKAPRVPDVLSLVRRASGAPEAEGPLSCQSPVPISPLPTPSPRISDILNSVR
FT                   RGCGTPEAEGPLSVGPPPCLSPGLLGPLPTPSPRISDILNSVRRGSGTPEAEGLPPVGP
FT                   PPCPSPTLPGPLPTPSRKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNL
FT                   VEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTS
FT                   QSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ"
FT   CDS             complement(join(2900644..2900876,2901058..2901152,
FT                   2901239..2901314,2908099..2908147,2909496..2909540,
FT                   2910927..2910998,2911147..2911184,2915483..2915557,
FT                   2916527..2916569,2917381..2917464,2917758..2917880,
FT                   2918000..2918094,2918362..2918394,2918589..2918672,
FT                   2918746..2918848,2921246..2921318,2926309..2926374,
FT                   2929570..2929624,2938875..2938934,2953104..2953198,
FT                   2989734..2989798))
FT                   /codon_start=1
FT                   /gene="Camk2b"
FT                   /locus_tag="mCG_122182"
FT                   /product="calcium/calmodulin-dependent protein kinase II,
FT                   beta, isoform CRA_c"
FT                   /note="gene_id=mCG122182.1 transcript_id=mCT193931.1
FT                   protein_id=mCP114913.1 isoform=CRA_c"
FT                   /protein_id="EDL40572.1"
FT                   /translation="MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKII
FT                   NTKKLSARDHQKLEREARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVA
FT                   REYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIE
FT                   VQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGHYVCLPVLIIGVILYILLVGY
FT                   PPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHP
FT                   WVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTA
FT                   ASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSSAITSPKGSLPPAALEPQTTVIHNPV
FT                   DGIKESSDSTNTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPE
FT                   ALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQG
FT                   RPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ"
FT   assembly_gap    2926995..2927014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2933582..2933601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2940218..2940237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2992836..2992858
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    2995684..2996450
FT                   /estimated_length=767
FT                   /gap_type="unknown"
FT   assembly_gap    2998159..2998407
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    3008637..3008771
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    3026168..3026187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3030610..3119368)
FT                   /gene="Nudcd3"
FT                   /locus_tag="mCG_21378"
FT                   /note="gene_id=mCG21378.2"
FT   mRNA            complement(join(3030610..3033253,3038141..3038329,
FT                   3049586..3049729,3069548..3069680,3112123..3112445,
FT                   3118912..3119368))
FT                   /gene="Nudcd3"
FT                   /locus_tag="mCG_21378"
FT                   /product="NudC domain containing 3, transcript variant
FT                   mCT13095"
FT                   /note="gene_id=mCG21378.2 transcript_id=mCT13095.3 created
FT                   on 27-FEB-2003"
FT   mRNA            complement(join(3031356..3033253,3038141..3038329,
FT                   3069548..3069680,3112123..3112445,3118912..3119111))
FT                   /gene="Nudcd3"
FT                   /locus_tag="mCG_21378"
FT                   /product="NudC domain containing 3, transcript variant
FT                   mCT180816"
FT                   /note="gene_id=mCG21378.2 transcript_id=mCT180816.0 created
FT                   on 27-FEB-2003"
FT   CDS             complement(join(3033143..3033253,3038141..3038329,
FT                   3069548..3069680,3112123..3112445,3118912..3119103))
FT                   /codon_start=1
FT                   /gene="Nudcd3"
FT                   /locus_tag="mCG_21378"
FT                   /product="NudC domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG21378.2 transcript_id=mCT180816.0
FT                   protein_id=mCP103738.0 isoform=CRA_b"
FT                   /protein_id="EDL40574.1"
FT                   /translation="MEPGAAELYDQALLGILQHVGNVQDFLRVLFGFLYRKTDFYRLLR
FT                   HPSDRMGFPPGAAQALVLQVFKTFDHMARQDDEKRKKELEEKIRKKEEEAKALPAAETE
FT                   KVAVPVPVQEVEIDAAADLSGPQEVEKEEPPGSQDPEHTVTHGLEKAEAPGTVSSAAEG
FT                   PKDPPVLPRIQEQFQKNPDSYNGAIRENYIWSQDYTDLEVRVPVPKHVMKGKQVNLSKV
FT                   GEYWWSAILEGEEPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKV
FT                   HEMLKKGWDAEGSPFRGQRFDPAMFNISPGAVQF"
FT   CDS             complement(join(3033143..3033253,3038141..3038329,
FT                   3049586..3049729,3069548..3069680,3112123..3112445,
FT                   3118912..3119103))
FT                   /codon_start=1
FT                   /gene="Nudcd3"
FT                   /locus_tag="mCG_21378"
FT                   /product="NudC domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG21378.2 transcript_id=mCT13095.3
FT                   protein_id=mCP7880.3 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR025934"
FT                   /db_xref="InterPro:IPR027761"
FT                   /db_xref="MGI:MGI:2144158"
FT                   /db_xref="UniProtKB/TrEMBL:B0FTY3"
FT                   /protein_id="EDL40573.1"
FT                   /translation="MEPGAAELYDQALLGILQHVGNVQDFLRVLFGFLYRKTDFYRLLR
FT                   HPSDRMGFPPGAAQALVLQVFKTFDHMARQDDEKRKKELEEKIRKKEEEAKALPAAETE
FT                   KVAVPVPVQEVEIDAAADLSGPQEVEKEEPPGSQDPEHTVTHGLEKAEAPGTVSSAAEG
FT                   PKDPPVLPRIQEQFQKNPDSYNGAIRENYIWSQDYTDLEVRVPVPKHVMKGKQVSVALS
FT                   SGTIRVAMVEENGERVLMEGKLTHKINTESSLWSLEPGRCVLVNLSKVGEYWWSAILEG
FT                   EEPIDIDKINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAE
FT                   GSPFRGQRFDPAMFNISPGAVQF"
FT   assembly_gap    3040862..3040881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3047093..3049729,3069548..3069680,
FT                   3112123..3112445,3118912..>3119143))
FT                   /gene="Nudcd3"
FT                   /locus_tag="mCG_21378"
FT                   /product="NudC domain containing 3, transcript variant
FT                   mCT193935"
FT                   /note="gene_id=mCG21378.2 transcript_id=mCT193935.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3049475..3049729,3069548..3069680,
FT                   3112123..3112445,3118912..>3119142))
FT                   /codon_start=1
FT                   /gene="Nudcd3"
FT                   /locus_tag="mCG_21378"
FT                   /product="NudC domain containing 3, isoform CRA_c"
FT                   /note="gene_id=mCG21378.2 transcript_id=mCT193935.0
FT                   protein_id=mCP114902.0 isoform=CRA_c"
FT                   /protein_id="EDL40575.1"
FT                   /translation="RCPLCSRPSGSRAMEPGAAELYDQALLGILQHVGNVQDFLRVLFG
FT                   FLYRKTDFYRLLRHPSDRMGFPPGAAQALVLQVFKTFDHMARQDDEKRKKELEEKIRKK
FT                   EEEAKALPAAETEKVAVPVPVQEVEIDAAADLSGPQEVEKEEPPGSQDPEHTVTHGLEK
FT                   AEAPGTVSSAAEGPKDPPVLPRIQEQFQKNPDSYNGAIRENYIWSQDYTDLEVRVPVPK
FT                   HVMKGKQVSVALSSGTIRVAMVEENGERVLMEGKLTHKINTESSLWSLEPGRCVLVSEV
FT                   TCVQSSHQGFAPAMMTCVQVFPIISEVFNYSN"
FT   assembly_gap    3067116..3067135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3091642..3092101)
FT                   /pseudo
FT                   /locus_tag="mCG_140433"
FT                   /note="gene_id=mCG140433.0"
FT   mRNA            complement(3091642..3092101)
FT                   /pseudo
FT                   /locus_tag="mCG_140433"
FT                   /note="gene_id=mCG140433.0 transcript_id=mCT169516.0
FT                   created on 24-MAY-2002"
FT   assembly_gap    3104186..3104235
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(3129988..>3149100)
FT                   /gene="Npc1l1"
FT                   /locus_tag="mCG_21405"
FT                   /note="gene_id=mCG21405.2"
FT   mRNA            complement(join(3129988..3130631,3132983..3133145,
FT                   3133232..3133345,3133498..3133729,3133993..3134143,
FT                   3136452..3136507,3136681..3136807,3137208..3137335,
FT                   3137526..3137716,3140802..3140891,3141119..3141256,
FT                   3142006..3142133,3142298..3142412,3143115..3143297,
FT                   3143749..3143877,3144097..3144269,3144606..3144706,
FT                   3146806..3148334,3149050..>3149100))
FT                   /gene="Npc1l1"
FT                   /locus_tag="mCG_21405"
FT                   /product="NPC1-like 1"
FT                   /note="gene_id=mCG21405.2 transcript_id=mCT22099.2 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(3130429..3130631,3132983..3133145,
FT                   3133232..3133345,3133498..3133729,3133993..3134143,
FT                   3136452..3136507,3136681..3136807,3137208..3137335,
FT                   3137526..3137716,3140802..3140891,3141119..3141256,
FT                   3142006..3142133,3142298..3142412,3143115..3143297,
FT                   3143749..3143877,3144097..3144269,3144606..3144706,
FT                   3146806..3148334,3149050..3149100))
FT                   /codon_start=1
FT                   /gene="Npc1l1"
FT                   /locus_tag="mCG_21405"
FT                   /product="NPC1-like 1"
FT                   /note="gene_id=mCG21405.2 transcript_id=mCT22099.2
FT                   protein_id=mCP7861.2"
FT                   /db_xref="GOA:Z4YJC9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR004765"
FT                   /db_xref="InterPro:IPR032190"
FT                   /db_xref="MGI:MGI:2685089"
FT                   /db_xref="UniProtKB/TrEMBL:Z4YJC9"
FT                   /protein_id="EDL40576.1"
FT                   /translation="MAAAWQGWLLWALLLNSAQGELYTPTHKAGFCTFYEECGKNPELS
FT                   GGLTSLSNISCLSNTPARHVTGDHLALLQRVCPRLYNGPNDTYACCSTKQLVSLDSSLS
FT                   ITKALLTRCPACSENFVSIHCHNTCSPDQSLFINVTRVVQRDPGQLPAVVAYEAFYQRS
FT                   FAEKAYESCSRVRIPAAASLAVGSMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITFHL
FT                   LEPGQALADGMKPLDGKITPCNESQGEDSAACSCQDCAASCPVIPPPPALRPSFYMGRM
FT                   PGWLALIIIFTAVFVLLSVVLVYLRVASNRNKNKTAGSQEAPNLPRKRRFSPHTVLGRF
FT                   FESWGTRVASWPLTVLALSFIVVIALSVGLTFIELTTDPVELWSAPKSQARKEKAFHDE
FT                   HFGPFFRTNQIFVTAKNRSSYKYDSLLLGPKNFSGILSLDLLQELLELQERLRHLQVWS
FT                   HEAQRNISLQDICYAPLKPHNTSLTDCCVNSLLQYFQNNHTLLLLTANQTLNGQTSLVD
FT                   WKDHFLYCANAPLTYKDGTALALSCIADYGAPVFPFLAVGGYQGTDYSEAEALIITFSI
FT                   NNYPADDPRMAHAKLWEEAFLKEMQSFQRSTADKFQIAFSAERSLEDEINRTTIQDLPV
FT                   FAISYLIVFLYISLALGSYSRWSRVAVDSKATLGLGGVAVVLGAVVAAMGFYSYLGVPS
FT                   SLVIIQVVPFLVLAVGADNIFIFVLEYQRLPRMPGEQREAHIGRTLGSVAPSMLLCSLS
FT                   EAICFFLGALTSMPAVRTFALTSGLAIIFDFLLQMTAFVALLSLDSKRQEASRPDVVCC
FT                   FSSRNLPPPKQKEGLLLCFFRKIYTPFLLHRFIRPVVLLLFLVLFGANLYLMCNISVGL
FT                   DQDLALPKDSYLIDYFLFLNRYLEVGPPVYFDTTSGYNFSTEAGMNAICSSAGCESFSL
FT                   TQKIQYASEFPNQSYVAIAASSWVDDFIDWLTPSSSCCRIYTRGPHKDEFCPSTDTSFN
FT                   CLKNCMNRTLGPVRPTTEQFHKYLPWFLNDTPNIRCPKGGLAAYRTSVNLSSDGQIIAS
FT                   QFMAYHKPLRNSQDFTEALRASRLLAANITAELRKVPGTDPNFEVFPYTISNVFYQQYL
FT                   TVLPEGIFTLALCFVPTFVVCYLLLGLDIRSGILNLLSIIMILVDTIGLMAVWGISYNA
FT                   VSLINLVTAVGMSVEFVSHITRSFAVSTKPTRLERAKDATIFMGSAVFAGVAMTNFPGI
FT                   LILGFAQAQLIQIFFFRLNLLITLLGLLHGLVFLPVVLSYLGPDVNQALVLEEKLATEA
FT                   AMVSEPSCPQYPFPADANTSDYVNYGFNPEFIPEINAASSSLPKSDQKF"
FT   assembly_gap    3132054..3132073
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3158104..>3159318
FT                   /locus_tag="mCG_1041183"
FT                   /note="gene_id=mCG1041183.1"
FT   mRNA            join(<3158104..3159166,3159270..>3159318)
FT                   /locus_tag="mCG_1041183"
FT                   /product="mCG1041183"
FT                   /note="gene_id=mCG1041183.1 transcript_id=mCT158887.1
FT                   created on 24-MAY-2002"
FT   CDS             join(<3158830..3159166,3159270..>3159318)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041183"
FT                   /product="mCG1041183"
FT                   /note="gene_id=mCG1041183.1 transcript_id=mCT158887.1
FT                   protein_id=mCP59297.1"
FT                   /protein_id="EDL40577.1"
FT                   /translation="SIDPRCVVMLFSPIDPLWVGLIVLVLFVLIYGLCYCLCVEAVKTG
FT                   QKILTEQQESMSEKEKGLKRKRKKKGDTVLSGGQKGQNKRAEVEEEGELASVPPPYASS
FT                   AATYRWTFSDPVLTRARGSVCVFP"
FT   assembly_gap    3159616..3159635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3160668..3161069
FT                   /pseudo
FT                   /locus_tag="mCG_50420"
FT                   /note="gene_id=mCG50420.1"
FT   mRNA            3160668..3161069
FT                   /pseudo
FT                   /locus_tag="mCG_50420"
FT                   /note="gene_id=mCG50420.1 transcript_id=mCT50603.2 created
FT                   on 24-MAY-2002"
FT   gene            complement(3176554..3186059)
FT                   /gene="Ddx56"
FT                   /locus_tag="mCG_21395"
FT                   /note="gene_id=mCG21395.2"
FT   mRNA            complement(join(3176554..3177580,3177869..3177942,
FT                   3179938..3180043,3180779..3180868,3180985..3181058,
FT                   3182260..3182354,3182445..3182558,3182997..3183116,
FT                   3183833..3184077,3184637..3184727,3184833..3185003,
FT                   3185132..3185292,3185739..3185900,3185981..3186059))
FT                   /gene="Ddx56"
FT                   /locus_tag="mCG_21395"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 56"
FT                   /note="gene_id=mCG21395.2 transcript_id=mCT22089.2 created
FT                   on 24-MAY-2002"
FT   CDS             complement(join(3177503..3177580,3177869..3177942,
FT                   3179938..3180043,3180779..3180868,3180985..3181058,
FT                   3182260..3182354,3182445..3182558,3182997..3183116,
FT                   3183833..3184077,3184637..3184727,3184833..3185003,
FT                   3185132..3185292,3185739..3185900,3185981..3186040))
FT                   /codon_start=1
FT                   /gene="Ddx56"
FT                   /locus_tag="mCG_21395"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 56"
FT                   /note="gene_id=mCG21395.2 transcript_id=mCT22089.2
FT                   protein_id=mCP7781.2"
FT                   /db_xref="GOA:Q5SVX3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1277172"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVX3"
FT                   /protein_id="EDL40578.1"
FT                   /translation="MEDQEALGFEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGK
FT                   DLLARARTGSGKTAAYAIPMLQSLLHKKATGPVMEQAVRGLVLVPTKELARQAQAMIQQ
FT                   LAAYCARDVRVANVSAAEDSASQRAVLMEKPDVVVGTPSRVLSHLQQNTLKLRDSLELL
FT                   VVDEADLLFSFGFEDELKSLLCHLPRIYQAFLMSATFNEDVQTLKELVLHNPVTLKLQE
FT                   SQLPGPDQLQQFQVVCETEEDKFLLLYALLKLSLIRGKALLFVNTLERGYRLRLFLEQF
FT                   SIPSCVLNGELPLRSRCHIISQFNQGLYDCVIATDAEILGPQVKGKRRGRGSKGNKASD
FT                   PESGVARGIDFHHVSAVLNFDLPPTAEAYVHRAGRTARANNPGIVLTFVLPAEQPFLGK
FT                   IEDLLSGEGEAPILLPYQFQMEEIESFRYRCRDAMRSVTKQAIREARLKEIKEELLHSE
FT                   KLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPAALRGLVHPRKKRRKVPFS
FT                   RKAKKVKAQNPLRDFKHRGKKPKPAAKPS"
FT   gene            complement(3188702..3193206)
FT                   /gene="Tmed4"
FT                   /locus_tag="mCG_21403"
FT                   /note="gene_id=mCG21403.2"
FT   mRNA            complement(join(3188702..3190126,3192075..3192221,
FT                   3192442..3192567,3192732..3192832,3193008..3193206))
FT                   /gene="Tmed4"
FT                   /locus_tag="mCG_21403"
FT                   /product="transmembrane emp24 protein transport domain
FT                   containing 4, transcript variant mCT22097"
FT                   /note="gene_id=mCG21403.2 transcript_id=mCT22097.2 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(3188702..3190126,3192075..3192221,
FT                   3192442..3192567,3192732..3193176))
FT                   /gene="Tmed4"
FT                   /locus_tag="mCG_21403"
FT                   /product="transmembrane emp24 protein transport domain
FT                   containing 4, transcript variant mCT169757"
FT                   /note="gene_id=mCG21403.2 transcript_id=mCT169757.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(join(3189977..3190126,3192075..3192221,
FT                   3192442..3192567,3192732..3192832,3193008..3193167))
FT                   /codon_start=1
FT                   /gene="Tmed4"
FT                   /locus_tag="mCG_21403"
FT                   /product="transmembrane emp24 protein transport domain
FT                   containing 4, isoform CRA_b"
FT                   /note="gene_id=mCG21403.2 transcript_id=mCT22097.2
FT                   protein_id=mCP7823.1 isoform=CRA_b"
FT                   /protein_id="EDL40580.1"
FT                   /translation="MAGVGVGPLQGMVRFGLLVLTVCAACARGLYFHIGETEKRCFIEE
FT                   IPDETMVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTS
FT                   HTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQL
FT                   LDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFE
FT                   AKKLV"
FT   CDS             complement(join(3189977..3190126,3192075..3192221,
FT                   3192442..3192567,3192732..3192815))
FT                   /codon_start=1
FT                   /gene="Tmed4"
FT                   /locus_tag="mCG_21403"
FT                   /product="transmembrane emp24 protein transport domain
FT                   containing 4, isoform CRA_a"
FT                   /note="gene_id=mCG21403.2 transcript_id=mCT169757.0
FT                   protein_id=mCP92570.0 isoform=CRA_a"
FT                   /protein_id="EDL40579.1"
FT                   /translation="MWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTS
FT                   HTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQL
FT                   LDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFE
FT                   AKKLV"
FT   assembly_gap    3200133..3200152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3201771..3202260
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   gene            3209891..3276083
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /note="gene_id=mCG21383.3"
FT   mRNA            join(3209891..3209983,3215242..3215967)
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide),
FT                   transcript variant mCT169754"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT169754.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(3209915..3209983,3215242..3215351,3274682..3274742,
FT                   3274851..3276047)
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide),
FT                   transcript variant mCT169755"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT169755.0 created
FT                   on 19-JUN-2003"
FT   mRNA            join(3209923..3209983,3215242..3215489,3233143..3233334,
FT                   3236120..3236210,3244232..3244276,3253885..3254000,
FT                   3257910..3258064,3258461..3258607,3259190..3259280,
FT                   3259795..3259974,3261847..3261975,3265867..3266046,
FT                   3266450..3266602,3267181..3267283,3267587..3267715,
FT                   3268010..3268160,3268452..3268579,3268667..3268845,
FT                   3269194..3269265,3269958..3270086,3271423..3271495,
FT                   3274226..3274389,3274588..3274742,3274851..3276083)
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide),
FT                   transcript variant mCT169752"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT169752.1 created
FT                   on 19-JUN-2003"
FT   mRNA            join(3209956..3210059,3215242..3215489,3233143..3233334,
FT                   3236333..3236435,3253885..3254000,3257910..3258064,
FT                   3258461..3258607,3259190..3259280,3259795..3259974,
FT                   3261847..3261975,3265867..3266046,3266450..3266602,
FT                   3267181..3267283,3267587..3267715,3268010..3268160,
FT                   3268452..3268579,3268667..3268845,3269194..3269265,
FT                   3269958..3270086,3271423..3271495,3274226..3274389,
FT                   3274588..3274742,3274851..3276083)
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide),
FT                   transcript variant mCT11449"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT11449.4 created
FT                   on 19-JUN-2003"
FT   mRNA            join(3209994..3210059,3215242..3215489,3233143..3233334,
FT                   3236333..3236435,3253885..3254000,3257910..3258064,
FT                   3258461..3258559,3265954..3266046,3266450..3266602,
FT                   3267181..3267283,3267587..3267715,3268010..3268160,
FT                   3268452..3268579,3268667..3268845,3269194..3269265,
FT                   3269958..3270086,3271423..3271495,3274226..3274389,
FT                   3274588..3274742,3275685..3276083)
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide),
FT                   transcript variant mCT169751"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT169751.2 created
FT                   on 19-JUN-2003"
FT   mRNA            join(<3210895..3211004,3215242..3215489,3233143..3233334,
FT                   3236120..3236210,3253885..3254000,3257910..3258064,
FT                   3258461..3258607,3259190..3259280,3259795..3259974,
FT                   3261847..3261975,3265867..3266046,3266450..3266602,
FT                   3267181..3267283,3267587..3267715,3268010..3268160,
FT                   3268452..3268579,3268667..3268845,3269194..3269265,
FT                   3269958..3270086,3271423..3271495,3274226..3274389,
FT                   3274588..3274742,3274851..3275858)
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide),
FT                   transcript variant mCT193934"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT193934.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3210911..3211004,3215242..3215489,3233143..3233334,
FT                   3236120..3236210,3253885..3254000,3257910..3258064,
FT                   3258461..3258607,3259190..3259280,3259795..3259974,
FT                   3261847..3261975,3265867..3266046,3266450..3266602,
FT                   3267181..3267283,3267587..3267715,3268010..3268160,
FT                   3268452..3268579,3268667..3268845,3269194..3269265,
FT                   3269958..3270086,3271423..3271495,3274226..3274389,
FT                   3274588..3274742,3274851..3274971)
FT                   /codon_start=1
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide), isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT193934.0
FT                   protein_id=mCP114903.0 isoform=CRA_f"
FT                   /protein_id="EDL40586.1"
FT                   /translation="ILDVKRSLKEHLYRPKWGQWGQPVFDGGLYVRTCGRLQDKMFHLR
FT                   TCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVAAEPFLSGTSSNYVEEMYCA
FT                   WLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKL
FT                   VEDHLAVQSLIRAYQVRGHHIAKLDPLGISCVNFDDAPVTVSSNVGFYGLHESDLDKVF
FT                   HLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQ
FT                   FTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDY
FT                   VIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDMKYHLGMYHRRINRVTD
FT                   RNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYE
FT                   TFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPE
FT                   AVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKY
FT                   AELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQP
FT                   RSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGLSRILKTRRELVTNRTVDWALAEY
FT                   MAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCN
FT                   SSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIV
FT                   LLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTP
FT                   GNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQD
FT                   PHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAEL
FT                   AWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDT
FT                   AFDLDAFKKFS"
FT   CDS             join(3215268..3215489,3233143..3233334,3236120..3236210,
FT                   3244232..3244276,3253885..3254000,3257910..3258064,
FT                   3258461..3258607,3259190..3259280,3259795..3259974,
FT                   3261847..3261975,3265867..3266046,3266450..3266602,
FT                   3267181..3267283,3267587..3267715,3268010..3268160,
FT                   3268452..3268579,3268667..3268845,3269194..3269265,
FT                   3269958..3270086,3271423..3271495,3274226..3274389,
FT                   3274588..3274742,3274851..3274971)
FT                   /codon_start=1
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT169752.1
FT                   protein_id=mCP92551.1 isoform=CRA_c"
FT                   /protein_id="EDL40583.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSL
FT                   ATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQVRGHHIAKLDPLGISCVNFDDAPVT
FT                   VSSNVDLAVFKERLRMLTVGGFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLE
FT                   MAYCQHIGVEFMFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQR
FT                   KWSSEKRFGLEGCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQI
FT                   FCQFDSKLEAADEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKT
FT                   KAEQFYCGDTEGKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIG
FT                   FTTDPRMARSSPYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLV
FT                   CYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKI
FT                   CEEAFTRSKDEKILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSV
FT                   PVENFTIHGGLSRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTF
FT                   SHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVL
FT                   WEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQM
FT                   CNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPK
FT                   SLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKAR
FT                   NMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTID
FT                   RAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
FT   CDS             join(3215268..3215489,3233143..3233334,3236333..3236435,
FT                   3253885..3254000,3257910..3258064,3258461..3258607,
FT                   3259190..3259280,3259795..3259974,3261847..3261975,
FT                   3265867..3266046,3266450..3266602,3267181..3267283,
FT                   3267587..3267715,3268010..3268160,3268452..3268579,
FT                   3268667..3268845,3269194..3269265,3269958..3270086,
FT                   3271423..3271495,3274226..3274389,3274588..3274742,
FT                   3274851..3274971)
FT                   /codon_start=1
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT11449.4
FT                   protein_id=mCP7852.4 isoform=CRA_a"
FT                   /protein_id="EDL40581.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSL
FT                   ATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPA
FT                   DIISSTDKLGFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEF
FT                   MFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLE
FT                   GCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAA
FT                   DEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTE
FT                   GKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSS
FT                   PYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMD
FT                   EPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDE
FT                   KILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGL
FT                   SRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQN
FT                   VDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNM
FT                   AQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDL
FT                   QEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTS
FT                   FDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRI
FT                   EQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRD
FT                   PAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
FT   CDS             join(3215268..3215351,3274682..3274742,3274851..3274909)
FT                   /codon_start=1
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide), isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT169755.0
FT                   protein_id=mCP92538.0 isoform=CRA_e"
FT                   /protein_id="EDL40585.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPATMTMSSQDFVPPLTVL
FT                   SLSGMLAETRQLLQPLATRKHT"
FT   CDS             join(3215268..3215489,3233143..3233334,3236333..3236435,
FT                   3253885..3254000,3257910..3258064,3258461..3258559,
FT                   3265954..3266038)
FT                   /codon_start=1
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT169751.2
FT                   protein_id=mCP92552.2 isoform=CRA_b"
FT                   /protein_id="EDL40582.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSL
FT                   ATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPA
FT                   DIISSTDKLGFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEF
FT                   MFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLE
FT                   GCEVLIPALKTIIDMSTQMTLKLSCMYARWQLSGETPSTRML"
FT   CDS             3215268..3215507
FT                   /codon_start=1
FT                   /gene="Ogdh"
FT                   /locus_tag="mCG_21383"
FT                   /product="oxoglutarate dehydrogenase (lipoamide), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG21383.3 transcript_id=mCT169754.0
FT                   protein_id=mCP92550.0 isoform=CRA_d"
FT                   /protein_id="EDL40584.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKVRLTE"
FT   assembly_gap    3221664..3221683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3222791..3222810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3294326..3294345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3315041..3315060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3315254..3326510
FT                   /gene="D11Bwg0280e"
FT                   /locus_tag="mCG_121520"
FT                   /note="gene_id=mCG121520.1"
FT   mRNA            join(3315254..3315373,3315653..3315763,3315829..3315957,
FT                   3316317..3316519,3316750..3316933,3317114..3317374,
FT                   3317592..3317771,3318347..3318424,3318641..3318809,
FT                   3319593..3319737,3319812..3320022,3320859..3320964,
FT                   3321187..3321344,3322496..3322563,3322893..3322961,
FT                   3323209..3323453,3323875..3324044,3324129..3324371,
FT                   3325079..3326509)
FT                   /gene="D11Bwg0280e"
FT                   /locus_tag="mCG_121520"
FT                   /product="DNA segment, Chr 11, Brigham & Women's Genetics
FT                   0280e expressed, transcript variant mCT122726"
FT                   /note="gene_id=mCG121520.1 transcript_id=mCT122726.0
FT                   created on 28-MAY-2002"
FT   mRNA            join(3315292..3315373,3315653..3315763,3315843..3315957,
FT                   3316413..3316519,3316750..3316933,3317114..3317374,
FT                   3317592..3317771,3318347..3318424,3318641..3318809,
FT                   3319593..3319737,3319812..3320022,3320859..3320964,
FT                   3321187..3321344,3322496..3322563,3322893..3322961,
FT                   3323209..3323453,3323875..3324044,3324129..3324371,
FT                   3325079..3326510)
FT                   /gene="D11Bwg0280e"
FT                   /locus_tag="mCG_121520"
FT                   /product="DNA segment, Chr 11, Brigham & Women's Genetics
FT                   0280e expressed, transcript variant mCT169941"
FT                   /note="gene_id=mCG121520.1 transcript_id=mCT169941.0
FT                   created on 28-MAY-2002"
FT   CDS             join(3315714..3315763,3315843..3315957,3316413..3316519,
FT                   3316750..3316933,3317114..3317374,3317592..3317771,
FT                   3318347..3318424,3318641..3318809,3319593..3319737,
FT                   3319812..3320022,3320859..3320964,3321187..3321344,
FT                   3322496..3322563,3322893..3322961,3323209..3323453,
FT                   3323875..3324044,3324129..3324371,3325079..3325186)
FT                   /codon_start=1
FT                   /gene="D11Bwg0280e"
FT                   /locus_tag="mCG_121520"
FT                   /product="DNA segment, Chr 11, Brigham & Women's Genetics
FT                   0280e expressed, isoform CRA_b"
FT                   /note="gene_id=mCG121520.1 transcript_id=mCT169941.0
FT                   protein_id=mCP92536.0 isoform=CRA_b"
FT                   /protein_id="EDL40588.1"
FT                   /translation="MNPMNPMKPALPPAPHGDGSFAYESVPWQQSATQPAGSLSVVTTV
FT                   WGVGNATQSQCLGQQAFAEGGASKSYVQQGVYGRGSYPGGSSFTTGYAGGPAGLGLPTH
FT                   AARPSTDFTQAAAAAAMAAAAATATATATATVAALQEKQSQELSQYGAMGTGQSFNSQF
FT                   LQHGGPRGPSVPPGMNPSGMGGMMGPSGLSSMAMTPTRAAGMTPLYAGQRLPQHGYPGP
FT                   PQGQPLPRQGIKRAYSEVYPGQQYLQGGQYAANTAQYAPGPGQPPGPASSYAGHRLPLQ
FT                   QGMAQSLSAPGPTGLHYKPTEQFNGQGASFNGGSISYSQPGLSGPSRSIPGYPSSPLPG
FT                   NPTPPMTPSSNVPYMSPSQEVKSPFLPDLKPGLSSLHPSPSASVHCDELRLTFPVRDGV
FT                   VLEPFRLQHNLAVSNHVFQLRDSVYKTLMLRPDLELQFKCYHHEDRQMNTNWPASVQVS
FT                   VNATPLSIERGDNKTSHKPLYLKHVCQPGRNTIQITVTACCCSHLFVLQLVHRPSVRSV
FT                   LQGLLKKRLLPAEHCITKIKRNFSSGTIPGTPGPNGEDGVEQTAIKVSLKCPITFRRIQ
FT                   LPARGHDCRHIQCFDLESYLQLNCERGTWRCPVCNKTALLEGLEVDQYMLGILIYIQNS
FT                   DYEEITIDPTCSWKPVPVKPDLHIKEEPDGPVLKRCRTVSPAHVLMPSVMEMIAALGPG
FT                   AAPFAPLQPPSAPTPSDYPSQGSNFMGPGTFPESFPSATPTTPNLAEFTQGPPPISYQS
FT                   DIPSSLLTPDKSTPCLPGQMAPAGHLDPAHNPGPPGLHTPNLGPTPGTQLHHPNPSPAS
FT                   RQPLGQPNTGPISELAFNPASGMMGPPSMTGAGEASEPALDLLPELTNPDELLSYLGPP
FT                   DLPTNSSDDLLSLFENN"
FT   CDS             join(3316332..3316519,3316750..3316933,3317114..3317374,
FT                   3317592..3317771,3318347..3318424,3318641..3318809,
FT                   3319593..3319737,3319812..3320022,3320859..3320964,
FT                   3321187..3321344,3322496..3322563,3322893..3322961,
FT                   3323209..3323453,3323875..3324044,3324129..3324371,
FT                   3325079..3325186)
FT                   /codon_start=1
FT                   /gene="D11Bwg0280e"
FT                   /locus_tag="mCG_121520"
FT                   /product="DNA segment, Chr 11, Brigham & Women's Genetics
FT                   0280e expressed, isoform CRA_a"
FT                   /note="gene_id=mCG121520.1 transcript_id=mCT122726.0
FT                   protein_id=mCP59449.1 isoform=CRA_a"
FT                   /protein_id="EDL40587.1"
FT                   /translation="MGPAGSPPGGSMMPGVAGGSSALTSPQCLGQQAFAEGGASKSYVQ
FT                   QGVYGRGSYPGGSSFTTGYAGGPAGLGLPTHAARPSTDFTQAAAAAAMAAAAATATATA
FT                   TATVAALQEKQSQELSQYGAMGTGQSFNSQFLQHGGPRGPSVPPGMNPSGMGGMMGPSG
FT                   LSSMAMTPTRAAGMTPLYAGQRLPQHGYPGPPQGQPLPRQGIKRAYSEVYPGQQYLQGG
FT                   QYAANTAQYAPGPGQPPGPASSYAGHRLPLQQGMAQSLSAPGPTGLHYKPTEQFNGQGA
FT                   SFNGGSISYSQPGLSGPSRSIPGYPSSPLPGNPTPPMTPSSNVPYMSPSQEVKSPFLPD
FT                   LKPGLSSLHPSPSASVHCDELRLTFPVRDGVVLEPFRLQHNLAVSNHVFQLRDSVYKTL
FT                   MLRPDLELQFKCYHHEDRQMNTNWPASVQVSVNATPLSIERGDNKTSHKPLYLKHVCQP
FT                   GRNTIQITVTACCCSHLFVLQLVHRPSVRSVLQGLLKKRLLPAEHCITKIKRNFSSGTI
FT                   PGTPGPNGEDGVEQTAIKVSLKCPITFRRIQLPARGHDCRHIQCFDLESYLQLNCERGT
FT                   WRCPVCNKTALLEGLEVDQYMLGILIYIQNSDYEEITIDPTCSWKPVPVKPDLHIKEEP
FT                   DGPVLKRCRTVSPAHVLMPSVMEMIAALGPGAAPFAPLQPPSAPTPSDYPSQGSNFMGP
FT                   GTFPESFPSATPTTPNLAEFTQGPPPISYQSDIPSSLLTPDKSTPCLPGQMAPAGHLDP
FT                   AHNPGPPGLHTPNLGPTPGTQLHHPNPSPASRQPLGQPNTGPISELAFNPASGMMGPPS
FT                   MTGAGEASEPALDLLPELTNPDELLSYLGPPDLPTNSSDDLLSLFENN"
FT   gene            <3327393..3329086
FT                   /locus_tag="mCG_1041184"
FT                   /note="gene_id=mCG1041184.0"
FT   mRNA            join(<3327393..3327766,3328896..3329086)
FT                   /locus_tag="mCG_1041184"
FT                   /product="mCG1041184"
FT                   /note="gene_id=mCG1041184.0 transcript_id=mCT158888.1
FT                   created on 28-MAY-2002"
FT   CDS             join(<3327643..3327766,3328896..3329062)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041184"
FT                   /product="mCG1041184"
FT                   /note="gene_id=mCG1041184.0 transcript_id=mCT158888.1
FT                   protein_id=mCP59298.1"
FT                   /protein_id="EDL40589.1"
FT                   /translation="THRDQHTASWMREFKACTLKPANSLHLKGGIVGWLVGFPRQARAI
FT                   QRNPVWKNKNKTKQKKNNYVNKSDNKVDQLPHRNTDNRTYRTQTLSRPTGK"
FT   gene            3335473..3339847
FT                   /locus_tag="mCG_121511"
FT                   /note="gene_id=mCG121511.2"
FT   mRNA            join(3335473..3336018,3338131..3338161,3338256..3338344,
FT                   3339143..3339315,3339508..3339847)
FT                   /locus_tag="mCG_121511"
FT                   /product="mCG121511, transcript variant mCT181166"
FT                   /note="gene_id=mCG121511.2 transcript_id=mCT181166.1
FT                   created on 18-JUL-2003"
FT   mRNA            join(3335473..3336009,3338131..3338161,3338256..3338344,
FT                   3339143..3339315,3339508..3339847)
FT                   /locus_tag="mCG_121511"
FT                   /product="mCG121511, transcript variant mCT122717"
FT                   /note="gene_id=mCG121511.2 transcript_id=mCT122717.2
FT                   created on 18-JUL-2003"
FT   mRNA            join(<3335906..3338161,3338256..3338344,3339143..3339315,
FT                   3339508..3339826)
FT                   /locus_tag="mCG_121511"
FT                   /product="mCG121511, transcript variant mCT193925"
FT                   /note="gene_id=mCG121511.2 transcript_id=mCT193925.0
FT                   created on 09-MAR-2004"
FT   CDS             <3335906..3336433
FT                   /codon_start=1
FT                   /locus_tag="mCG_121511"
FT                   /product="mCG121511, isoform CRA_c"
FT                   /note="gene_id=mCG121511.2 transcript_id=mCT193925.0
FT                   protein_id=mCP114912.0 isoform=CRA_c"
FT                   /protein_id="EDL40592.1"
FT                   /translation="DATVAFRRLLQPWSTPPCSSTSRPMTSPWAASPSRSGGQWCSRVG
FT                   SRELWRGRLSRARPDPPVERARVAAPFPDEGPFWEAGEARGGWAGCGQSRAGRGRWGRG
FT                   PSPPVPASPQAHVAASCGAPRGRAHVLRASPFSQPLGPALLRCGAAAPRASSQPAFRSP
FT                   TAFYSDLSRDPA"
FT   CDS             join(3335941..3336018,3338131..3338161,3338256..3338344,
FT                   3339143..3339315,3339508..3339640)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121511"
FT                   /product="mCG121511, isoform CRA_b"
FT                   /note="gene_id=mCG121511.2 transcript_id=mCT181166.1
FT                   protein_id=mCP104088.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CZK9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="MGI:MGI:97749"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CZK9"
FT                   /protein_id="EDL40591.1"
FT                   /translation="MVNPTVFFDITADDEPLGRVSFEVGWLFADKVPKTAENFRALSTG
FT                   EKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMA
FT                   NAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISD
FT                   CGQL"
FT   CDS             join(3335941..3336009,3338131..3338161,3338256..3338344,
FT                   3339143..3339315,3339508..3339640)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121511"
FT                   /product="mCG121511, isoform CRA_a"
FT                   /note="gene_id=mCG121511.2 transcript_id=mCT122717.2
FT                   protein_id=mCP59255.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SVY2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="MGI:MGI:97749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVY2"
FT                   /protein_id="EDL40590.1"
FT                   /translation="MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKG
FT                   FGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAG
FT                   PNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQ
FT                   L"
FT   assembly_gap    3341675..3341694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3345549..3345568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3350066..3350085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3350337..3367520)
FT                   /locus_tag="mCG_121516"
FT                   /note="gene_id=mCG121516.1"
FT   mRNA            complement(join(3350337..3351538,3352202..3352331,
FT                   3356835..3356948,3361078..3361180,3362489..3362566,
FT                   3367430..3367520))
FT                   /locus_tag="mCG_121516"
FT                   /product="mCG121516, transcript variant mCT169745"
FT                   /note="gene_id=mCG121516.1 transcript_id=mCT169745.0
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(3350337..3351538,3352202..3352331,
FT                   3356835..3356948,3362489..3362566,3367430..3367519))
FT                   /locus_tag="mCG_121516"
FT                   /product="mCG121516, transcript variant mCT122722"
FT                   /note="gene_id=mCG121516.1 transcript_id=mCT122722.1
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(3351259..3351538,3352202..3352331,
FT                   3362489..3362566,3367430..3367481))
FT                   /locus_tag="mCG_121516"
FT                   /product="mCG121516, transcript variant mCT180803"
FT                   /note="gene_id=mCG121516.1 transcript_id=mCT180803.0
FT                   created on 27-FEB-2003"
FT   CDS             complement(join(3351477..3351538,3352202..3352331,
FT                   3362489..3362566,3367430..3367432))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121516"
FT                   /product="mCG121516, isoform CRA_c"
FT                   /note="gene_id=mCG121516.1 transcript_id=mCT180803.0
FT                   protein_id=mCP103725.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8R029"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="MGI:MGI:1924855"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R029"
FT                   /protein_id="EDL40595.1"
FT                   /translation="MAGGKAGKDSGKAKAKAVSRSQRAGLQVLELAGNASKDLKVKRIT
FT                   PRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA"
FT   CDS             complement(join(3351477..3351538,3352202..3352331,
FT                   3356835..3356948,3362489..3362566,3367430..3367432))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121516"
FT                   /product="mCG121516, isoform CRA_a"
FT                   /note="gene_id=mCG121516.1 transcript_id=mCT122722.1
FT                   protein_id=mCP59428.1 isoform=CRA_a"
FT                   /db_xref="GOA:B2RVP5"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="MGI:MGI:1924855"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVP5"
FT                   /protein_id="EDL40593.1"
FT                   /translation="MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHG
FT                   RVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKAT
FT                   IAGGGVIPHIHKSLIGKKGQQKTA"
FT   CDS             complement(join(3351477..3351538,3352202..3352331,
FT                   3356835..3356948,3361078..3361167))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121516"
FT                   /product="mCG121516, isoform CRA_b"
FT                   /note="gene_id=mCG121516.1 transcript_id=mCT169745.0
FT                   protein_id=mCP92548.0 isoform=CRA_b"
FT                   /protein_id="EDL40594.1"
FT                   /translation="MYVCAACTYSARGGQTRESDILELDSHMCHFPVGRIHRHLKTRTT
FT                   SHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLI
FT                   KATIAGGGVIPHIHKSLIGKKGQQKTA"
FT   assembly_gap    3362916..3363150
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   gene            3369276..3369744
FT                   /pseudo
FT                   /locus_tag="mCG_121513"
FT                   /note="gene_id=mCG121513.1"
FT   mRNA            3369276..3369744
FT                   /pseudo
FT                   /locus_tag="mCG_121513"
FT                   /note="gene_id=mCG121513.1 transcript_id=mCT122719.1
FT                   created on 28-MAY-2002"
FT   assembly_gap    3374565..3374698
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   gene            3376140..3377099
FT                   /pseudo
FT                   /locus_tag="mCG_49942"
FT                   /note="gene_id=mCG49942.1"
FT   mRNA            3376140..3377099
FT                   /pseudo
FT                   /locus_tag="mCG_49942"
FT                   /note="gene_id=mCG49942.1 transcript_id=mCT50125.1 created
FT                   on 28-MAY-2002"
FT   gene            complement(3378571..3378959)
FT                   /pseudo
FT                   /locus_tag="mCG_49412"
FT                   /note="gene_id=mCG49412.2"
FT   mRNA            complement(3378571..3378959)
FT                   /pseudo
FT                   /locus_tag="mCG_49412"
FT                   /note="gene_id=mCG49412.2 transcript_id=mCT49595.2 created
FT                   on 28-MAY-2002"
FT   gene            complement(3389362..3390894)
FT                   /locus_tag="mCG_148408"
FT                   /note="gene_id=mCG148408.0"
FT   mRNA            complement(3389362..3390894)
FT                   /locus_tag="mCG_148408"
FT                   /product="mCG148408"
FT                   /note="gene_id=mCG148408.0 transcript_id=mCT188671.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3390253..3390624)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148408"
FT                   /product="mCG148408"
FT                   /note="gene_id=mCG148408.0 transcript_id=mCT188671.0
FT                   protein_id=mCP108587.0"
FT                   /db_xref="GOA:Q9D7C3"
FT                   /db_xref="MGI:MGI:1338779"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D7C3"
FT                   /protein_id="EDL40596.1"
FT                   /translation="MVYVGIWRFCKTLFSKPMSLSIEPKSSGVWKVGRLGQKSRNLAVG
FT                   QRDTLFYRVCGFAYFFGRQVYFSYFSVTLIFEIKIVSVFGLFFSPEVRTVVLGIYSCES
FT                   LCRCLTSLVNKVQMTYFVL"
FT   gene            complement(3396548..3397677)
FT                   /gene="Purb"
FT                   /locus_tag="mCG_21399"
FT                   /note="gene_id=mCG21399.1"
FT   mRNA            complement(3396548..3397677)
FT                   /gene="Purb"
FT                   /locus_tag="mCG_21399"
FT                   /product="purine rich element binding protein B"
FT                   /note="gene_id=mCG21399.1 transcript_id=mCT22091.1 created
FT                   on 28-MAY-2002"
FT   CDS             complement(3396668..3397642)
FT                   /codon_start=1
FT                   /gene="Purb"
FT                   /locus_tag="mCG_21399"
FT                   /product="purine rich element binding protein B"
FT                   /note="gene_id=mCG21399.1 transcript_id=mCT22091.1
FT                   protein_id=mCP7792.2"
FT                   /protein_id="EDL40597.1"
FT                   /translation="MADGDSGSERGGGGGGGGGPGGFQPAPRGGGGGGGGPGGEQETQE
FT                   LASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIE
FT                   HYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVN
FT                   RGGGGFGGGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGDEDELAGGPGGGAGG
FT                   PGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFG
FT                   GAFCRYADEMKEIQERQRDKLYERRGGGSGGGDESEGEEVDED"
FT   assembly_gap    3411125..3411144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3414693..3414732
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    3417258..3417741
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   assembly_gap    3419167..3419186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3420195..3420214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3421385..3421404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3430014..>3444416)
FT                   /gene="Myo1g"
FT                   /locus_tag="mCG_145061"
FT                   /note="gene_id=mCG145061.0"
FT   mRNA            complement(join(3430014..3430294,3430369..3430523,
FT                   3431331..3431444,3431652..3431756,3432787..3432931,
FT                   3433610..3433833,3434330..3434537,3434945..3435111,
FT                   3435623..3435755,3435925..3435999,3437929..3437999,
FT                   3438214..3438384,3438556..3438670,3439306..3439451,
FT                   3439536..3439760,3440205..3440321,3440544..3440654,
FT                   3441027..3441080,3441309..3441474,3442191..3442284,
FT                   3442436..3442644,3444199..>3444416))
FT                   /gene="Myo1g"
FT                   /locus_tag="mCG_145061"
FT                   /product="myosin IG"
FT                   /note="gene_id=mCG145061.0 transcript_id=mCT184485.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(3430138..3430294,3430369..3430523,
FT                   3431331..3431444,3431652..3431756,3432787..3432931,
FT                   3433610..3433833,3434330..3434537,3434945..3435111,
FT                   3435623..3435755,3435925..3435999,3437929..3437999,
FT                   3438214..3438384,3438556..3438670,3439306..3439451,
FT                   3439536..3439760,3440205..3440321,3440544..3440654,
FT                   3441027..3441080,3441309..3441474,3442191..3442284,
FT                   3442436..3442644,3444199..>3444398))
FT                   /codon_start=1
FT                   /gene="Myo1g"
FT                   /locus_tag="mCG_145061"
FT                   /product="myosin IG"
FT                   /note="gene_id=mCG145061.0 transcript_id=mCT184485.0
FT                   protein_id=mCP105941.0"
FT                   /protein_id="EDL40598.1"
FT                   /translation="STAVVRQGWASPFCLPLHLCTESSGDLPWMLAVGRMEDEEGPEYG
FT                   KPDFVLLDQLTMEDFMKNLELRFEKGRIYTYIGEVLVSVNPYQELPLYGPEAIAKYQGR
FT                   ELYERPPHLYAVANAAYKAMKRRSRDTCIVISGESGAGKTEASKHIMQYIAAVTNPSQR
FT                   AEVERVKNVLLKSTCVLEAFGNARTNRNHNSSRFGKYMDINFDFKGDPVGGHIHSYLLE
FT                   KSRVLKQHVGERNFHAFYQLLRGSEDQELQGLHLERNPAVYNFTRQGAGLNMGVHNALD
FT                   SDEKSHQGVMEAMRIIGFSPDEVESIHRILAAILHLGNIEFVETEENGPQKGGLEVADE
FT                   ALVGYVAKLTATPRDLVLRTLLARTVASGGREVIEKSHTVAEASYARDACAKAMYQRLF
FT                   EWVVNKINSIMEPRNRDPRCDGKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEKLQQLF
FT                   IQLILKQEQEEYEREGIAWQTIEYFNNATIVELVEQPRRGILAVLDEACSTAGPITDRI
FT                   FLQTLDTHHRHHPHYSSRQLCPTDKTMEFGRDFQIKHYAGDVTYSVEGFIDKNRDSLFQ
FT                   DFKRLLYNSVDPTLRAMWPDGQQDITEVTKRPLTAGTLFKNSMVALVENLASKEPFYVR
FT                   CIKPNEDKVAGRLDEAHCRHQVEYLGLLENVRVRRAGFASRQPYPRFLLRYKMTCEYTW
FT                   PNHLLGSDRDAVSALLEQHGLQGDVAFGHSKLFIRSPRTLVTLEQSRARLIPIIVLLLQ
FT                   KAWRGTLARWHCRRLRAIYTIMRWFRRHKVRAHLIELQRRFQAARQPPLYGRDLVWPTP
FT                   PAVLQPFQDTCRVLFSRWRARQLVKNIPPSDMIQIKAKVAAMGALQGLRQDWGCQRAWA
FT                   RDYLSSDTDNPTASHLFAEQLKALREKDGFGSVLFSSHVRKVNRFRKSRDRALLLTDRY
FT                   LYKLEPGRQYRVMRAVPLEAVTGLSVTSGRDQLVVLHAQGYDDLVVCLHRSQPPLDNRI
FT                   GELVGMLAAHCQGEGRTLEVRVSDCIPLSQRGARRLISVEPRPEQPEPDFQSSRSTFTL
FT                   LWPSH"
FT   gene            complement(3449050..3452205)
FT                   /locus_tag="mCG_21386"
FT                   /note="gene_id=mCG21386.2"
FT   mRNA            complement(join(3449050..3449276,3449814..3449896,
FT                   3451765..3451833,3452007..3452205))
FT                   /locus_tag="mCG_21386"
FT                   /product="mCG21386, transcript variant mCT11451"
FT                   /note="gene_id=mCG21386.2 transcript_id=mCT11451.2 created
FT                   on 28-MAY-2002"
FT   mRNA            complement(join(3449084..3449276,3449814..3449896,
FT                   3451765..3451900))
FT                   /locus_tag="mCG_21386"
FT                   /product="mCG21386, transcript variant mCT169756"
FT                   /note="gene_id=mCG21386.2 transcript_id=mCT169756.0 created
FT                   on 28-MAY-2002"
FT   CDS             complement(3449097..3449276)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21386"
FT                   /product="mCG21386, isoform CRA_a"
FT                   /note="gene_id=mCG21386.2 transcript_id=mCT169756.0
FT                   protein_id=mCP92554.0 isoform=CRA_a"
FT                   /protein_id="EDL40599.1"
FT                   /translation="MQKWRLQSWRERDDSTVKSTDCSSRGPEFNSQQPHGGSQLSVMGI
FT                   RCPPLVCLKTVMVY"
FT   CDS             complement(3449097..3449276)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21386"
FT                   /product="mCG21386, isoform CRA_a"
FT                   /note="gene_id=mCG21386.2 transcript_id=mCT11451.2
FT                   protein_id=mCP7784.2 isoform=CRA_a"
FT                   /protein_id="EDL40600.1"
FT                   /translation="MQKWRLQSWRERDDSTVKSTDCSSRGPEFNSQQPHGGSQLSVMGI
FT                   RCPPLVCLKTVMVY"
FT   assembly_gap    3456722..3456925
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    3458993..3459838
FT                   /estimated_length=846
FT                   /gap_type="unknown"
FT   assembly_gap    3469889..3470095
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   gene            complement(3482002..3482564)
FT                   /pseudo
FT                   /locus_tag="mCG_21396"
FT                   /note="gene_id=mCG21396.1"
FT   mRNA            complement(3482002..3482564)
FT                   /pseudo
FT                   /locus_tag="mCG_21396"
FT                   /note="gene_id=mCG21396.1 transcript_id=mCT22090.1 created
FT                   on 28-MAY-2002"
FT   gene            3484147..>3517299
FT                   /gene="Ccm2"
FT                   /locus_tag="mCG_21376"
FT                   /note="gene_id=mCG21376.2"
FT   mRNA            join(3484147..3484268,3492902..3493075,3507517..3507600,
FT                   3508031..3508214,3512440..3512576,3513761..3513896,
FT                   3516075..3516132,3516610..3516748,3517156..>3517298)
FT                   /gene="Ccm2"
FT                   /locus_tag="mCG_21376"
FT                   /product="cerebral cavernous malformation 2 homolog
FT                   (human), transcript variant mCT13093"
FT                   /note="gene_id=mCG21376.2 transcript_id=mCT13093.1 created
FT                   on 28-MAY-2002"
FT   mRNA            join(3484200..3484268,3492902..3493075,3512440..3512576,
FT                   3513761..3513896,3516075..3516132,3516610..3516748,
FT                   3517156..>3517299)
FT                   /gene="Ccm2"
FT                   /locus_tag="mCG_21376"
FT                   /product="cerebral cavernous malformation 2 homolog
FT                   (human), transcript variant mCT169750"
FT                   /note="gene_id=mCG21376.2 transcript_id=mCT169750.0 created
FT                   on 28-MAY-2002"
FT   CDS             join(3484257..3484268,3492902..3493075,3507517..3507600,
FT                   3508031..3508214,3512440..3512576,3513761..3513896,
FT                   3516075..3516132,3516610..3516748,3517156..>3517298)
FT                   /codon_start=1
FT                   /gene="Ccm2"
FT                   /locus_tag="mCG_21376"
FT                   /product="cerebral cavernous malformation 2 homolog
FT                   (human), isoform CRA_a"
FT                   /note="gene_id=mCG21376.2 transcript_id=mCT13093.1
FT                   protein_id=mCP7820.2 isoform=CRA_a"
FT                   /protein_id="EDL40601.1"
FT                   /translation="MENEPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLALPE
FT                   RVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDKAKRSHQLPGHLTQEHD
FT                   AVLSLSAYNVKLAWRDGEDIILRVPIHDIAAVSYVRDDAAHLVVLKTAQDPGISPSQSL
FT                   CAESSRGLSAGSLSESAVGPVEACCLVIMATESKVAAEELCSLLSQVFQIVYTESTIDF
FT                   LDRAIFDGASTPTHHLSLHSDDSSTKVDMKDSYDADASTFCFPDSGDVGGLPPLPFCMQ
FT                   TSPHSKTVSESELSTSATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCIS
FT                   LRQLYGDSRKFLLLG"
FT   assembly_gap    3487590..3487652
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    3490653..3490812
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    3495635..3495740
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    3497261..3497622
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    3499582..3500398
FT                   /estimated_length=817
FT                   /gap_type="unknown"
FT   CDS             join(3512559..3512576,3513761..3513896,3516075..3516132,
FT                   3516610..3516748,3517156..>3517299)
FT                   /codon_start=1
FT                   /gene="Ccm2"
FT                   /locus_tag="mCG_21376"
FT                   /product="cerebral cavernous malformation 2 homolog
FT                   (human), isoform CRA_b"
FT                   /note="gene_id=mCG21376.2 transcript_id=mCT169750.0
FT                   protein_id=mCP92563.0 isoform=CRA_b"
FT                   /protein_id="EDL40602.1"
FT                   /translation="MATESKVAAEELCSLLSQVFQIVYTESTIDFLDRAIFDGASTPTH
FT                   HLSLHSDDSSTKVDMKDSYDADASTFCFPDSGDVGGLPPLPFCMQTSPHSKTVSESELS
FT                   TSATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCISLRQLYGDSRKFLLL
FT                   GE"
FT   assembly_gap    3518881..3550600
FT                   /estimated_length=31720
FT                   /gap_type="unknown"
FT   assembly_gap    3584920..3584939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3622873..>3626968)
FT                   /locus_tag="mCG_53516"
FT                   /note="gene_id=mCG53516.2"
FT   mRNA            complement(join(3622873..3623116,3623793..3623911,
FT                   3624772..3624836,3626670..3626721,3626814..>3626968))
FT                   /locus_tag="mCG_53516"
FT                   /product="mCG53516"
FT                   /note="gene_id=mCG53516.2 transcript_id=mCT53699.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(3623100..3623116,3623793..3623911,
FT                   3624772..3624836,3626670..3626721,3626814..>3626824))
FT                   /codon_start=1
FT                   /locus_tag="mCG_53516"
FT                   /product="mCG53516"
FT                   /note="gene_id=mCG53516.2 transcript_id=mCT53699.2
FT                   protein_id=mCP30231.2"
FT                   /protein_id="EDL40603.1"
FT                   /translation="GRFWFVTSIDIWEMDPSGSNKTRLRTVMSPLSSDIKVANSRLSLH
FT                   EGLSEKASAHVRTAHLSGEIGLSSNLVFTGLLERRPQSALGL"
FT   assembly_gap    3625995..3626397
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    3630593..3653932
FT                   /estimated_length=23340
FT                   /gap_type="unknown"
FT   assembly_gap    3660296..3660542
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   gene            complement(3676425..3679089)
FT                   /pseudo
FT                   /locus_tag="mCG_21398"
FT                   /note="gene_id=mCG21398.2"
FT   mRNA            complement(3676425..3679089)
FT                   /pseudo
FT                   /locus_tag="mCG_21398"
FT                   /note="gene_id=mCG21398.2 transcript_id=mCT22094.2 created
FT                   on 29-MAY-2002"
FT   gene            complement(3681631..3682464)
FT                   /pseudo
FT                   /locus_tag="mCG_49411"
FT                   /note="gene_id=mCG49411.2"
FT   mRNA            complement(3681631..3682464)
FT                   /pseudo
FT                   /locus_tag="mCG_49411"
FT                   /note="gene_id=mCG49411.2 transcript_id=mCT49594.2 created
FT                   on 29-MAY-2002"
FT   assembly_gap    3684338..3684431
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    3687810..3688908
FT                   /estimated_length=1099
FT                   /gap_type="unknown"
FT   assembly_gap    3689985..3692971
FT                   /estimated_length=2987
FT                   /gap_type="unknown"
FT   assembly_gap    3726729..3728695
FT                   /estimated_length=1967
FT                   /gap_type="unknown"
FT   assembly_gap    3730451..3730470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3736396..3738262)
FT                   /pseudo
FT                   /locus_tag="mCG_49943"
FT                   /note="gene_id=mCG49943.2"
FT   mRNA            complement(3736396..3738262)
FT                   /pseudo
FT                   /locus_tag="mCG_49943"
FT                   /note="gene_id=mCG49943.2 transcript_id=mCT50126.2 created
FT                   on 29-MAY-2002"
FT   assembly_gap    3740792..3740811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3762272..3762291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3764783..3764802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3772857..3772876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3778626..3778645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3780317..3780336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3781455..3781474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3783285..3783304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3784844..3784863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3788255..3788274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3794894..3795263
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    3805961..3806991
FT                   /estimated_length=1031
FT                   /gap_type="unknown"
FT   assembly_gap    3811847..3811866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3812925..3813464
FT                   /estimated_length=540
FT                   /gap_type="unknown"
FT   assembly_gap    3814539..3814558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3815903..3815922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3817469..3817488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3820239..3820258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3830776..3830795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3847616..3847647
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    3859728..3859747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3872066..3872164
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    3880678..3880697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3883306..3883325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3894993..3895150
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    3917728..3918070
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    3928465..3928484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3930303..3930322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3941990..3942086
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    3946366..3946457
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    3953189..3953242
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    3974635..3974939
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   gene            3974940..4090336
FT                   /gene="Adcy1"
FT                   /locus_tag="mCG_140489"
FT                   /note="gene_id=mCG140489.1"
FT   mRNA            join(3974940..3975593,3990454..3990603,4012151..4012269,
FT                   4020581..4020692,4042119..4042246,4049116..4049274,
FT                   4050130..4050271,4050877..4051032,4056517..4056711,
FT                   4056876..4056973,4058344..4058428,4061338..4061427,
FT                   4061798..4062051,4062615..4062741,4072042..4072158,
FT                   4073115..4073261,4073688..4073786,4077248..4077362,
FT                   4078900..4079024,4081249..4090336)
FT                   /gene="Adcy1"
FT                   /locus_tag="mCG_140489"
FT                   /product="adenylate cyclase 1, transcript variant
FT                   mCT169749"
FT                   /note="gene_id=mCG140489.1 transcript_id=mCT169749.1
FT                   created on 25-SEP-2003"
FT   CDS             join(3974958..3975593,3990454..3990603,4012151..4012269,
FT                   4020581..4020692,4042119..4042246,4049116..4049274,
FT                   4050130..4050271,4050877..4051032,4056517..4056711,
FT                   4056876..4056973,4058344..4058428,4061338..4061427,
FT                   4061798..4062051,4062615..4062741,4072042..4072158,
FT                   4073115..4073261,4073688..4073786,4077248..4077362,
FT                   4078900..4079024,4081249..4081551)
FT                   /codon_start=1
FT                   /gene="Adcy1"
FT                   /locus_tag="mCG_140489"
FT                   /product="adenylate cyclase 1, isoform CRA_a"
FT                   /note="gene_id=mCG140489.1 transcript_id=mCT169749.1
FT                   protein_id=mCP92537.0 isoform=CRA_a"
FT                   /protein_id="EDL40604.1"
FT                   /translation="MAGAPRGQGGGGGAGEPGGAERAAGPGGRRGFRACGEEFACPELE
FT                   ALFRGYTLRLEQAATLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCILFLAL
FT                   FVVTNVRSLQVSQLQQVGQLALFFSLTFALLCCPFALGGPARSSAGGAMGSTVAEQGVW
FT                   QLLLVTFVSYALLPVRSLLAIGFGLVVAASHLLVTAALVPAKRPRLWRTLGANALLFFG
FT                   VNMYGVFVRILTERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKED
FT                   FLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATE
FT                   NHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLH
FT                   TGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHG
FT                   HERNTFLRTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMF
FT                   KAEIPFSNVMTCEDDDKRRALRTASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQ
FT                   TELEMADLNFFTLKYKHVEREQKYHQLQDEYFTSAVVLALILAALFGLIYLLVIPQSVA
FT                   VLLLLVFSICFLVACTLYLHITRVQCFPGCLTIQIRTALCVFIVVLIYSVAQGCVVGCL
FT                   PWAWSSQSNSSLVVLAAGGRRTVLPALPCESAHHALLCCLVGTLPLAIFLRVSSLPKMI
FT                   LLSGLTTSYILVLELSGYTKVGGGALSGRSYEPIMAILLFSCTLALHARQVDVRLRLDY
FT                   LWAAQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFA
FT                   SIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVG
FT                   LAPTAGTRAKKSISSHLCTLADFAIDMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIG
FT                   ARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLKRCSYQFVCRGKVSVKGKGEM
FT                   LTYFLEGRTDGNSSHGRTFRLERRMCPYGRGGGQARRPPLCPAAGPPVRPGLPPAPTSQ
FT                   YLSSTAAGKEA"
FT   assembly_gap    3987384..3987929
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    4022581..4022895
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    4030877..4030925
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    4037701..4037720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(4071718..4071869,4071981..4072158,4073115..4073261,
FT                   4073688..4073786,4077248..4077362,4078076..4078125,
FT                   4078900..4079024,4081249..4090336)
FT                   /gene="Adcy1"
FT                   /locus_tag="mCG_140489"
FT                   /product="adenylate cyclase 1, transcript variant
FT                   mCT186681"
FT                   /note="gene_id=mCG140489.1 transcript_id=mCT186681.0
FT                   created on 25-SEP-2003"
FT   CDS             join(4072024..4072158,4073115..4073261,4073688..4073786,
FT                   4077248..4077362,4078076..4078125,4078900..4078932)
FT                   /codon_start=1
FT                   /gene="Adcy1"
FT                   /locus_tag="mCG_140489"
FT                   /product="adenylate cyclase 1, isoform CRA_b"
FT                   /note="gene_id=mCG140489.1 transcript_id=mCT186681.0
FT                   protein_id=mCP107920.0 isoform=CRA_b"
FT                   /protein_id="EDL40605.1"
FT                   /translation="MTSDPQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNM
FT                   DLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKDFYKDL
FT                   EKIKTIGSTYMAAVGLAPTAGTRAKKSISSHLCTLADFAIDMFDVLDEINYQSYNDFVL
FT                   RVDPGPWLHFEQFKQRQEIASTLAPWLLE"
FT   assembly_gap    4091092..4092204
FT                   /estimated_length=1113
FT                   /gap_type="unknown"
FT   gene            complement(4094758..>4097891)
FT                   /locus_tag="mCG_116239"
FT                   /note="gene_id=mCG116239.1"
FT   mRNA            complement(join(4094758..4095062,4096230..4096442,
FT                   4097694..>4097891))
FT                   /locus_tag="mCG_116239"
FT                   /product="mCG116239"
FT                   /note="gene_id=mCG116239.1 transcript_id=mCT117356.1
FT                   created on 29-MAY-2002"
FT   CDS             complement(join(4096266..4096442,4097694..>4097891))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116239"
FT                   /product="mCG116239"
FT                   /note="gene_id=mCG116239.1 transcript_id=mCT117356.1
FT                   protein_id=mCP59447.1"
FT                   /protein_id="EDL40606.1"
FT                   /translation="SEQEGPHSDHLAAEEGPCMSASLNQEQHQKKTEALQATSWPKNSG
FT                   MPGISDIACRKRRDPKKRAAAMQRLRQWEAQMLQEIEEAVHHELTIQEGVLSTELPGQA
FT                   QGPLSISTVRIDPQAPAALA"
FT   gene            4109368..4114121
FT                   /gene="Igfbp1"
FT                   /locus_tag="mCG_16621"
FT                   /note="gene_id=mCG16621.1"
FT   mRNA            join(4109368..4109911,4111314..4111498,4112349..4112477,
FT                   4113466..4114121)
FT                   /gene="Igfbp1"
FT                   /locus_tag="mCG_16621"
FT                   /product="insulin-like growth factor binding protein 1,
FT                   transcript variant mCT19350"
FT                   /note="gene_id=mCG16621.1 transcript_id=mCT19350.2 created
FT                   on 29-MAY-2002"
FT   mRNA            join(4109368..4109911,4111314..4111498,4112349..4112469,
FT                   4113992..4114119)
FT                   /gene="Igfbp1"
FT                   /locus_tag="mCG_16621"
FT                   /product="insulin-like growth factor binding protein 1,
FT                   transcript variant mCT169748"
FT                   /note="gene_id=mCG16621.1 transcript_id=mCT169748.0 created
FT                   on 29-MAY-2002"
FT   CDS             join(4109539..4109911,4111314..4111498,4112349..4112469,
FT                   4113992..4114083)
FT                   /codon_start=1
FT                   /gene="Igfbp1"
FT                   /locus_tag="mCG_16621"
FT                   /product="insulin-like growth factor binding protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16621.1 transcript_id=mCT169748.0
FT                   protein_id=mCP92562.0 isoform=CRA_a"
FT                   /protein_id="EDL40607.1"
FT                   /translation="MPEFLTVVSWPFLILLSFQIGVAAGAPQPWHCAPCTAERLGLCPP
FT                   VPASCPEISRPAGCGCCPTCALPMGAACGVATARCAQGLSCRALPGEPRPLHALTRGQG
FT                   ACVPEPAAPATSTLFSSQHEEAKAAVVSADELSESPEMTEEQLLDSFHLMAPSREDQPI
FT                   LWNAISTYSSMRAREIADLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKN
FT                   GFYHNLCLMHICWESSDADCVTKAERGKLRPIHC"
FT   CDS             join(4109539..4109911,4111314..4111498,4112349..4112477,
FT                   4113466..4113597)
FT                   /codon_start=1
FT                   /gene="Igfbp1"
FT                   /locus_tag="mCG_16621"
FT                   /product="insulin-like growth factor binding protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG16621.1 transcript_id=mCT19350.2
FT                   protein_id=mCP7796.2 isoform=CRA_b"
FT                   /db_xref="GOA:P47876"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR009168"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="InterPro:IPR022321"
FT                   /db_xref="InterPro:IPR022322"
FT                   /db_xref="MGI:MGI:96436"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47876"
FT                   /protein_id="EDL40608.1"
FT                   /translation="MPEFLTVVSWPFLILLSFQIGVAAGAPQPWHCAPCTAERLGLCPP
FT                   VPASCPEISRPAGCGCCPTCALPMGAACGVATARCAQGLSCRALPGEPRPLHALTRGQG
FT                   ACVPEPAAPATSTLFSSQHEEAKAAVVSADELSESPEMTEEQLLDSFHLMAPSREDQPI
FT                   LWNAISTYSSMRAREIADLKKWKEPCQRELYKVLERLAAAQQKAGDEIYKFYLPNCNKN
FT                   GFYHSKQCETSLDGEAGLCWCVYPWSGKKIPGSLETRGDPNCHQYFNVHN"
FT   gene            complement(4117666..4125462)
FT                   /gene="Igfbp3"
FT                   /locus_tag="mCG_16620"
FT                   /note="gene_id=mCG16620.2"
FT   mRNA            complement(join(4117666..4119086,4119949..4120088,
FT                   4121039..4121158,4121599..4121825,4124965..4125106,
FT                   4125325..4125462))
FT                   /gene="Igfbp3"
FT                   /locus_tag="mCG_16620"
FT                   /product="insulin-like growth factor binding protein 3,
FT                   transcript variant mCT19349"
FT                   /note="gene_id=mCG16620.2 transcript_id=mCT19349.2 created
FT                   on 29-MAY-2002"
FT   mRNA            complement(join(4119431..4120088,4121039..4121158,
FT                   4121599..4121825,4124965..4125106,4125325..4125462))
FT                   /gene="Igfbp3"
FT                   /locus_tag="mCG_16620"
FT                   /product="insulin-like growth factor binding protein 3,
FT                   transcript variant mCT169747"
FT                   /note="gene_id=mCG16620.2 transcript_id=mCT169747.0 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(4119963..4120088,4121039..4121158,
FT                   4121599..4121825,4124965..4125106,4125325..4125408))
FT                   /codon_start=1
FT                   /gene="Igfbp3"
FT                   /locus_tag="mCG_16620"
FT                   /product="insulin-like growth factor binding protein 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16620.2 transcript_id=mCT169747.0
FT                   protein_id=mCP92560.0 isoform=CRA_a"
FT                   /protein_id="EDL40609.1"
FT                   /translation="MHPARPALWAAALTALTLLRGPPVARAGRCGTGLRCQPRPAEQYP
FT                   LRALLNGRGFCANASAAGSLSTYLPSQPAPGNISESEEEHNAGSVESQVVPSTHRVTDS
FT                   KFHPLHAKMDVIKKGHARDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN
FT                   HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYDTKGKD
FT                   DVHCLSVQSQ"
FT   CDS             complement(join(4119963..4120088,4121039..4121158,
FT                   4121599..4121825,4124965..4125106,4125325..4125408))
FT                   /codon_start=1
FT                   /gene="Igfbp3"
FT                   /locus_tag="mCG_16620"
FT                   /product="insulin-like growth factor binding protein 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG16620.2 transcript_id=mCT19349.2
FT                   protein_id=mCP7793.2 isoform=CRA_a"
FT                   /protein_id="EDL40610.1"
FT                   /translation="MHPARPALWAAALTALTLLRGPPVARAGRCGTGLRCQPRPAEQYP
FT                   LRALLNGRGFCANASAAGSLSTYLPSQPAPGNISESEEEHNAGSVESQVVPSTHRVTDS
FT                   KFHPLHAKMDVIKKGHARDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN
FT                   HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYDTKGKD
FT                   DVHCLSVQSQ"
FT   assembly_gap    4125107..4125323
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    4131094..4131113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4149045..4149292
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   gene            complement(4182058..4201964)
FT                   /locus_tag="mCG_148407"
FT                   /note="gene_id=mCG148407.0"
FT   mRNA            complement(join(4182058..4182626,4201094..4201964))
FT                   /locus_tag="mCG_148407"
FT                   /product="mCG148407"
FT                   /note="gene_id=mCG148407.0 transcript_id=mCT188670.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    4182744..4182834
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    4184696..4184715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(4201132..4201302)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148407"
FT                   /product="mCG148407"
FT                   /note="gene_id=mCG148407.0 transcript_id=mCT188670.0
FT                   protein_id=mCP108585.0"
FT                   /protein_id="EDL40611.1"
FT                   /translation="MGMACRTWFAGAILTPDICGCHNESCRLTEMQFILACAFGSLKPT
FT                   SLQKKKNFFKL"
FT   assembly_gap    4217692..4217720
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    4264713..4264934
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    4267926..4268149
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    4272733..4273474
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    4283100..4283119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4284330..4284349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4308717..4308736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4310972..4311699
FT                   /estimated_length=728
FT                   /gap_type="unknown"
FT   assembly_gap    4313571..4313590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4314724..4314743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4318157..4318176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4330004..4330023
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4331289..4331308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4332313..4332332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4358821..4364811
FT                   /estimated_length=5991
FT                   /gap_type="unknown"
FT   assembly_gap    4381579..4381800
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    4403621..4403793
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    4411594..4412516
FT                   /estimated_length=923
FT                   /gap_type="unknown"
FT   assembly_gap    4414693..4415654
FT                   /estimated_length=962
FT                   /gap_type="unknown"
FT   assembly_gap    4437607..4438621
FT                   /estimated_length=1015
FT                   /gap_type="unknown"
FT   assembly_gap    4469005..4469024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4470294..4470313
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4490753..4490772
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4500826..4500845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4505146..4508406
FT                   /estimated_length=3261
FT                   /gap_type="unknown"
FT   assembly_gap    4510656..4513912
FT                   /estimated_length=3257
FT                   /gap_type="unknown"
FT   gene            <4538503..4539058
FT                   /locus_tag="mCG_1041136"
FT                   /note="gene_id=mCG1041136.1"
FT   mRNA            <4538503..4539058
FT                   /locus_tag="mCG_1041136"
FT                   /product="mCG1041136"
FT                   /note="gene_id=mCG1041136.1 transcript_id=mCT158840.1
FT                   created on 29-MAY-2002"
FT   CDS             <4538786..4539019
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041136"
FT                   /product="mCG1041136"
FT                   /note="gene_id=mCG1041136.1 transcript_id=mCT158840.1
FT                   protein_id=mCP59377.1"
FT                   /protein_id="EDL40612.1"
FT                   /translation="TSHQISDSLFYNLTGQENTDPNLSSLNSFNPKYWAMCTARSITKQ
FT                   QAYQFVIASISVCQTSNIKLLYPMCIESLSFH"
FT   assembly_gap    4543863..4543882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4555205..4556320
FT                   /estimated_length=1116
FT                   /gap_type="unknown"
FT   assembly_gap    4571069..4571088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4571993..>4577596)
FT                   /locus_tag="mCG_1041193"
FT                   /note="gene_id=mCG1041193.1"
FT   mRNA            complement(join(4571993..4572230,4577321..>4577596))
FT                   /locus_tag="mCG_1041193"
FT                   /product="mCG1041193"
FT                   /note="gene_id=mCG1041193.1 transcript_id=mCT158897.1
FT                   created on 29-MAY-2002"
FT   assembly_gap    4572233..4572252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4573848..4577320
FT                   /estimated_length=3473
FT                   /gap_type="unknown"
FT   CDS             complement(4577344..>4577502)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041193"
FT                   /product="mCG1041193"
FT                   /note="gene_id=mCG1041193.1 transcript_id=mCT158897.1
FT                   protein_id=mCP59435.1"
FT                   /protein_id="EDL40613.1"
FT                   /translation="VRGYLKEKNHNSRRWEGRCWKIPKIPDKSHKEVQSHRCHKEYLVI
FT                   VNSQDSL"
FT   assembly_gap    4601437..4601456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4612503..4612522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4631358..4636209
FT                   /estimated_length=4852
FT                   /gap_type="unknown"
FT   assembly_gap    4649282..4649301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4658380..4658399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4666972..4671104
FT                   /estimated_length=4133
FT                   /gap_type="unknown"
FT   assembly_gap    4692699..4693008
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    4695805..4695878
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    4721130..4721149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4749802..4749919
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    4776314..4777223
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    4790922..4791094
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    4801186..4805115
FT                   /estimated_length=3930
FT                   /gap_type="unknown"
FT   assembly_gap    4813628..4813807
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            4819782..4822281
FT                   /pseudo
FT                   /locus_tag="mCG_1041195"
FT                   /note="gene_id=mCG1041195.1"
FT   mRNA            join(4819782..4820448,4820482..4820766,4820808..4822281)
FT                   /pseudo
FT                   /locus_tag="mCG_1041195"
FT                   /note="gene_id=mCG1041195.1 transcript_id=mCT158899.1
FT                   created on 07-MAR-2003"
FT   assembly_gap    4842711..4842914
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    4870627..4870646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4871729..4871748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4873696..4879694
FT                   /estimated_length=5999
FT                   /gap_type="unknown"
FT   assembly_gap    4904159..4904209
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            complement(4907000..4907537)
FT                   /pseudo
FT                   /locus_tag="mCG_1041137"
FT                   /note="gene_id=mCG1041137.1"
FT   mRNA            complement(join(4907000..4907250,4907446..4907537))
FT                   /pseudo
FT                   /locus_tag="mCG_1041137"
FT                   /note="gene_id=mCG1041137.1 transcript_id=mCT158841.1
FT                   created on 29-MAY-2002"
FT   assembly_gap    4928846..4928906
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    4938692..4938736
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    4964962..4964981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4968607..4968956
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    4988870..4988904
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    5039543..5039562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5056260..5056767
FT                   /estimated_length=508
FT                   /gap_type="unknown"
FT   assembly_gap    5084667..5084712
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    5104736..5104755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5111959..5112250
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    5131931..5131950
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5135051..5135813
FT                   /estimated_length=763
FT                   /gap_type="unknown"
FT   assembly_gap    5138430..5138591
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    5147149..5148455
FT                   /estimated_length=1307
FT                   /gap_type="unknown"
FT   assembly_gap    5168793..5168812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5182849..5183042
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   gene            5233125..5234040
FT                   /locus_tag="mCG_1041138"
FT                   /note="gene_id=mCG1041138.0"
FT   mRNA            join(5233125..5233254,5233294..5233767,5233834..5234040)
FT                   /locus_tag="mCG_1041138"
FT                   /product="mCG1041138"
FT                   /note="gene_id=mCG1041138.0 transcript_id=mCT158842.1
FT                   created on 29-MAY-2002"
FT   CDS             join(5233674..5233767,5233834..5233886)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041138"
FT                   /product="mCG1041138"
FT                   /note="gene_id=mCG1041138.0 transcript_id=mCT158842.1
FT                   protein_id=mCP59388.1"
FT                   /protein_id="EDL40614.1"
FT                   /translation="MLHDIYNWNHLRSALRLLHQCVFTLQPLEQHKRKKERKKERKNEP
FT                   RSL"
FT   assembly_gap    5265506..5265525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5277365..5278078)
FT                   /pseudo
FT                   /locus_tag="mCG_14680"
FT                   /note="gene_id=mCG14680.2"
FT   mRNA            complement(5277365..5278078)
FT                   /pseudo
FT                   /locus_tag="mCG_14680"
FT                   /note="gene_id=mCG14680.2 transcript_id=mCT19199.2 created
FT                   on 29-MAY-2002"
FT   assembly_gap    5311980..5312276
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   gene            complement(5325756..>5472127)
FT                   /locus_tag="mCG_53160"
FT                   /note="gene_id=mCG53160.2"
FT   mRNA            complement(join(5325756..5328732,5329811..5329837,
FT                   5329941..5330009,5331198..5331366,5338253..5338330,
FT                   5339264..5339341,5339964..5340059,5343008..5343139,
FT                   5344388..5344474,5345173..5345813,5347397..5347568,
FT                   5362813..5362934,5363832..5363966,5375308..5375593,
FT                   5376588..5376748,5389422..5390666,5415519..5415623,
FT                   5416443..5416508,5416761..5416890,5428263..5428338,
FT                   5429095..5429155,5429788..5429890,5438225..5438347,
FT                   5440313..5440363,5441965..5442136,5442706..5442755,
FT                   5472104..>5472127))
FT                   /locus_tag="mCG_53160"
FT                   /product="mCG53160"
FT                   /note="gene_id=mCG53160.2 transcript_id=mCT53343.2 created
FT                   on 29-MAY-2002"
FT   assembly_gap    5335236..5335498
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   CDS             complement(join(5345785..5345813,5347397..5347568,
FT                   5362813..5362934,5363832..5363966,5375308..5375593,
FT                   5376588..5376748,5389422..5390666,5415519..5415623,
FT                   5416443..5416508,5416761..5416890,5428263..5428338,
FT                   5429095..5429155,5429788..5429890,5438225..5438347,
FT                   5440313..5440363,5441965..5442136,5442706..5442755,
FT                   5472104..>5472127))
FT                   /codon_start=1
FT                   /locus_tag="mCG_53160"
FT                   /product="mCG53160"
FT                   /note="gene_id=mCG53160.2 transcript_id=mCT53343.2
FT                   protein_id=mCP30206.2"
FT                   /protein_id="EDL40615.1"
FT                   /translation="VVTPCSVQAPESPTPAVLRCDKPSRTVVLSPAMEDSHELDLTYVT
FT                   ERIIAVSFPASCSEESYLHSLQEVTRMLKCKHGDNYLVLNLSEKRYDLTKLNPKIMDVG
FT                   WPELHAPPLDKMCTICKAQESWLNNDPQHVVVIHCRFLSGLLSGAMKMNTSPLFLHFVI
FT                   MHGVPSFDTGGACRPFLKLYQAMQPVYTSGIYNVGSENPSRIRIAIEPAQLLKGDIMVK
FT                   CYHKKFRSATRDVIFRLQFHTGAVQGYGLLFGKEELDSACKDDRFPDYGKIELVFSATP
FT                   EKIQGSEHLYSDQGVTVDYNTADPLIRWDSYENMSADGEVLHTQGPVDGSLYAKVRKKS
FT                   ASDTGIPSSPQGMPATSSPDHGDHTLSVSSDSGHSTASARTDKTEERLTPGARRGLSPQ
FT                   EKAELDQLLSGFGLEDSASSHKDMTDMRSKYSGTRHVVPAQVHVNGDAALKDRETDILD
FT                   DEMPHHDLHSVDSLGTLSSSEGPQSTHLGPFTCLKSSQNSLLSDGFGNGVAEDHNGVLS
FT                   PDLGLGVDTLYDRERMCGGREQKPLQPLLRKPSAPTPVQAYGQSNYSTQTWVRQQQMVA
FT                   AHQYSFASDGEARLGSRSTVDNTGLAQPPPHIPVTPNRGASSRVAVQRGISNGPNPPDT
FT                   QQLCPGKALQPRFQDDRVTNGVHQEPNTGSSPGSPTLDIDQSIEQLNRLILELDPTFEP
FT                   IPTHLNALGISAVCPDGVGSGLRCSGRLDSVDGPGRSPGRQGDDPIGGRLRKLSIGQYD
FT                   NDAASQVTFSKCGWGKAGVDPAPSLGSFSSPEDIKETVITAYPSDLNMIDGRIPNSKES
FT                   SMCLTPAFPVSPETPYGKKEEKLAGYNLVLQDGGVTVSFVVLFCPVKTSPRYPPFSPPE
FT                   PQLSSPASLHKGREACDNEVKSTLAHAGQEATLGEHEKLLFETFRENVLEVSRSSHLQR
FT                   WVGDAIGPDSAPGAAGDRPCRVPLTRLTDSRPFHGLTGPQNHEAAQRLLATLWGCQRAP
FT                   LDPNPPCFGLICLQHPTFSRCLHHPARFQAMALARGERARLLQNASG"
FT   assembly_gap    5360403..5360422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5364612..5364631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5365635..5365654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5367198..5367217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5373410..5373429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5384880..5385132
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    5422755..5422830
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    5430415..5430706
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    5432372..5433746
FT                   /estimated_length=1375
FT                   /gap_type="unknown"
FT   assembly_gap    5435543..5435562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5439907..5439926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5494150..5494289
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    5510099..5510197
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    5523552..5523917
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    5527384..5527403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5528521..5528540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5536347..5536370
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    5562741..5562760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5566332..5566351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5597774..5597793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5608918..5608937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5641283..5641657
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   assembly_gap    5698549..5703133
FT                   /estimated_length=4585
FT                   /gap_type="unknown"
FT   gene            complement(5714724..>5722888)
FT                   /locus_tag="mCG_14681"
FT                   /note="gene_id=mCG14681.2"
FT   mRNA            complement(join(5714724..5714885,5721862..5722032,
FT                   5722862..>5722888))
FT                   /locus_tag="mCG_14681"
FT                   /product="mCG14681"
FT                   /note="gene_id=mCG14681.2 transcript_id=mCT19200.2 created
FT                   on 29-MAY-2002"
FT   CDS             complement(join(5714853..5714885,5721862..5722032,
FT                   5722862..>5722888))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14681"
FT                   /product="mCG14681"
FT                   /note="gene_id=mCG14681.2 transcript_id=mCT19200.2
FT                   protein_id=mCP7873.1"
FT                   /protein_id="EDL40616.1"
FT                   /translation="EETEVATDHIYYLDEFSSLLDELLMKIDGLSDSLELSILENQWKR
FT                   ALESRAGDSPPVGSSEYQATGVSGPLAAESE"
FT   assembly_gap    5726427..5726446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5741821..5759276
FT                   /estimated_length=17456
FT                   /gap_type="unknown"
FT   assembly_gap    5763011..5763800
FT                   /estimated_length=790
FT                   /gap_type="unknown"
FT   gene            complement(5763801..5764105)
FT                   /pseudo
FT                   /locus_tag="mCG_1041156"
FT                   /note="gene_id=mCG1041156.1"
FT   mRNA            complement(5763801..5764105)
FT                   /pseudo
FT                   /locus_tag="mCG_1041156"
FT                   /note="gene_id=mCG1041156.1 transcript_id=mCT158860.1
FT                   created on 30-MAY-2002"
FT   assembly_gap    5772119..5772523
FT                   /estimated_length=405
FT                   /gap_type="unknown"
FT   assembly_gap    5779002..5779583
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    5787423..5787442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5792275..5794889
FT                   /estimated_length=2615
FT                   /gap_type="unknown"
FT   assembly_gap    5803771..5803790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5812240..5812447
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    5836521..5837132
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    5857908..5857927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5862341..5880406)
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /note="gene_id=mCG16615.2"
FT   mRNA            complement(join(5862341..5865542,5865980..5866128,
FT                   5867833..5867952,5869276..5869375,5875187..5875261,
FT                   5876693..5876803,5879456..5879632,5879712..5879839,
FT                   5880274..5880406))
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /product="Hus1 homolog (S. pombe), transcript variant
FT                   mCT19158"
FT                   /note="gene_id=mCG16615.2 transcript_id=mCT19158.2 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(5864552..5866128,5867833..5867952,
FT                   5869276..5869375,5875187..5875261,5876693..5876800,
FT                   5879456..5879632,5879712..>5880344))
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /product="Hus1 homolog (S. pombe), transcript variant
FT                   mCT193944"
FT                   /note="gene_id=mCG16615.2 transcript_id=mCT193944.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5864877..5866128,5867833..5867952,
FT                   5869276..5869375,5875187..5875261,5876693..5876800,
FT                   5879456..5879632,5879712..5879839,5880274..>5880353))
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /product="Hus1 homolog (S. pombe), transcript variant
FT                   mCT193945"
FT                   /note="gene_id=mCG16615.2 transcript_id=mCT193945.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(5865826..5866128,5867833..5867952,
FT                   5869276..5869375,5875187..5875261,5876693..5876803,
FT                   5879456..5879632,5879712..5879839,5880274..5880406))
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /product="Hus1 homolog (S. pombe), transcript variant
FT                   mCT169746"
FT                   /note="gene_id=mCG16615.2 transcript_id=mCT169746.0 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(5866046..5866128,5867833..5867952,
FT                   5869276..5869375,5875187..5875261,5876693..5876800,
FT                   5879456..5879632,5879712..5879839,5880274..>5880352))
FT                   /codon_start=1
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /product="Hus1 homolog (S. pombe), isoform CRA_c"
FT                   /note="gene_id=mCG16615.2 transcript_id=mCT193945.0
FT                   protein_id=mCP114901.0 isoform=CRA_c"
FT                   /protein_id="EDL40620.1"
FT                   /translation="NAAVGLVSAMKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISP
FT                   EKLNFILCDKLASGGVSMWCELEQENFFSEFQMEGVSEENNEIYLELTSENLSRALKTA
FT                   QNSRALKIKLTNKHFPCLTVSVELVSSSSSSRIVVHDIPIKVLPRRLWKDLQEPSIPDC
FT                   DVSICLPALKMMKSVVEKMRNISNQLVIEANLKGELNLKIETELVCVTTHFKDLENPLL
FT                   PSDSVSQNRHPEDMAKVHIDIKKLLQFLAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSL
FT                   QYFIPALS"
FT   CDS             complement(join(5866046..5866128,5867833..5867952,
FT                   5869276..5869375,5875187..5875261,5876693..5876803,
FT                   5879456..5879632,5879712..5879839,5880274..5880325))
FT                   /codon_start=1
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /product="Hus1 homolog (S. pombe), isoform CRA_a"
FT                   /note="gene_id=mCG16615.2 transcript_id=mCT169746.0
FT                   protein_id=mCP92539.0 isoform=CRA_a"
FT                   /protein_id="EDL40617.1"
FT                   /translation="MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCD
FT                   KLASGGVSMWCELEQENFFSEFQMEGVSEENNEIYLELTSENLSRALKTAQNSRALKIK
FT                   LTNKHFPCLTVSVELQVSSSSSSRIVVHDIPIKVLPRRLWKDLQEPSIPDCDVSICLPA
FT                   LKMMKSVVEKMRNISNQLVIEANLKGELNLKIETELVCVTTHFKDLENPLLPSDSVSQN
FT                   RHPEDMAKVHIDIKKLLQFLAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSLQYFIPALS
FT                   "
FT   CDS             complement(join(5866046..5866128,5867833..5867952,
FT                   5869276..5869375,5875187..5875261,5876693..5876803,
FT                   5879456..5879632,5879712..5879839,5880274..5880325))
FT                   /codon_start=1
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /product="Hus1 homolog (S. pombe), isoform CRA_a"
FT                   /note="gene_id=mCG16615.2 transcript_id=mCT19158.2
FT                   protein_id=mCP7791.2 isoform=CRA_a"
FT                   /protein_id="EDL40618.1"
FT                   /translation="MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCD
FT                   KLASGGVSMWCELEQENFFSEFQMEGVSEENNEIYLELTSENLSRALKTAQNSRALKIK
FT                   LTNKHFPCLTVSVELQVSSSSSSRIVVHDIPIKVLPRRLWKDLQEPSIPDCDVSICLPA
FT                   LKMMKSVVEKMRNISNQLVIEANLKGELNLKIETELVCVTTHFKDLENPLLPSDSVSQN
FT                   RHPEDMAKVHIDIKKLLQFLAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSLQYFIPALS
FT                   "
FT   CDS             complement(join(5866046..5866128,5867833..5867952,
FT                   5869276..5869375,5875187..5875261,5876693..5876800,
FT                   5879456..5879632,5879712..>5879864))
FT                   /codon_start=1
FT                   /gene="Hus1"
FT                   /locus_tag="mCG_16615"
FT                   /product="Hus1 homolog (S. pombe), isoform CRA_b"
FT                   /note="gene_id=mCG16615.2 transcript_id=mCT193944.0
FT                   protein_id=mCP114900.0 isoform=CRA_b"
FT                   /protein_id="EDL40619.1"
FT                   /translation="LLFTPLAVGVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSM
FT                   WCELEQENFFSEFQMEGVSEENNEIYLELTSENLSRALKTAQNSRALKIKLTNKHFPCL
FT                   TVSVELVSSSSSSRIVVHDIPIKVLPRRLWKDLQEPSIPDCDVSICLPALKMMKSVVEK
FT                   MRNISNQLVIEANLKGELNLKIETELVCVTTHFKDLENPLLPSDSVSQNRHPEDMAKVH
FT                   IDIKKLLQFLAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSLQYFIPALS"
FT   gene            complement(5884804..5922710)
FT                   /gene="Sunc1"
FT                   /locus_tag="mCG_55828"
FT                   /note="gene_id=mCG55828.2"
FT   mRNA            complement(join(5884804..5885107,5886874..5886966,
FT                   5889988..5890118,5901027..5901111,5902666..5902837,
FT                   5903576..5903616,5904777..5904880,5905319..5905423,
FT                   5922590..5922710))
FT                   /gene="Sunc1"
FT                   /locus_tag="mCG_55828"
FT                   /product="Sad1 and UNC84 domain containing 1, transcript
FT                   variant mCT169942"
FT                   /note="gene_id=mCG55828.2 transcript_id=mCT169942.0 created
FT                   on 30-MAY-2002"
FT   mRNA            complement(join(5884804..5885107,5886874..5886966,
FT                   5889988..5890118,5901027..5901111,5902666..5902837,
FT                   5903576..5903616,5904777..5904880,5905319..5905423,
FT                   5911965..5912026,5913266..5913297))
FT                   /gene="Sunc1"
FT                   /locus_tag="mCG_55828"
FT                   /product="Sad1 and UNC84 domain containing 1, transcript
FT                   variant mCT56011"
FT                   /note="gene_id=mCG55828.2 transcript_id=mCT56011.2 created
FT                   on 30-MAY-2002"
FT   CDS             complement(join(5884988..5885107,5886874..5886966,
FT                   5889988..5890118,5901027..5901111,5902666..5902837,
FT                   5903576..5903616,5904777..5904880,5905319..5905423,
FT                   5911965..5912026,5913266..5913267))
FT                   /codon_start=1
FT                   /gene="Sunc1"
FT                   /locus_tag="mCG_55828"
FT                   /product="Sad1 and UNC84 domain containing 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG55828.2 transcript_id=mCT56011.2
FT                   protein_id=mCP30223.2 isoform=CRA_b"
FT                   /protein_id="EDL40622.1"
FT                   /translation="MLTRSWKIILSTVFISTFLLVGLLNHQWLKETEFPQKPRQLYTVI
FT                   AEYGSRLYNYQGLLNHQWLKETEFPQKPRQLYTVIAEYGSRLYNYQARLRMPKEQQELL
FT                   KKESQTLENNFREILFLIEQIDVLKALLKDMKDGVHNHSLPVHRDAVQDQATTDVLDEE
FT                   MSNLVHYVLKKFRGDQIQLADYALKSAGSQGHILIKLARKIIPTAVTMEHISEKVSPSG
FT                   NISSAPKEFSVYGVMKKCEGEEIFLGQFIYNKMEATIQTFELQNEASESLLCVKLQILS
FT                   NWGHPKYTCLYRFRVHGIPSDYT"
FT   CDS             complement(join(5884988..5885107,5886874..5886966,
FT                   5889988..5890118,5901027..5901111,5902666..5902837,
FT                   5903576..5903604))
FT                   /codon_start=1
FT                   /gene="Sunc1"
FT                   /locus_tag="mCG_55828"
FT                   /product="Sad1 and UNC84 domain containing 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG55828.2 transcript_id=mCT169942.0
FT                   protein_id=mCP92565.0 isoform=CRA_a"
FT                   /protein_id="EDL40621.1"
FT                   /translation="MPKEQQELLKKESQTLENNFREILFLIEQIDVLKALLKDMKDGVH
FT                   NHSLPVHRDAVQDQATTDVLDEEMSNLVHYVLKKFRGDQIQLADYALKSAGSQGHILIK
FT                   LARKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGVMKKCEGEEIFLGQFIYNKMEAT
FT                   IQTFELQNEASESLLCVKLQILSNWGHPKYTCLYRFRVHGIPSDYT"
FT   assembly_gap    5887239..5887258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5888377..5888396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5890340..5890359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5892187..5892206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5897403..5897422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5901911..5901930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5905278..5905297
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5922334..5943125
FT                   /locus_tag="mCG_16619"
FT                   /note="gene_id=mCG16619.2"
FT   mRNA            join(5922334..5922921,5926394..5926579,5927887..5927995,
FT                   5930150..5930306,5933640..5933737,5934895..5935115,
FT                   5942106..5943125)
FT                   /locus_tag="mCG_16619"
FT                   /product="mCG16619"
FT                   /note="gene_id=mCG16619.2 transcript_id=mCT19348.2 created
FT                   on 30-MAY-2002"
FT   CDS             join(5922867..5922921,5926394..5926579,5927887..5927995,
FT                   5930150..5930306,5933640..5933737,5934895..5935115,
FT                   5942106..5942155)
FT                   /codon_start=1
FT                   /locus_tag="mCG_16619"
FT                   /product="mCG16619"
FT                   /note="gene_id=mCG16619.2 transcript_id=mCT19348.2
FT                   protein_id=mCP7866.2"
FT                   /db_xref="MGI:MGI:3651127"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVL0"
FT                   /protein_id="EDL40623.1"
FT                   /translation="MRNTSKEVQSTSYRYAPCDWYYHLPVKRSEKPVGAPPASQIPGLS
FT                   DLRDSPNVNLPRARRYWIKETDSEYVKLAKQGGRPDLLKHFAPGTRQGSPVAYSLPDWY
FT                   IHHSKPPTSHQREVPVVSIPDYMVYEEFNPDQANGSYESRQGPFDFDRKTIWQREAEEL
FT                   ENVKRKVKLPAINSKNPSKTGTPVSHKEPERSRLSLPPMPGQKNSSPTNFSKLISNGYK
FT                   DEWLQQQKAEADRRTPKTSRASVSSKSTEDSKSNQDTETPENPETPEGSEKTPDAEVSS
FT                   PSESTPAELK"
FT   assembly_gap    5935351..5935370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5951090..5954292
FT                   /estimated_length=3203
FT                   /gap_type="unknown"
FT   assembly_gap    5986996..5987084
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   gene            5988095..6006252
FT                   /gene="Upp1"
FT                   /locus_tag="mCG_140488"
FT                   /note="gene_id=mCG140488.0"
FT   mRNA            join(5988095..5988371,5989461..5989536,5995720..5995785,
FT                   5999575..5999692,6001717..6001875,6003321..6003435,
FT                   6004809..6005018,6005251..6005397,6006049..6006252)
FT                   /gene="Upp1"
FT                   /locus_tag="mCG_140488"
FT                   /product="uridine phosphorylase 1, transcript variant
FT                   mCT169742"
FT                   /note="gene_id=mCG140488.0 transcript_id=mCT169742.0
FT                   created on 31-MAY-2002"
FT   mRNA            join(5988096..5988249,5989461..5989536,5995720..5995785,
FT                   5999575..5999692,6001717..6001875,6003321..6003435,
FT                   6004809..6005018,6005251..6005397,6006049..6006252)
FT                   /gene="Upp1"
FT                   /locus_tag="mCG_140488"
FT                   /product="uridine phosphorylase 1, transcript variant
FT                   mCT169740"
FT                   /note="gene_id=mCG140488.0 transcript_id=mCT169740.0
FT                   created on 31-MAY-2002"
FT   mRNA            join(5988640..5988747,5989461..5989536,5995720..5995785,
FT                   5999575..5999692,6001717..6001875,6003321..6003435,
FT                   6004809..6005018,6005251..6005397,6006049..6006252)
FT                   /gene="Upp1"
FT                   /locus_tag="mCG_140488"
FT                   /product="uridine phosphorylase 1, transcript variant
FT                   mCT169741"
FT                   /note="gene_id=mCG140488.0 transcript_id=mCT169741.0
FT                   created on 31-MAY-2002"
FT   CDS             join(5995739..5995785,5999575..5999692,6001717..6001875,
FT                   6003321..6003435,6004809..6005018,6005251..6005397,
FT                   6006049..6006188)
FT                   /codon_start=1
FT                   /gene="Upp1"
FT                   /locus_tag="mCG_140488"
FT                   /product="uridine phosphorylase 1, isoform CRA_a"
FT                   /note="gene_id=mCG140488.0 transcript_id=mCT169740.0
FT                   protein_id=mCP92557.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SUC8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010059"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="MGI:MGI:1097668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUC8"
FT                   /protein_id="EDL40624.1"
FT                   /translation="MAATGTEAKDLENHHNDCFIQLSNPNIAAMKEDVLYHFNLSTSTH
FT                   DFPAMFGDVKFVCVGGSSSRMNTFIKYVAAELGLDHPGKEYPNICAGTDRYAMYKAGPV
FT                   LSVSHGMGIPSIGIMLHELIKMLYHARCSNITIIRIGTSGGIGLEPGSVVITQQAVNEC
FT                   FKPEFEQIVLGKRVIRNTNLDAQLVQELVQCSSDLNEFPMVVGNTMCTLDFYEGQGRLD
FT                   GALCSYTEKDKQSYLRAAHAAGVRNIEMESSVFATMCSACGLKAAVVCVTLLDRLQGDQ
FT                   INTPHDVLVEYQQRPQRLVGHFIKKSLGRA"
FT   CDS             join(5995739..5995785,5999575..5999692,6001717..6001875,
FT                   6003321..6003435,6004809..6005018,6005251..6005397,
FT                   6006049..6006188)
FT                   /codon_start=1
FT                   /gene="Upp1"
FT                   /locus_tag="mCG_140488"
FT                   /product="uridine phosphorylase 1, isoform CRA_a"
FT                   /note="gene_id=mCG140488.0 transcript_id=mCT169741.0
FT                   protein_id=mCP92561.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SUC8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010059"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="MGI:MGI:1097668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUC8"
FT                   /protein_id="EDL40625.1"
FT                   /translation="MAATGTEAKDLENHHNDCFIQLSNPNIAAMKEDVLYHFNLSTSTH
FT                   DFPAMFGDVKFVCVGGSSSRMNTFIKYVAAELGLDHPGKEYPNICAGTDRYAMYKAGPV
FT                   LSVSHGMGIPSIGIMLHELIKMLYHARCSNITIIRIGTSGGIGLEPGSVVITQQAVNEC
FT                   FKPEFEQIVLGKRVIRNTNLDAQLVQELVQCSSDLNEFPMVVGNTMCTLDFYEGQGRLD
FT                   GALCSYTEKDKQSYLRAAHAAGVRNIEMESSVFATMCSACGLKAAVVCVTLLDRLQGDQ
FT                   INTPHDVLVEYQQRPQRLVGHFIKKSLGRA"
FT   CDS             join(5995739..5995785,5999575..5999692,6001717..6001875,
FT                   6003321..6003435,6004809..6005018,6005251..6005397,
FT                   6006049..6006188)
FT                   /codon_start=1
FT                   /gene="Upp1"
FT                   /locus_tag="mCG_140488"
FT                   /product="uridine phosphorylase 1, isoform CRA_a"
FT                   /note="gene_id=mCG140488.0 transcript_id=mCT169742.0
FT                   protein_id=mCP92564.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SUC8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010059"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="MGI:MGI:1097668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUC8"
FT                   /protein_id="EDL40626.1"
FT                   /translation="MAATGTEAKDLENHHNDCFIQLSNPNIAAMKEDVLYHFNLSTSTH
FT                   DFPAMFGDVKFVCVGGSSSRMNTFIKYVAAELGLDHPGKEYPNICAGTDRYAMYKAGPV
FT                   LSVSHGMGIPSIGIMLHELIKMLYHARCSNITIIRIGTSGGIGLEPGSVVITQQAVNEC
FT                   FKPEFEQIVLGKRVIRNTNLDAQLVQELVQCSSDLNEFPMVVGNTMCTLDFYEGQGRLD
FT                   GALCSYTEKDKQSYLRAAHAAGVRNIEMESSVFATMCSACGLKAAVVCVTLLDRLQGDQ
FT                   INTPHDVLVEYQQRPQRLVGHFIKKSLGRA"
FT   gene            complement(6019568..6020723)
FT                   /pseudo
FT                   /locus_tag="mCG_16613"
FT                   /note="gene_id=mCG16613.1"
FT   mRNA            complement(6019568..6020723)
FT                   /pseudo
FT                   /locus_tag="mCG_16613"
FT                   /note="gene_id=mCG16613.1 transcript_id=mCT19157.1 created
FT                   on 31-MAY-2002"
FT   gene            <6062741..6097261
FT                   /locus_tag="mCG_145627"
FT                   /note="gene_id=mCG145627.0"
FT   mRNA            join(<6062741..6062834,6087375..6087468,6093493..6097261)
FT                   /locus_tag="mCG_145627"
FT                   /product="mCG145627"
FT                   /note="gene_id=mCG145627.0 transcript_id=mCT185051.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6062742..6062834,6087375..6087468,6093493..6093653)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145627"
FT                   /product="mCG145627"
FT                   /note="gene_id=mCG145627.0 transcript_id=mCT185051.0
FT                   protein_id=mCP105948.0"
FT                   /protein_id="EDL40627.1"
FT                   /translation="ELRQGAAGMGHAGRQFQALLWKNWICRLRHPVLSLAEFFWPCILF
FT                   MILTVLRFQEPPRHRENCYLQARDLPSRGVLPFVQGLLCNTGSSCRNISFESSMDHHFR
FT                   YEKYKHPFQNS"
FT   assembly_gap    6075834..6075983
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    6076996..6077231
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    6080430..6080673
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    6088650..6088669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6089849..6089868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6099922..6099941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6104371..6104390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6118893..6121230
FT                   /estimated_length=2338
FT                   /gap_type="unknown"
FT   assembly_gap    6127243..6127327
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    6143750..6143795
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    6173534..6173684
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    6177697..6177716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6179991..6180208
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    6198566..6198585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6207474..6207493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6208888..6554092
FT                   /locus_tag="mCG_116227"
FT                   /note="gene_id=mCG116227.1"
FT   mRNA            join(<6208888..6209025,6219719..6219832,6228598..6228688,
FT                   6251817..6252300,6271572..6271686,6272966..6273295,
FT                   6277626..6277749,6307486..6307623,6308667..6308847,
FT                   6311048..6311317,6321193..6321389,6334543..6334700,
FT                   6336027..6336236,6379967..6380340,6437311..6437488,
FT                   6440188..6440303,6446843..6446999,6451155..6451292,
FT                   6455031..6455207,6458049..6458158,6485480..6485630,
FT                   6491697..6491831,6498400..6498503,6506379..6506475,
FT                   6549550..6549655,6551676..6551813,6553112..6554092)
FT                   /locus_tag="mCG_116227"
FT                   /product="mCG116227"
FT                   /note="gene_id=mCG116227.1 transcript_id=mCT117344.1
FT                   created on 07-MAR-2003"
FT   CDS             join(<6208888..6209025,6219719..6219832,6228598..6228688,
FT                   6251817..6252300,6271572..6271686,6272966..6273295,
FT                   6277626..6277749,6307486..6307623,6308667..6308847,
FT                   6311048..6311317,6321193..6321389,6334543..6334700,
FT                   6336027..6336236,6379967..6380340,6437311..6437488,
FT                   6440188..6440303,6446843..6446999,6451155..6451292,
FT                   6455031..6455207,6458049..6458158,6485480..6485630,
FT                   6491697..6491831,6498400..6498503,6506379..6506475,
FT                   6549550..6549558)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116227"
FT                   /product="mCG116227"
FT                   /note="gene_id=mCG116227.1 transcript_id=mCT117344.1
FT                   protein_id=mCP59333.1"
FT                   /protein_id="EDL40628.1"
FT                   /translation="PFCLKLYQEILQSPNGALVWSFLKPVLHGKILYTPNSPEINEVIQ
FT                   KANYTFYFVDKIKVLSETFLKISKLFQGSGNGQMFNQLQDALRNKFIRNFVESQLHIDM
FT                   DKLTEDLQTYGSCFNYLWLRVACLLASLGLHSPTTGVEDYAEFQALLRFLSILCVTSMS
FT                   CMTSFSFLLPGIIFNSSLRHRHIRSAPHKLPPHVTYTIRTNVLYSMRTDMIKNPSWKFH
FT                   PQNLPAGGFKYNYIFVPLQDMIERAIIVVQTGQESLEPTTQAQAAPYPCHTSDLFLNNV
FT                   GFFFPLIMMLTWMVAVASMVRKLVYEREIQIEEYMRMMGLHPTIHFLSWFLENMATLAL
FT                   SSAALAVILKMSGIFMHSDAFIIFLYLLDFGVSAVMMSYFLSVFFNQANTAALCTSLGY
FT                   MISFLPYVVLLVLHNQLSFAIQTLLWGNMYRAPEPGGMTFGWVCWMILFDAILYFLGGW
FT                   YFSNLVPGTFGLGKPWYFPFTASYWKSICGLMERRRCSLSSGLFFFNEDFGNKGLSQQN
FT                   GPGEMEGGNPGVALISVTKEYEDHKVAVQELTLTFHRDQITALLGTNGAGKTTIISMLM
FT                   GLFPPTSGTITINGKNLQTDLSKVREELGVCPQQDVLLDNLTVREHLMLFASIKAPWWT
FT                   TKELQQQVNKLVNSPRFSFPSFAQLCRTLDEVELTQHQHKPAGVLSGGMKRKLSIGIAF
FT                   MGMSKTVVLDEPSSGVDPCSRRSLWDILLKYREGRTIIFTTHHLDEAEMLSDHVAVLQQ
FT                   GRLRCYAPPADLKETYGQGLTLTLSKQEPKDVARVTSLIQIYIPQAFLKDSCGGELTYT
FT                   IPKDADRTCFKGLCQALDQNLQHLHLTGYGISDTTLEEGPYRIIGDIHQNRVGVRNSIH
FT                   LHAAHFVYLSSPTDVSPLSTPPEGALPEPIGGCQLLLGQAVALLRKRLLHTLRAWKSTT
FT                   SDLLLPVLFVALAMGLFMVQPLAITYPPLKLTPGHYETAETYFFSLESIRQCGVALCIV
FT                   LGFSILSASIGSSVVRDRVTGAKRLQHISGLGHRTYWLINFLYDMLFYLVSVCLCVAVI
FT                   GAFQLTAFTFRENLAATALLLALFGYAMIPWMYLMSRIFSSSDVAFISYISLNFIFGLC
FT                   TMLMTTMPRLLAIISKAQNLQKIYNVLKWAFTIFPQFCLGQGLIELCYNQIKYDLTHNF
FT                   GIDSYDIVKPAKDIDVETEQMRVLEGRTGGDMMVLCNLSKSYRSVFGGKTTAVHGISLG
FT                   IPRGECFGLLGVNGAGKSTTFKILNGETPPSSGYTVIRTPQGDMVDLASAGKAGILIGY
FT                   CPQQDALDELLTGWEHLQYYCRLRGIPKQYIPEVAADLVRRLHLESHVDKPVATYSGGT
FT                   RRKLSTALALVGKPDILLLDEPSSGMDPCSKRYLWQTITQEVRDGCAAVLTSHSMEECE
FT                   ALCTRLAIMVDGSFRCLGPPQHIKNRYVW"
FT   assembly_gap    6233803..6238120
FT                   /estimated_length=4318
FT                   /gap_type="unknown"
FT   assembly_gap    6279502..6279521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6280835..6280854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6285457..6285476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6286720..6286739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6288206..6288225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6294433..6294452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6298901..6298986
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    6320182..6320201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6323028..6323239
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   assembly_gap    6337413..6337522
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    6433909..6434143
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    6441778..6441877
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    6449820..6449923
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    6460369..6460488
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    6468901..6468920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6470876..6470915
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    6510550..6510612
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    6517078..6517097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6525781..6525800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6552290..6552490
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    6579593..6579612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6586707..6586726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6588288..6588307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6603994..6604602)
FT                   /pseudo
FT                   /locus_tag="mCG_1041130"
FT                   /note="gene_id=mCG1041130.1"
FT   mRNA            complement(6603994..6604602)
FT                   /pseudo
FT                   /locus_tag="mCG_1041130"
FT                   /note="gene_id=mCG1041130.1 transcript_id=mCT158834.1
FT                   created on 31-MAY-2002"
FT   assembly_gap    6613718..6614324
FT                   /estimated_length=607
FT                   /gap_type="unknown"
FT   assembly_gap    6623593..6623612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6637316..6637335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6638381..6638400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6646348..6646367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6651351..6651370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6663657..6663676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6682069..6683789
FT                   /estimated_length=1721
FT                   /gap_type="unknown"
FT   assembly_gap    6691006..6691025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6692282..6692301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6693693..6693712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6758842..6758861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6799229..6799345
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    6824168..6824516
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    6836382..6836401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6838048..6838067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6847226..6851237
FT                   /estimated_length=4012
FT                   /gap_type="unknown"
FT   assembly_gap    6900946..6901124
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    6903035..6903054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6904482..6904501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6910135..6911570
FT                   /estimated_length=1436
FT                   /gap_type="unknown"
FT   assembly_gap    6912881..6913075
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    6915299..6915318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6917427..6917446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6918737..6923611
FT                   /estimated_length=4875
FT                   /gap_type="unknown"
FT   assembly_gap    6925101..6925514
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    6927069..6927088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6928497..6928516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6932824..6932843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6935247..6935266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6937203..6937222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6989523..6989542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6991615..6994193
FT                   /estimated_length=2579
FT                   /gap_type="unknown"
FT   assembly_gap    6998431..6998450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7000292..7000311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7004193..7004212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7006253..7006272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7055521..7055540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7056698..7056717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7101857..7101876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7111111..7111130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7120459..7121000
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   gene            7136254..7137005
FT                   /pseudo
FT                   /locus_tag="mCG_13254"
FT                   /note="gene_id=mCG13254.1"
FT   mRNA            7136254..7137005
FT                   /pseudo
FT                   /locus_tag="mCG_13254"
FT                   /note="gene_id=mCG13254.1 transcript_id=mCT14260.1 created
FT                   on 31-MAY-2002"
FT   assembly_gap    7150619..7151217
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    7152086..7152516
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    7153439..7154020
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    7228024..7228145
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            complement(7273685..7273997)
FT                   /pseudo
FT                   /locus_tag="mCG_49085"
FT                   /note="gene_id=mCG49085.2"
FT   mRNA            complement(7273685..7273997)
FT                   /pseudo
FT                   /locus_tag="mCG_49085"
FT                   /note="gene_id=mCG49085.2 transcript_id=mCT49268.2 created
FT                   on 31-MAY-2002"
FT   assembly_gap    7296658..7296677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7330233..7330252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7334583..7338180
FT                   /estimated_length=3598
FT                   /gap_type="unknown"
FT   assembly_gap    7343580..7343599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7346395..7349153
FT                   /estimated_length=2759
FT                   /gap_type="unknown"
FT   assembly_gap    7359239..7359282
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    7364218..7364240
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    7366048..7366067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7368353..7370568
FT                   /estimated_length=2216
FT                   /gap_type="unknown"
FT   assembly_gap    7371727..7372054
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    7381095..7381210
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    7419892..7419913
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    7424831..7424850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7425861..7425880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7431431..7431450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7446013..7448647
FT                   /estimated_length=2635
FT                   /gap_type="unknown"
FT   assembly_gap    7452873..7452892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7455357..7456459
FT                   /estimated_length=1103
FT                   /gap_type="unknown"
FT   assembly_gap    7522997..7523042
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    7558555..7558682
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    7588287..7588333
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    7650956..7653831
FT                   /estimated_length=2876
FT                   /gap_type="unknown"
FT   assembly_gap    7658776..7658795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7705966..7706044
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    7716148..7716638
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    7741531..7742125
FT                   /estimated_length=595
FT                   /gap_type="unknown"
FT   assembly_gap    7759112..7759225
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    7778105..7778208
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    7800792..7801059
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    7811683..7812163
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    7817649..7817668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7851081..7851147
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    7897027..7897046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7898106..7898125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7899356..7899375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7919947..7919966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7921730..7921749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7927396..7927415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7934176..7934307
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    7937598..7940423
FT                   /estimated_length=2826
FT                   /gap_type="unknown"
FT   assembly_gap    7949030..7949049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7972097..7972116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7977512..7977531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7997657..7997836
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   gene            8008716..8159646
FT                   /gene="A930041G11Rik"
FT                   /locus_tag="mCG_3991"
FT                   /note="gene_id=mCG3991.3"
FT   mRNA            join(8008716..8009002,8010304..8011099,8045959..8046088,
FT                   8153298..8155455)
FT                   /gene="A930041G11Rik"
FT                   /locus_tag="mCG_3991"
FT                   /product="RIKEN cDNA A930041G11, transcript variant
FT                   mCT2894"
FT                   /note="gene_id=mCG3991.3 transcript_id=mCT2894.3 created on
FT                   12-JUN-2003"
FT   mRNA            join(8009237..8009265,8010304..8011099,8045959..8046088,
FT                   8153298..8153688,8158489..8159646)
FT                   /gene="A930041G11Rik"
FT                   /locus_tag="mCG_3991"
FT                   /product="RIKEN cDNA A930041G11, transcript variant
FT                   mCT185571"
FT                   /note="gene_id=mCG3991.3 transcript_id=mCT185571.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(8009237..8009265,8010304..8011099,8022372..8022646)
FT                   /gene="A930041G11Rik"
FT                   /locus_tag="mCG_3991"
FT                   /product="RIKEN cDNA A930041G11, transcript variant
FT                   mCT169758"
FT                   /note="gene_id=mCG3991.3 transcript_id=mCT169758.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(8010407..8011099,8045959..8046088,8153298..8153449)
FT                   /codon_start=1
FT                   /gene="A930041G11Rik"
FT                   /locus_tag="mCG_3991"
FT                   /product="RIKEN cDNA A930041G11, isoform CRA_b"
FT                   /note="gene_id=mCG3991.3 transcript_id=mCT185571.0
FT                   protein_id=mCP106829.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C8N3"
FT                   /db_xref="InterPro:IPR001007"
FT                   /db_xref="MGI:MGI:2442987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C8N3"
FT                   /protein_id="EDL40630.1"
FT                   /translation="MPSSSAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQ
FT                   EKREHASRDSPGRVSELGRASRDEGSSARDWKSKGSRALSGREAWSKQKQAWAAQGGSA
FT                   KAADWQVRPRGDTPQGEPPAAAQEAISLELVPTPELPEEYAYPDYRGKGCVDESGFVYA
FT                   IGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDNSQCCPQCKEKKNYCEFRGK
FT                   TYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAE
FT                   TAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM"
FT   CDS             join(8010407..8011099,8045959..8046088,8153298..8153449)
FT                   /codon_start=1
FT                   /gene="A930041G11Rik"
FT                   /locus_tag="mCG_3991"
FT                   /product="RIKEN cDNA A930041G11, isoform CRA_b"
FT                   /note="gene_id=mCG3991.3 transcript_id=mCT2894.3
FT                   protein_id=mCP7834.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8C8N3"
FT                   /db_xref="InterPro:IPR001007"
FT                   /db_xref="MGI:MGI:2442987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C8N3"
FT                   /protein_id="EDL40631.1"
FT                   /translation="MPSSSAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQ
FT                   EKREHASRDSPGRVSELGRASRDEGSSARDWKSKGSRALSGREAWSKQKQAWAAQGGSA
FT                   KAADWQVRPRGDTPQGEPPAAAQEAISLELVPTPELPEEYAYPDYRGKGCVDESGFVYA
FT                   IGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDNSQCCPQCKEKKNYCEFRGK
FT                   TYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAE
FT                   TAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM"
FT   CDS             join(8010407..8011099,8022372..8022512)
FT                   /codon_start=1
FT                   /gene="A930041G11Rik"
FT                   /locus_tag="mCG_3991"
FT                   /product="RIKEN cDNA A930041G11, isoform CRA_a"
FT                   /note="gene_id=mCG3991.3 transcript_id=mCT169758.0
FT                   protein_id=mCP92545.1 isoform=CRA_a"
FT                   /protein_id="EDL40629.1"
FT                   /translation="MPSSSAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQ
FT                   EKREHASRDSPGRVSELGRASRDEGSSARDWKSKGSRALSGREAWSKQKQAWAAQGGSA
FT                   KAADWQVRPRGDTPQGEPPAAAQEAISLELVPTPELPEEYAYPDYRGKGCVDESGFVYA
FT                   IGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDNSQCCPQCKEKKNYCEFRGK
FT                   TYQTLEEFVISRICTNQRELFRQGFESRWQRKISQYYWLVLKKKAGPSHHLSQAL"
FT   assembly_gap    8021397..8021416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8035016..8038342
FT                   /estimated_length=3327
FT                   /gap_type="unknown"
FT   assembly_gap    8116433..8116452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8157569..8157588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8162577..8162731
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   gene            complement(8174565..8358284)
FT                   /gene="Zpbp"
FT                   /locus_tag="mCG_3995"
FT                   /note="gene_id=mCG3995.2"
FT   mRNA            complement(join(8174565..8174765,8248408..8248585,
FT                   8299826..8299902,8304200..8304418,8310978..8311127,
FT                   8313954..8314079,8355562..8355642,8358099..8358284))
FT                   /gene="Zpbp"
FT                   /locus_tag="mCG_3995"
FT                   /product="zona pellucida binding protein, transcript
FT                   variant mCT169759"
FT                   /note="gene_id=mCG3995.2 transcript_id=mCT169759.0 created
FT                   on 31-MAY-2002"
FT   mRNA            complement(join(8174565..8174765,8248408..8248585,
FT                   8299826..8299902,8304200..8304418,8310978..8311127,
FT                   8313954..8314079,8355562..8355642,8357928..8358272))
FT                   /gene="Zpbp"
FT                   /locus_tag="mCG_3995"
FT                   /product="zona pellucida binding protein, transcript
FT                   variant mCT2884"
FT                   /note="gene_id=mCG3995.2 transcript_id=mCT2884.1 created on
FT                   31-MAY-2002"
FT   CDS             complement(join(8174671..8174765,8248408..8248585,
FT                   8299826..8299902,8304200..8304418,8310978..8311127,
FT                   8313954..8314079,8355562..8355642,8358099..8358228))
FT                   /codon_start=1
FT                   /gene="Zpbp"
FT                   /locus_tag="mCG_3995"
FT                   /product="zona pellucida binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG3995.2 transcript_id=mCT169759.0
FT                   protein_id=mCP92535.0 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZP49"
FT                   /db_xref="InterPro:IPR010857"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1855701"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZP49"
FT                   /protein_id="EDL40632.1"
FT                   /translation="MCTQAGSQASTPPAHHPSGSGASVGPSFRPAVCQLPAAGGRAPVG
FT                   HLARLPRSIHLTQDSLKIVGSTHFPVSVYVMLHQKSPHVLCVTQRLRNTELVDPSFQWH
FT                   GPKGKLVSENTTAQVTSTGSLIFQSFEETMSGVYTCFLEYKPTVEESIKNLQLKYIVYA
FT                   YREPRFYYQFTARYHAAPCNSIYNISFEKKLLQILSKLVLDLSCEISLIKSECHRVKMQ
FT                   RAGLQNELFFTFSVASIDTEKGSKPCTDHSCEASKRLSKAKNLIERFFIQQVEVLGKRA
FT                   EPLPEIYYIEGTLQMVWVNRCFPGYGINVLKHPKCPECCVVCSPGSFNPRDGTHCLQCN
FT                   NSLVYGAKTCM"
FT   CDS             complement(join(8174671..8174765,8248408..8248585,
FT                   8299826..8299902,8304200..8304418,8310978..8311127,
FT                   8313954..8314079,8355562..8355642,8357928..8358228))
FT                   /codon_start=1
FT                   /gene="Zpbp"
FT                   /locus_tag="mCG_3995"
FT                   /product="zona pellucida binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG3995.2 transcript_id=mCT2884.1
FT                   protein_id=mCP7798.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5NC84"
FT                   /db_xref="InterPro:IPR010857"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1855701"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NC84"
FT                   /protein_id="EDL40633.1"
FT                   /translation="MCTQAGSQASTPPAHHPSGSGASVGPSFRPAVCQLPAAGGRAPGN
FT                   DLLRRGSAVGGVWMEALAPGRAPRGRRRAGASGSVLSPLSLAAVLLCALLRAPPAVGHL
FT                   ARLPRSIHLTQDSLKIVGSTHFPVSVYVMLHQKSPHVLCVTQRLRNTELVDPSFQWHGP
FT                   KGKLVSENTTAQVTSTGSLIFQSFEETMSGVYTCFLEYKPTVEESIKNLQLKYIVYAYR
FT                   EPRFYYQFTARYHAAPCNSIYNISFEKKLLQILSKLVLDLSCEISLIKSECHRVKMQRA
FT                   GLQNELFFTFSVASIDTEKGSKPCTDHSCEASKRLSKAKNLIERFFIQQVEVLGKRAEP
FT                   LPEIYYIEGTLQMVWVNRCFPGYGINVLKHPKCPECCVVCSPGSFNPRDGTHCLQCNNS
FT                   LVYGAKTCM"
FT   assembly_gap    8184004..8187005
FT                   /estimated_length=3002
FT                   /gap_type="unknown"
FT   assembly_gap    8194349..8194368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8235990..8237548
FT                   /estimated_length=1559
FT                   /gap_type="unknown"
FT   assembly_gap    8238778..8238797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8239833..8244853
FT                   /estimated_length=5021
FT                   /gap_type="unknown"
FT   assembly_gap    8274411..8277605
FT                   /estimated_length=3195
FT                   /gap_type="unknown"
FT   assembly_gap    8288545..8289361
FT                   /estimated_length=817
FT                   /gap_type="unknown"
FT   assembly_gap    8296059..8296078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8332382..8332427
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            8332612..8333665
FT                   /pseudo
FT                   /locus_tag="mCG_3996"
FT                   /note="gene_id=mCG3996.1"
FT   mRNA            8332612..8333665
FT                   /pseudo
FT                   /locus_tag="mCG_3996"
FT                   /note="gene_id=mCG3996.1 transcript_id=mCT2881.1 created on
FT                   31-MAY-2002"
FT   assembly_gap    8354326..8354345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8385134..8411055
FT                   /locus_tag="mCG_3989"
FT                   /note="gene_id=mCG3989.2"
FT   mRNA            join(8385134..8385346,8386089..8386156,8391291..8391332,
FT                   8392277..8392384,8405066..8405173,8410842..8411055)
FT                   /locus_tag="mCG_3989"
FT                   /product="mCG3989"
FT                   /note="gene_id=mCG3989.2 transcript_id=mCT2893.2 created on
FT                   03-JUN-2002"
FT   CDS             join(8386089..8386156,8391291..8391332,8392277..8392384,
FT                   8405066..8405173,8410842..8410965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3989"
FT                   /product="mCG3989"
FT                   /note="gene_id=mCG3989.2 transcript_id=mCT2893.2
FT                   protein_id=mCP7830.2"
FT                   /protein_id="EDL40634.1"
FT                   /translation="MVGGLWDRFQTRLFSAPAKPINFVSPSTRSKYIPLYTGHVQSTDA
FT                   DNVDNPYGDIKSVASPRHSKLQYTNSSRSANIPGYTGKVHFTATHPTNSNIPSREPSAD
FT                   SEMNRLLLQEMRVDRFRHQGPMSQMVTTVKPYNPFNKKEKETLEY"
FT   assembly_gap    8406834..8406949
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    8414820..8414863
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    8424073..8424737
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    8425862..8427456
FT                   /estimated_length=1595
FT                   /gap_type="unknown"
FT   assembly_gap    8428852..8428871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8437503..8437522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8448573..8448592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8453719..8475329
FT                   /locus_tag="mCG_58483"
FT                   /note="gene_id=mCG58483.2"
FT   mRNA            join(8453719..8453818,8470074..8470215,8474599..8475329)
FT                   /locus_tag="mCG_58483"
FT                   /product="mCG58483"
FT                   /note="gene_id=mCG58483.2 transcript_id=mCT58666.2 created
FT                   on 27-FEB-2003"
FT   CDS             join(8470143..8470215,8474599..8474654)
FT                   /codon_start=1
FT                   /locus_tag="mCG_58483"
FT                   /product="mCG58483"
FT                   /note="gene_id=mCG58483.2 transcript_id=mCT58666.2
FT                   protein_id=mCP30270.2"
FT                   /protein_id="EDL40635.1"
FT                   /translation="MFKMELCLSIYICRWMDTHANTPVCHDIIQPLSEKLLGIDVN"
FT   gene            complement(8485075..>8523850)
FT                   /locus_tag="mCG_3997"
FT                   /note="gene_id=mCG3997.2"
FT   mRNA            complement(join(8485075..8485214,8485904..8485971,
FT                   8520668..8520736,8523412..>8523850))
FT                   /locus_tag="mCG_3997"
FT                   /product="mCG3997"
FT                   /note="gene_id=mCG3997.2 transcript_id=mCT2889.2 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(8485119..8485214,8485904..8485971,
FT                   8520668..8520736,8523412..>8523850))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3997"
FT                   /product="mCG3997"
FT                   /note="gene_id=mCG3997.2 transcript_id=mCT2889.2
FT                   protein_id=mCP7818.1"
FT                   /protein_id="EDL40636.1"
FT                   /translation="CILLLMLVSMVPDLFPRVSISSIASLWVFFILSTSLFRSWMVLFN
FT                   SIACLVVFSCNSLRDFCVSSLMSSTCLVMFSCNSIRDFCVSSLMSSTCLAVFFCISLSE
FT                   LFKSFLISSTIIMRYAFKSRSSFSGVLGCPGLGEVGLLGSNDDQRITGQAEVKLRAFLG
FT                   DYDGSQMEECCFKILLNIWFNGTANHPHEANISQGALFILQNFSIYLTTLLKGEAEVHI
FT                   I"
FT   assembly_gap    8496029..8496264
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    8511103..8511448
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    8530120..8530249
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   gene            complement(8538367..>8581609)
FT                   /locus_tag="mCG_145628"
FT                   /note="gene_id=mCG145628.0"
FT   mRNA            complement(join(8538367..8538866,8549390..8549518,
FT                   8549777..8549849,8581498..>8581609))
FT                   /locus_tag="mCG_145628"
FT                   /product="mCG145628"
FT                   /note="gene_id=mCG145628.0 transcript_id=mCT185052.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(8538748..8538866,8549390..8549518,
FT                   8549777..>8549783))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145628"
FT                   /product="mCG145628"
FT                   /note="gene_id=mCG145628.0 transcript_id=mCT185052.0
FT                   protein_id=mCP105947.0"
FT                   /protein_id="EDL40637.1"
FT                   /translation="NRVYRLKKIRFALLRSCVKQILSELLQVNSKLIWPDSTPPLYVGE
FT                   SLASASELVSADIILPISWSPRKTRSHQHTTRSFWFISL"
FT   gene            8581208..8665797
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /note="gene_id=mCG3994.3"
FT   mRNA            join(8581208..8581405,8596280..8596333,8603860..8603979,
FT                   8650029..8650196,8654216..8654338,8657240..8657374,
FT                   8664499..8665416)
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   transcript variant mCT178282"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT178282.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(8581209..8581382,8596280..8596333,8603860..8603979,
FT                   8644332..8644592,8650029..8650196,8654216..8654338,
FT                   8657240..8657374,8664499..8665797)
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   transcript variant mCT169906"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT169906.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(8581348..8581405,8596280..8596333,8603860..8603979,
FT                   8650029..8650196,8654216..8654338,8657240..8657374,
FT                   8664499..8665199)
FT                   /codon_start=1
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT178282.0
FT                   protein_id=mCP101204.0 isoform=CRA_c"
FT                   /protein_id="EDL40641.1"
FT                   /translation="MEGAILTSSVSRWEGRDARDNLKTMDVDEGQDMSQVSGKESPPVS
FT                   DTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMGERPFQCNQCGASFTQKGNLLRHIKLH
FT                   SGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNY
FT                   LESMGLPGMYPVIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMPQKFLGDK
FT                   CLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPVISSM
FT                   YQLHKPPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQ
FT                   RSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEH
FT                   CRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS"
FT   assembly_gap    8581710..8582313
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   mRNA            join(<8582421..8582662,8596280..8596333,8603860..8603979,
FT                   8650029..8650196,8654216..8654338,8657240..8657445)
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   transcript variant mCT193942"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT193942.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(8582493..8582662,8596280..8596333,8603860..8603979,
FT                   8650029..8650196,8654216..8654338,8657240..8657374,
FT                   8664499..8665797)
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   transcript variant mCT169907"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT169907.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(<8582572..8582662,8596280..8596333,8603860..8603979,
FT                   8650029..8650196,8654216..8654338,8657240..8657385)
FT                   /codon_start=1
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT193942.0
FT                   protein_id=mCP114906.0 isoform=CRA_d"
FT                   /protein_id="EDL40642.1"
FT                   /translation="VPRGAGAPRSPAALRAPGSFLAPKARRTNPHNLKTMDVDEGQDMS
FT                   QVSGKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQNSKSDRGMGERPFQCNQCGASFTQ
FT                   KGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSS
FT                   LEEHKERCHNYLESMGLPGMYPVIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRK
FT                   SSMPQKFLGKS"
FT   mRNA            join(8586552..8586575,8596280..8596333,8603860..8603979,
FT                   8644332..8644592,8650029..8650196,8654216..8654338,
FT                   8657240..8657374,8664499..8665797)
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   transcript variant mCT169905"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT169905.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(8586552..8586575,8596280..8596333,8603860..8603979,
FT                   8650029..8650196,8654216..8654338,8657240..8657374,
FT                   8664499..8665797)
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   transcript variant mCT2888"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT2888.2 created on
FT                   31-DEC-2002"
FT   assembly_gap    8587178..8587229
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    8594296..8594405
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    8596189..8596208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(8596294..8596333,8603860..8603979,8644332..8644592,
FT                   8650029..8650196,8654216..8654338,8657240..8657374,
FT                   8664499..8665199)
FT                   /codon_start=1
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT169905.0
FT                   protein_id=mCP92559.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8H3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1342540"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8H3"
FT                   /protein_id="EDL40638.1"
FT                   /translation="MDVDEGQDMSQVSGKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQ
FT                   NSKSDRGMASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSAL
FT                   SGVGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRH
FT                   IKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKER
FT                   CHNYLESMGLPGMYPVIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMPQKF
FT                   LGDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPV
FT                   ISSMYQLHKPPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESN
FT                   AEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVY
FT                   KCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS"
FT   CDS             join(8596294..8596333,8603860..8603979,8644332..8644592,
FT                   8650029..8650196,8654216..8654338,8657240..8657374,
FT                   8664499..8665199)
FT                   /codon_start=1
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT169906.0
FT                   protein_id=mCP92540.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8H3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1342540"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8H3"
FT                   /protein_id="EDL40639.1"
FT                   /translation="MDVDEGQDMSQVSGKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQ
FT                   NSKSDRGMASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSAL
FT                   SGVGGIRLPNGKLKCDICGIVCIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRH
FT                   IKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSYKQRSSLEEHKER
FT                   CHNYLESMGLPGMYPVIKEETNHNEMAEDLCKIGAERSLVLDRLASNVAKRKSSMPQKF
FT                   LGDKCLSDMPYDSANYEKEDMMTSHVMDQAINNAINYLGAESLRPLVQTPPGSSEVVPV
FT                   ISSMYQLHKPPSDGPPRSNHSAQDAVDNLLLLSKAKSVSSEREASPSNSCQDSTDTESN
FT                   AEEQRSGLIYLTNHINPHARNGLALKEEQRAYEVLRAASENSQDAFRVVSTSGEQLKVY
FT                   KCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGYHSQDRYEFSSHITRGEHRYHLS"
FT   CDS             join(8596294..8596333,8603860..8603979,8650029..8650196,
FT                   8654216..8654338,8657240..8657374,8664499..8665199)
FT                   /codon_start=1
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT169907.0
FT                   protein_id=mCP92543.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SWU0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1342540"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SWU0"
FT                   /protein_id="EDL40640.1"
FT                   /translation="MDVDEGQDMSQVSGKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQ
FT                   NSKSDRGMGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGH
FT                   LRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGMYPVIKEETNHNEMAE
FT                   DLCKIGAERSLVLDRLASNVAKRKSSMPQKFLGDKCLSDMPYDSANYEKEDMMTSHVMD
FT                   QAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDN
FT                   LLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEE
FT                   QRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPF
FT                   ECNMCGYHSQDRYEFSSHITRGEHRYHLS"
FT   CDS             join(8596294..8596333,8603860..8603979,8650029..8650196,
FT                   8654216..8654338,8657240..8657374,8664499..8665199)
FT                   /codon_start=1
FT                   /gene="Zfpn1a1"
FT                   /locus_tag="mCG_3994"
FT                   /product="zinc finger protein, subfamily 1A, 1 (Ikaros),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3994.3 transcript_id=mCT2888.2
FT                   protein_id=mCP7782.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SWU0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1342540"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SWU0"
FT                   /protein_id="EDL40643.1"
FT                   /translation="MDVDEGQDMSQVSGKESPPVSDTPDEGDEPMPVPEDLSTTSGAQQ
FT                   NSKSDRGMGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGH
FT                   LRTHSVGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGMYPVIKEETNHNEMAE
FT                   DLCKIGAERSLVLDRLASNVAKRKSSMPQKFLGDKCLSDMPYDSANYEKEDMMTSHVMD
FT                   QAINNAINYLGAESLRPLVQTPPGSSEVVPVISSMYQLHKPPSDGPPRSNHSAQDAVDN
FT                   LLLLSKAKSVSSEREASPSNSCQDSTDTESNAEEQRSGLIYLTNHINPHARNGLALKEE
FT                   QRAYEVLRAASENSQDAFRVVSTSGEQLKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPF
FT                   ECNMCGYHSQDRYEFSSHITRGEHRYHLS"
FT   assembly_gap    8634292..8634388
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    8658086..8658555
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    8661532..8661763
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   gene            complement(8695947..>8704593)
FT                   /gene="Fignl1"
FT                   /locus_tag="mCG_3993"
FT                   /note="gene_id=mCG3993.2"
FT   mRNA            complement(join(8695947..8698722,8701755..8701874,
FT                   8704554..>8704591))
FT                   /gene="Fignl1"
FT                   /locus_tag="mCG_3993"
FT                   /product="fidgetin-like 1, transcript variant mCT193941"
FT                   /note="gene_id=mCG3993.2 transcript_id=mCT193941.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(8696033..8698722,8701755..8701874,
FT                   8704544..8704581))
FT                   /gene="Fignl1"
FT                   /locus_tag="mCG_3993"
FT                   /product="fidgetin-like 1, transcript variant mCT2887"
FT                   /note="gene_id=mCG3993.2 transcript_id=mCT2887.1 created on
FT                   03-JUN-2002"
FT   mRNA            complement(join(8696211..8698722,8701618..8701874,
FT                   8704554..>8704593))
FT                   /gene="Fignl1"
FT                   /locus_tag="mCG_3993"
FT                   /product="fidgetin-like 1, transcript variant mCT193940"
FT                   /note="gene_id=mCG3993.2 transcript_id=mCT193940.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(8696661..8698722,8701618..>8701661))
FT                   /codon_start=1
FT                   /gene="Fignl1"
FT                   /locus_tag="mCG_3993"
FT                   /product="fidgetin-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG3993.2 transcript_id=mCT193940.0
FT                   protein_id=mCP114904.0 isoform=CRA_a"
FT                   /protein_id="EDL40644.1"
FT                   /translation="FSQWFLQKNMNIQKLTFDMETSSSMSVETTRSVQVDEWQKNYCVV
FT                   TSSICTPKQKADAYRALLLHIQYAYANSEISQVFATNLFKRYTEKYSAIIDSDNVVTGL
FT                   NNYAESIFALAGSRQADSNKWQSGLSIDNVFKMSCVQEMMQAGKKFEESLLEPADASVV
FT                   LCKEPTAFEVPQLSVCGGSEDADILSSSGHDTDKTQAIPGSSLRCSPFQSARLPKETNT
FT                   TKTCLTSSTSLGESATAAFHMTPLFGNTEKDTQSFPKTSTGLNMFLSNLSCVPSGCENP
FT                   QERKAFNDSDIIDILSNPTLNKAPSKTEDRGRREDNSLPTFKTAKEQLWVDQKKKGHQS
FT                   QHTSKSSNGVMKKSLGAGRSRGIFGKFVPPVSNKQDGSEQHAKKHKSSRAGSAEPAHLT
FT                   DDCLKNVEPRMVELIMNEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRPDIFTGLR
FT                   GPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVAR
FT                   CQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQ
FT                   EIDEAARRRLVKRLYIPLPEASARKQIVGNLMSKEQCCLSDEETDLVVQQSDGFSGADM
FT                   TQLCREASLGPIRSLHAADIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWN
FT                   ETFGCGK"
FT   CDS             complement(8696661..>8698721)
FT                   /codon_start=1
FT                   /gene="Fignl1"
FT                   /locus_tag="mCG_3993"
FT                   /product="fidgetin-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG3993.2 transcript_id=mCT193941.0
FT                   protein_id=mCP114905.0 isoform=CRA_b"
FT                   /protein_id="EDL40645.1"
FT                   /translation="TFDMETSSSMSVETTRSVQVDEWQKNYCVVTSSICTPKQKADAYR
FT                   ALLLHIQYAYANSEISQVFATNLFKRYTEKYSAIIDSDNVVTGLNNYAESIFALAGSRQ
FT                   ADSNKWQSGLSIDNVFKMSCVQEMMQAGKKFEESLLEPADASVVLCKEPTAFEVPQLSV
FT                   CGGSEDADILSSSGHDTDKTQAIPGSSLRCSPFQSARLPKETNTTKTCLTSSTSLGESA
FT                   TAAFHMTPLFGNTEKDTQSFPKTSTGLNMFLSNLSCVPSGCENPQERKAFNDSDIIDIL
FT                   SNPTLNKAPSKTEDRGRREDNSLPTFKTAKEQLWVDQKKKGHQSQHTSKSSNGVMKKSL
FT                   GAGRSRGIFGKFVPPVSNKQDGSEQHAKKHKSSRAGSAEPAHLTDDCLKNVEPRMVELI
FT                   MNEIMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILLFGPPGTG
FT                   KTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSL
FT                   LSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLY
FT                   IPLPEASARKQIVGNLMSKEQCCLSDEETDLVVQQSDGFSGADMTQLCREASLGPIRSL
FT                   HAADIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWNETFGCGK"
FT   CDS             complement(8696661..8698712)
FT                   /codon_start=1
FT                   /gene="Fignl1"
FT                   /locus_tag="mCG_3993"
FT                   /product="fidgetin-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG3993.2 transcript_id=mCT2887.1
FT                   protein_id=mCP7779.1 isoform=CRA_c"
FT                   /protein_id="EDL40646.1"
FT                   /translation="METSSSMSVETTRSVQVDEWQKNYCVVTSSICTPKQKADAYRALL
FT                   LHIQYAYANSEISQVFATNLFKRYTEKYSAIIDSDNVVTGLNNYAESIFALAGSRQADS
FT                   NKWQSGLSIDNVFKMSCVQEMMQAGKKFEESLLEPADASVVLCKEPTAFEVPQLSVCGG
FT                   SEDADILSSSGHDTDKTQAIPGSSLRCSPFQSARLPKETNTTKTCLTSSTSLGESATAA
FT                   FHMTPLFGNTEKDTQSFPKTSTGLNMFLSNLSCVPSGCENPQERKAFNDSDIIDILSNP
FT                   TLNKAPSKTEDRGRREDNSLPTFKTAKEQLWVDQKKKGHQSQHTSKSSNGVMKKSLGAG
FT                   RSRGIFGKFVPPVSNKQDGSEQHAKKHKSSRAGSAEPAHLTDDCLKNVEPRMVELIMNE
FT                   IMDHGPPVHWDDIAGVEFAKATIKEIVVWPMMRPDIFTGLRGPPKGILLFGPPGTGKTL
FT                   IGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQ
FT                   RGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPL
FT                   PEASARKQIVGNLMSKEQCCLSDEETDLVVQQSDGFSGADMTQLCREASLGPIRSLHAA
FT                   DIATISPDQVRPIAYIDFENAFKTVRPTVSPKDLELYENWNETFGCGK"
FT   gene            complement(8709759..8786656)
FT                   /gene="Ddc"
FT                   /locus_tag="mCG_3990"
FT                   /note="gene_id=mCG3990.2"
FT   mRNA            complement(join(8709759..8710173,8710867..8711084,
FT                   8714978..8715079,8717866..8717964,8720520..8720539,
FT                   8725239..8725315,8731865..8731932,8735510..8735604,
FT                   8742743..8742809,8759765..8759908,8761012..8761146,
FT                   8769251..8769370,8772376..8772489,8776569..8776777,
FT                   8786494..8786656))
FT                   /gene="Ddc"
FT                   /locus_tag="mCG_3990"
FT                   /product="dopa decarboxylase"
FT                   /note="gene_id=mCG3990.2 transcript_id=mCT2890.2 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(8710884..8711084,8714978..8715079,
FT                   8717866..8717964,8720520..8720539,8725239..8725315,
FT                   8731865..8731932,8735510..8735604,8742743..8742809,
FT                   8759765..8759908,8761012..8761146,8769251..8769370,
FT                   8772376..8772489,8776569..8776777,8786494..8786584))
FT                   /codon_start=1
FT                   /gene="Ddc"
FT                   /locus_tag="mCG_3990"
FT                   /product="dopa decarboxylase"
FT                   /note="gene_id=mCG3990.2 transcript_id=mCT2890.2
FT                   protein_id=mCP7845.2"
FT                   /protein_id="EDL40647.1"
FT                   /translation="MAIASSVSFNCHQGERESKRANREEATPAAFFNMDSREFRRRGKE
FT                   MVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHW
FT                   HSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPE
FT                   AFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSD
FT                   QAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSC
FT                   CSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLV
FT                   NFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSLKMWFVF
FT                   RMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELNETLLQ
FT                   RINSAKKIHLVPCRLRDKFVLRFAVCARTVESAHVQLAWEHISDLASSVLRAEKE"
FT   assembly_gap    8712390..8712649
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    8723260..8724070
FT                   /estimated_length=811
FT                   /gap_type="unknown"
FT   assembly_gap    8743454..8743608
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    8750620..8750783
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            <8764233..8781444
FT                   /locus_tag="mCG_145625"
FT                   /note="gene_id=mCG145625.0"
FT   mRNA            join(<8764233..8764310,8767073..8767265,8779083..8779205,
FT                   8780764..8781444)
FT                   /locus_tag="mCG_145625"
FT                   /product="mCG145625"
FT                   /note="gene_id=mCG145625.0 transcript_id=mCT185049.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<8767148..8767265,8779083..8779204)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145625"
FT                   /product="mCG145625"
FT                   /note="gene_id=mCG145625.0 transcript_id=mCT185049.0
FT                   protein_id=mCP105945.0"
FT                   /protein_id="EDL40648.1"
FT                   /translation="RSQQIRLQRHDPELFGVNSPRTAMNPRSSCFLLSTVGITVFSTKG
FT                   TTHRHDLKMTQPPFQSYHLGAHFSQECLGDNGDT"
FT   assembly_gap    8772010..8772100
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    8782408..8782508
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    8792396..8795209
FT                   /estimated_length=2814
FT                   /gap_type="unknown"
FT   assembly_gap    8799817..8799836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8801538..8801557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8806592..8806908
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    8809348..8809668
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   gene            complement(8826126..8883309)
FT                   /gene="Grb10"
FT                   /locus_tag="mCG_116329"
FT                   /note="gene_id=mCG116329.1"
FT   mRNA            complement(join(8826126..8829233,8829823..8829916,
FT                   8832314..8832401,8832597..8832663,8833403..8833519,
FT                   8834006..8834080,8839485..8839583,8840419..8840529,
FT                   8841098..8841235,8841567..8841635,8842290..8842405,
FT                   8847106..8847262,8850347..8850511,8863139..8863292,
FT                   8866030..8866249,8883229..8883309))
FT                   /gene="Grb10"
FT                   /locus_tag="mCG_116329"
FT                   /product="growth factor receptor bound protein 10,
FT                   transcript variant mCT169896"
FT                   /note="gene_id=mCG116329.1 transcript_id=mCT169896.0
FT                   created on 03-JUN-2002"
FT   mRNA            complement(join(8826126..8829233,8829823..8829916,
FT                   8832314..8832401,8832597..8832663,8833403..8833519,
FT                   8834006..8834080,8839485..8839583,8840419..8840529,
FT                   8841098..8841235,8841567..8841635,8842290..8842405,
FT                   8847106..8847262,8850347..8850511,8853355..8853429,
FT                   8863139..8863292,8866030..8866249,8883229..8883309))
FT                   /gene="Grb10"
FT                   /locus_tag="mCG_116329"
FT                   /product="growth factor receptor bound protein 10,
FT                   transcript variant mCT117449"
FT                   /note="gene_id=mCG116329.1 transcript_id=mCT117449.1
FT                   created on 03-JUN-2002"
FT   CDS             complement(join(8829087..8829233,8829823..8829916,
FT                   8832314..8832401,8832597..8832663,8833403..8833519,
FT                   8834006..8834080,8839485..8839583,8840419..8840529,
FT                   8841098..8841235,8841567..8841635,8842290..8842405,
FT                   8847106..8847262,8850347..8850511,8863139..8863292,
FT                   8866030..8866223))
FT                   /codon_start=1
FT                   /gene="Grb10"
FT                   /locus_tag="mCG_116329"
FT                   /product="growth factor receptor bound protein 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG116329.1 transcript_id=mCT169896.0
FT                   protein_id=mCP92555.0 isoform=CRA_b"
FT                   /protein_id="EDL40650.1"
FT                   /translation="MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRG
FT                   QPQASPRQKMQRSQPVHILRRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSS
FT                   LPPPPSQPPAKHFPPGFQLSKLTRPGLWTKTTARFSKKQPKNQCPTDTVNPVARMPTSQ
FT                   MEKLRLRKDVKVFSEDGTSKVVEILTDMTARDLCQLLVYKSHCVDDNSWTLVEHHPQLG
FT                   LERCLEDHEIVVQVESTMPSESKFLFRKNYAKYEFFKNPVNFFPDQMVNWCQQSNGGQA
FT                   QLLQNFLNTSSCPEIQGFLQVKEVGRKSWKKLYVCLRRSGLYYSTKGTSKEPRHLQLLA
FT                   DLEESSIFYLIAGKKQYNAPNEHGMCIKPNKAKTEMKELRLLCAEDEQIRTCWMTAFRL
FT                   LKYGMLLYQNYRIPQRKGLPPPFNAPMRSVSENSLVAMDFSGQIGRVIDNPAEAQSAAL
FT                   EEGHAWRKRSTRMNILSSQSPLHPSTLNAVIHRTQHWFHGRISREESHRIIKQQGLVDG
FT                   LFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFTLDDGNTKFSDLIQLVDFY
FT                   QLNKGVLPCKLKHHCIRVAL"
FT   CDS             complement(join(8829087..8829233,8829823..8829916,
FT                   8832314..8832401,8832597..8832663,8833403..8833519,
FT                   8834006..8834080,8839485..8839583,8840419..8840529,
FT                   8841098..8841235,8841567..8841635,8842290..8842405,
FT                   8847106..8847262,8850347..8850511,8853355..8853429,
FT                   8863139..8863292,8866030..8866223))
FT                   /codon_start=1
FT                   /gene="Grb10"
FT                   /locus_tag="mCG_116329"
FT                   /product="growth factor receptor bound protein 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG116329.1 transcript_id=mCT117449.1
FT                   protein_id=mCP59492.0 isoform=CRA_a"
FT                   /protein_id="EDL40649.1"
FT                   /translation="MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRG
FT                   QPQASPRQKMQRSQPVHILRRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSS
FT                   LPPPPSQPPAKHCGRCEKWIPGENTRGNGKRKIWRWQFPPGFQLSKLTRPGLWTKTTAR
FT                   FSKKQPKNQCPTDTVNPVARMPTSQMEKLRLRKDVKVFSEDGTSKVVEILTDMTARDLC
FT                   QLLVYKSHCVDDNSWTLVEHHPQLGLERCLEDHEIVVQVESTMPSESKFLFRKNYAKYE
FT                   FFKNPVNFFPDQMVNWCQQSNGGQAQLLQNFLNTSSCPEIQGFLQVKEVGRKSWKKLYV
FT                   CLRRSGLYYSTKGTSKEPRHLQLLADLEESSIFYLIAGKKQYNAPNEHGMCIKPNKAKT
FT                   EMKELRLLCAEDEQIRTCWMTAFRLLKYGMLLYQNYRIPQRKGLPPPFNAPMRSVSENS
FT                   LVAMDFSGQIGRVIDNPAEAQSAALEEGHAWRKRSTRMNILSSQSPLHPSTLNAVIHRT
FT                   QHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCED
FT                   DGQTFFTLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL"
FT   assembly_gap    8879011..8879030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8920215..8920265
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    8932209..8932947
FT                   /estimated_length=739
FT                   /gap_type="unknown"
FT   assembly_gap    8947582..8947601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8990307..8993896
FT                   /estimated_length=3590
FT                   /gap_type="unknown"
FT   assembly_gap    9005025..9005044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9023652..9025259
FT                   /estimated_length=1608
FT                   /gap_type="unknown"
FT   assembly_gap    9026445..9026464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9046153..9046704
FT                   /estimated_length=552
FT                   /gap_type="unknown"
FT   assembly_gap    9055709..9055728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9058148..9058167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9080479..9080498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9083294..9083395
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    9088730..9089517
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    9107279..9107338
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   gene            complement(9115000..>9345730)
FT                   /gene="Cobl"
FT                   /locus_tag="mCG_9589"
FT                   /note="gene_id=mCG9589.3"
FT   mRNA            complement(join(9115000..9116381,9127974..9128237,
FT                   9129347..9129466,9131413..9133295,9134484..9134581,
FT                   9143979..9144267,9187696..9187866,9190352..9190490,
FT                   9224889..9225062,9246231..9246305,9250714..9250811,
FT                   9256743..9256971,9259082..9259292,9267482..9267685,
FT                   9345589..>9345707))
FT                   /gene="Cobl"
FT                   /locus_tag="mCG_9589"
FT                   /product="cordon-bleu, transcript variant mCT193930"
FT                   /note="gene_id=mCG9589.3 transcript_id=mCT193930.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(9115008..9116381,9127974..9128237,
FT                   9129347..9129466,9131413..9133295,9190352..9190490,
FT                   9224889..9225062,9246231..9246305,9250714..9250811,
FT                   9256743..9256971,9259082..9259292,9267482..9267685,
FT                   9345589..>9345730))
FT                   /gene="Cobl"
FT                   /locus_tag="mCG_9589"
FT                   /product="cordon-bleu, transcript variant mCT9397"
FT                   /note="gene_id=mCG9589.3 transcript_id=mCT9397.2 created on
FT                   03-JUN-2002"
FT   CDS             complement(join(9116364..9116381,9127974..9128237,
FT                   9129347..9129466,9131413..9133295,9190352..9190490,
FT                   9224889..9225062,9246231..9246305,9250714..9250811,
FT                   9256743..9256971,9259082..9259292,9267482..9267685,
FT                   9345589..>9345686))
FT                   /codon_start=1
FT                   /gene="Cobl"
FT                   /locus_tag="mCG_9589"
FT                   /product="cordon-bleu, isoform CRA_c"
FT                   /note="gene_id=mCG9589.3 transcript_id=mCT9397.2
FT                   protein_id=mCP7760.2 isoform=CRA_c"
FT                   /protein_id="EDL40653.1"
FT                   /translation="GRRRRSQRPSRPAEQPAGSMDAPRALAAKPPTGRKMKARAPPPPG
FT                   KPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSGLEKQSVVSGSHAM
FT                   MDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHTVLLKEKVPEERVK
FT                   PGLTKAPEKSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVA
FT                   GEELELSKSLNELGIKELYAWDNRREMFRKSSLGNDETDKEKKKFLGFFKANKRSNSKA
FT                   EHLGLSGADSDEDPAKSASGGDLNGCVTTPNSPSLHSRSLTLGPSLSLGNISGVSMKSD
FT                   MKKRRAPPPPSPKLLGQDKVSEKASLSSQADLQKKKRRAPAPPPPQQPPPSPVVPNRKE
FT                   DKEENRKSTVGMEENYETDTSSLTNSVNGVSNHSLQEAIIPDSGVDDIPVTFIGEVSDE
FT                   PFDSGLFSSRCNNATTFNTGSIASQRSHLSPSQTEHSQPFVRTSRKEPDPSPPSQDNRK
FT                   RNQPTLANTSENENPVETDPTVTSLVSKLLIDDPKAKDKGKVHGSSHSEKTQAGHGINS
FT                   LRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGLTTYKIVPPKSEMRCYDRDVSLS
FT                   TGAIKIDELGNLVSPHMNGSRTISPPSAVVETDTPPIGKVKEFWRRNSMEKYLNGPAEC
FT                   TIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQEYGAHLEEERSRPRSAVSCS
FT                   VKVPASNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKATTEQCHEEAKL
FT                   ARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPGVQLPAGGHPKVEVNSTYGKSS
FT                   TQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQKANSTSNFSQALDKAHP
FT                   PPLLLAEARDSGRILMNGSARTPGNCEPPHSPKESTLTSYIILQTEEKPSSLSTDGQDA
FT                   DDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGREKLRKTAEQTSEGRPK
FT                   KPSYVEAESERSALLAAIRGHSGTLSLRKVSSLASEELQSFRNAALGAPGLDKPQQEDL
FT                   GLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQALMDAIRSGTGAARLRKV
FT                   PLLV"
FT   CDS             complement(join(9116364..9116381,9127974..9128237,
FT                   9129347..9129466,9131413..9133295,9134484..9134581,
FT                   9143979..9144267,9187696..9187866,9190352..9190490,
FT                   9224889..9225062,9246231..9246305,9250714..9250811,
FT                   9256743..9256971,9259082..9259292,9267482..9267685,
FT                   9345589..>9345686))
FT                   /codon_start=1
FT                   /gene="Cobl"
FT                   /locus_tag="mCG_9589"
FT                   /product="cordon-bleu, isoform CRA_b"
FT                   /note="gene_id=mCG9589.3 transcript_id=mCT193930.0
FT                   protein_id=mCP114908.0 isoform=CRA_b"
FT                   /protein_id="EDL40652.1"
FT                   /translation="GRRRRSQRPSRPAEQPAGSMDAPRALAAKPPTGRKMKARAPPPPG
FT                   KPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSGLEKQSVVSGSHAM
FT                   MDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHTVLLKEKVPEERVK
FT                   PGLTKAPEKSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVA
FT                   GEELELSKSLNELGIKELYAWDNRREMFRKSSLGNDETDKEKKKFLGFFKANKRSNSKA
FT                   EHLGLSGADSDEDPAKSASGGDLNGCVTTPNSPSLHSRSLTLGPSLSLGNISGVSMKSD
FT                   MKKRRAPPPPSPKLLGQDKVSEKASLSSQADLQKKKRRAPAPPPPQQPPPSPVVPNRKE
FT                   DKEENRKSTVGVGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVTEPVTFPGEGAGS
FT                   ETSELRPKLSLPLGPGSHCSMGGVSQVPAESEETASEDTTEDSGVMSSPSDAISLDSQQ
FT                   DSMRSKDKWSTDQEDGSDQDLAGTPELGPQKSPSWGKSGSGSSILRTEKATMPTNDDED
FT                   LFITGHLHQTLAELDEDLEGMEENYETDTSSLTNSVNGVSNHSLQEAIIPDSGVDDIPV
FT                   TFIGEVSDEPFDSGLFSSRCNNATTFNTGSIASQRSHLSPSQTEHSQPFVRTSRKEPDP
FT                   SPPSQDNRKRNQPTLANTSENENPVETDPTVTSLVSKLLIDDPKAKDKGKVHGSSHSEK
FT                   TQAGHGINSLRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGLTTYKIVPPKSEMR
FT                   CYDRDVSLSTGAIKIDELGNLVSPHMNGSRTISPPSAVVETDTPPIGKVKEFWRRNSME
FT                   KYLNGPAECTIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQEYGAHLEEERS
FT                   RPRSAVSCSVKVPASNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKATT
FT                   EQCHEEAKLARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPGVQLPAGGHPKVE
FT                   VNSTYGKSSTQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQKANSTSNF
FT                   SQALDKAHPPPLLLAEARDSGRILMNGSARTPGNCEPPHSPKESTLTSYIILQTEEKPS
FT                   SLSTDGQDADDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGREKLRKTA
FT                   EQTSEGRPKKPSYVEAESERSALLAAIRGHSGTLSLRKVSSLASEELQSFRNAALGAPG
FT                   LDKPQQEDLGLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQALMDAIRSG
FT                   TGAARLRKVPLLV"
FT   assembly_gap    9142619..9142638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9145154..9145173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9146219..9148289
FT                   /estimated_length=2071
FT                   /gap_type="unknown"
FT   mRNA            complement(join(9177250..9177303,9187696..9187866,
FT                   9190352..9190490,9224889..9225062,9246231..9246305,
FT                   9250714..9250811,9256743..9256971,9259082..9259292,
FT                   9267482..9267685,9345589..>9345730))
FT                   /gene="Cobl"
FT                   /locus_tag="mCG_9589"
FT                   /product="cordon-bleu, transcript variant mCT169918"
FT                   /note="gene_id=mCG9589.3 transcript_id=mCT169918.0 created
FT                   on 03-JUN-2002"
FT   CDS             complement(join(9177260..9177303,9187696..9187866,
FT                   9190352..9190490,9224889..9225062,9246231..9246305,
FT                   9250714..9250811,9256743..9256971,9259082..9259292,
FT                   9267482..9267685,9345589..>9345686))
FT                   /codon_start=1
FT                   /gene="Cobl"
FT                   /locus_tag="mCG_9589"
FT                   /product="cordon-bleu, isoform CRA_a"
FT                   /note="gene_id=mCG9589.3 transcript_id=mCT169918.0
FT                   protein_id=mCP92542.0 isoform=CRA_a"
FT                   /protein_id="EDL40651.1"
FT                   /translation="GRRRRSQRPSRPAEQPAGSMDAPRALAAKPPTGRKMKARAPPPPG
FT                   KPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSGLEKQSVVSGSHAM
FT                   MDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHTVLLKEKVPEERVK
FT                   PGLTKAPEKSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVA
FT                   GEELELSKSLNELGIKELYAWDNRREMFRKSSLGNDETDKEKKKFLGFFKANKRSNSKA
FT                   EHLGLSGADSDEDPAKSASGGDLNGCVTTPNSPSLHSRSLTLGPSLSLGNISGVSMKSD
FT                   MKKRRAPPPPSPKLLGQDKVSEKASLSSQADLQKKKRRAPAPPPPQQPPPSPVVPNRKE
FT                   DKEENRKSTVGVGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVTEPVTFPGEGAGS
FT                   ETSELRPKLYCCASFPTHAKRS"
FT   gene            <9195598..9218285
FT                   /locus_tag="mCG_145062"
FT                   /note="gene_id=mCG145062.0"
FT   mRNA            join(<9195598..9195751,9201420..9201510,9202225..9202328,
FT                   9203333..9203406,9216906..9218285)
FT                   /locus_tag="mCG_145062"
FT                   /product="mCG145062"
FT                   /note="gene_id=mCG145062.0 transcript_id=mCT184486.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    9211353..9211507
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   CDS             <9217415..9217702
FT                   /codon_start=1
FT                   /locus_tag="mCG_145062"
FT                   /product="mCG145062"
FT                   /note="gene_id=mCG145062.0 transcript_id=mCT184486.0
FT                   protein_id=mCP105942.0"
FT                   /protein_id="EDL40654.1"
FT                   /translation="TKGRCPVAKISCRFLPPRTLSMAALLFPPRNFLCGLFSQALQWKG
FT                   AAQVLRDVCVGKAPVFHHAAEHNAVCPHFLHRQRTSMGASQTLETSLHFH"
FT   assembly_gap    9312243..9312262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9327199..9327218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9331970..9332093
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    9345803..9345901
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    9410575..9410594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9423864..9423883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9430688..9430707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9439426..9442853
FT                   /estimated_length=3428
FT                   /gap_type="unknown"
FT   assembly_gap    9448045..9448064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9453146..9453439
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    9454805..9454824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9460580..9460599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9462809..9462828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9464005..9464024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9465679..9465698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9468472..9468491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9509424..9509443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9517516..9517535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9518858..9519688
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   gene            9520512..9520898
FT                   /pseudo
FT                   /locus_tag="mCG_9591"
FT                   /note="gene_id=mCG9591.1"
FT   mRNA            9520512..9520898
FT                   /pseudo
FT                   /locus_tag="mCG_9591"
FT                   /note="gene_id=mCG9591.1 transcript_id=mCT9398.1 created on
FT                   03-JUN-2002"
FT   assembly_gap    9535736..9573401
FT                   /estimated_length=37666
FT                   /gap_type="unknown"
FT   assembly_gap    9599092..9599111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9621875..9621894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9624205..9625619
FT                   /estimated_length=1415
FT                   /gap_type="unknown"
FT   assembly_gap    9633421..9633861
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   assembly_gap    9645005..9647086
FT                   /estimated_length=2082
FT                   /gap_type="unknown"
FT   assembly_gap    9653188..9658237
FT                   /estimated_length=5050
FT                   /gap_type="unknown"
FT   assembly_gap    9660981..9662759
FT                   /estimated_length=1779
FT                   /gap_type="unknown"
FT   assembly_gap    9678155..9681668
FT                   /estimated_length=3514
FT                   /gap_type="unknown"
FT   assembly_gap    9688457..9708929
FT                   /estimated_length=20473
FT                   /gap_type="unknown"
FT   assembly_gap    9724014..9724033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9725166..9725350
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    9747758..9747777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9770639..9770658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9771902..9771921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9773063..9773290
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    9777519..9779131
FT                   /estimated_length=1613
FT                   /gap_type="unknown"
FT   gene            complement(9804738..9805857)
FT                   /pseudo
FT                   /locus_tag="mCG_9592"
FT                   /note="gene_id=mCG9592.3"
FT   mRNA            complement(9804738..9805857)
FT                   /pseudo
FT                   /locus_tag="mCG_9592"
FT                   /note="gene_id=mCG9592.3 transcript_id=mCT9399.3 created on
FT                   15-JUL-2003"
FT   assembly_gap    9838934..9839029
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   gene            9860533..9861161
FT                   /pseudo
FT                   /locus_tag="mCG_49964"
FT                   /note="gene_id=mCG49964.2"
FT   mRNA            9860533..9861161
FT                   /pseudo
FT                   /locus_tag="mCG_49964"
FT                   /note="gene_id=mCG49964.2 transcript_id=mCT50147.2 created
FT                   on 03-JUN-2002"
FT   assembly_gap    9896241..9896299
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    9904493..9904514
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    9927080..9931612
FT                   /estimated_length=4533
FT                   /gap_type="unknown"
FT   assembly_gap    9939743..9940088
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    9972728..9973119
FT                   /estimated_length=392
FT                   /gap_type="unknown"
FT   assembly_gap    10062645..10062664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10095405..10095424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10099434..10099453
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10102289..10102308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10103600..10103619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10107030..10107049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10108099..10108118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10125748..10126318
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    10162934..10162953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10164866..10165720
FT                   /estimated_length=855
FT                   /gap_type="unknown"
FT   assembly_gap    10168021..10168313
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    10181423..10181442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10185754..10185773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10208431..10208450
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10210725..10216845
FT                   /estimated_length=6121
FT                   /gap_type="unknown"
FT   assembly_gap    10219783..10219802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10247492..10248028
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    10276413..10276432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10277857..10277912
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    10319889..10319908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10323367..10323386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10324762..10324781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10348413..10348432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10354739..10354758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10359749..10359768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10369205..10369224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10377508..10377528
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    10412958..10412977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10456058..10456077
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10466172..10466191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10474122..10474141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10476510..10476529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10501256..10501275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10546122..10546141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10560982..10561001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10567603..10567683
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    10571675..10571966
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    10610979..10611212
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    10662466..10662485
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10664983..10666835
FT                   /estimated_length=1853
FT                   /gap_type="unknown"
FT   assembly_gap    10714746..10714765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10764952..10764971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10770205..10770224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10773546..10773565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10789199..10791380
FT                   /estimated_length=2182
FT                   /gap_type="unknown"
FT   assembly_gap    10847170..10847189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10860476..10860620
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    10867097..10867116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10878793..10879164
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    10880674..10883041
FT                   /estimated_length=2368
FT                   /gap_type="unknown"
FT   assembly_gap    10889889..10892252
FT                   /estimated_length=2364
FT                   /gap_type="unknown"
FT   gene            complement(10911710..>11029277)
FT                   /locus_tag="mCG_145626"
FT                   /note="gene_id=mCG145626.0"
FT   mRNA            complement(join(10911710..10912838,10916248..10916408,
FT                   10997737..10997916,11029143..>11029277))
FT                   /locus_tag="mCG_145626"
FT                   /product="mCG145626"
FT                   /note="gene_id=mCG145626.0 transcript_id=mCT185050.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(10911755..>10912030)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145626"
FT                   /product="mCG145626"
FT                   /note="gene_id=mCG145626.0 transcript_id=mCT185050.0
FT                   protein_id=mCP105946.0"
FT                   /protein_id="EDL40655.1"
FT                   /translation="IWGELRCRFLMLIQHLKQELLSFFIIQGFPHYYGNEVSSELLPQE
FT                   LLFANPIEYWIPGALLDKSFYSYSNHCSIFTSSALCIFLHSSLHIY"
FT   assembly_gap    10922374..10922393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10923862..10923881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10927596..10927615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10931428..10931447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10932690..10932709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10940061..10940080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10942409..10942428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10944747..10945072
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   assembly_gap    10947221..10947386
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    10968915..10969168
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    10974135..10974154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10987495..10987639
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    10995850..10995869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11009175..11009194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11012258..11012710
FT                   /locus_tag="mCG_50546"
FT                   /note="gene_id=mCG50546.1"
FT   mRNA            <11012258..11012710
FT                   /locus_tag="mCG_50546"
FT                   /product="mCG50546"
FT                   /note="gene_id=mCG50546.1 transcript_id=mCT50729.1 created
FT                   on 04-JUN-2002"
FT   CDS             <11012291..11012695
FT                   /codon_start=1
FT                   /locus_tag="mCG_50546"
FT                   /product="mCG50546"
FT                   /note="gene_id=mCG50546.1 transcript_id=mCT50729.1
FT                   protein_id=mCP34980.1"
FT                   /protein_id="EDL40656.1"
FT                   /translation="EKACAEGGQKKKQVLKFTLDCTHLVEDGIMDAANFEQCLQERIKV
FT                   NGKAGNLGGGVVTIEQSKSKITVTSEVPFSKRYLKYLTKKYLKKNSLGDWLRVVANSKE
FT                   SYELRYFQINQDEKRTKIRTHWSAMFCINS"
FT   gene            11115006..11117572
FT                   /pseudo
FT                   /locus_tag="mCG_52687"
FT                   /note="gene_id=mCG52687.2"
FT   mRNA            11115006..11117572
FT                   /pseudo
FT                   /locus_tag="mCG_52687"
FT                   /note="gene_id=mCG52687.2 transcript_id=mCT52870.2 created
FT                   on 04-JUN-2002"
FT   assembly_gap    11147254..11147273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11158657..11159350
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    11179451..11179470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11224889..11225325
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    11235489..11238294
FT                   /estimated_length=2806
FT                   /gap_type="unknown"
FT   assembly_gap    11239465..11239484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11243372..11243391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11291446..11291465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11310087..11310380
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    11324058..11324800
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    11325736..11326556
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    11327502..11327521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11329448..11329635
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    11365917..11365936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11369476..11369495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11380373..11380392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11382834..11382853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11384780..11384799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11393300..11393659
FT                   /estimated_length=360
FT                   /gap_type="unknown"
FT   assembly_gap    11401150..11401205
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            complement(11412589..>11449359)
FT                   /locus_tag="mCG_145624"
FT                   /note="gene_id=mCG145624.0"
FT   mRNA            complement(join(11412589..11412833,11427654..11427761,
FT                   11427944..11428055,11449304..>11449359))
FT                   /locus_tag="mCG_145624"
FT                   /product="mCG145624"
FT                   /note="gene_id=mCG145624.0 transcript_id=mCT185048.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(11412798..11412833,11427654..11427761,
FT                   11427944..>11428039))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145624"
FT                   /product="mCG145624"
FT                   /note="gene_id=mCG145624.0 transcript_id=mCT185048.0
FT                   protein_id=mCP105944.0"
FT                   /protein_id="EDL40657.1"
FT                   /translation="NHSKCWPSAANFGGGISENDSHCLSIHQSMLQGTWIQFLAPTWRF
FT                   MNTYNSSSKRSNILFWPLKHSHKIKCPVQHECRP"
FT   assembly_gap    11436656..11436675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11473292..11508027)
FT                   /pseudo
FT                   /locus_tag="mCG_1041235"
FT                   /note="gene_id=mCG1041235.1"
FT   mRNA            complement(join(11473292..11473866,11474442..11475513,
FT                   11507704..11508027))
FT                   /pseudo
FT                   /locus_tag="mCG_1041235"
FT                   /note="gene_id=mCG1041235.1 transcript_id=mCT158939.1
FT                   created on 04-JUN-2002"
FT   assembly_gap    11489658..11489677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11491805..11491824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11493866..11493885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11503061..11503080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11508033..11508052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11576512..11576531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11577951..11578544
FT                   /pseudo
FT                   /locus_tag="mCG_1041162"
FT                   /note="gene_id=mCG1041162.1"
FT   mRNA            11577951..11578544
FT                   /pseudo
FT                   /locus_tag="mCG_1041162"
FT                   /note="gene_id=mCG1041162.1 transcript_id=mCT158866.1
FT                   created on 04-JUN-2002"
FT   assembly_gap    11635739..11635758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11653230..11653249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11660683..11660702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11662734..11662827
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    11752898..11758888
FT                   /estimated_length=5991
FT                   /gap_type="unknown"
FT   assembly_gap    11812726..11812745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11820429..11820448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11850898..11850917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11882258..11882277
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11908888..11908907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11913397..11914514
FT                   /pseudo
FT                   /locus_tag="mCG_50832"
FT                   /note="gene_id=mCG50832.1"
FT   mRNA            11913397..11914514
FT                   /pseudo
FT                   /locus_tag="mCG_50832"
FT                   /note="gene_id=mCG50832.1 transcript_id=mCT51015.1 created
FT                   on 04-JUN-2002"
FT   assembly_gap    12052775..12054072
FT                   /estimated_length=1298
FT                   /gap_type="unknown"
FT   assembly_gap    12056247..12056677
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    12092672..12092691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12096178..12096221
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    12103229..12103248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12109116..12109135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12111454..12111965
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    12138024..12139992
FT                   /estimated_length=1969
FT                   /gap_type="unknown"
FT   assembly_gap    12140715..12142938
FT                   /estimated_length=2224
FT                   /gap_type="unknown"
FT   assembly_gap    12147497..12149397
FT                   /estimated_length=1901
FT                   /gap_type="unknown"
FT   assembly_gap    12161013..12166053
FT                   /estimated_length=5041
FT                   /gap_type="unknown"
FT   assembly_gap    12232099..12232118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12267246..12267290
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    12274801..12274820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12311654..12311673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12338865..12345535
FT                   /pseudo
FT                   /locus_tag="mCG_58750"
FT                   /note="gene_id=mCG58750.2"
FT   mRNA            join(12338865..12339669,12344983..12345535)
FT                   /pseudo
FT                   /locus_tag="mCG_58750"
FT                   /note="gene_id=mCG58750.2 transcript_id=mCT58933.2 created
FT                   on 04-JUN-2002"
FT   assembly_gap    12354945..12355266
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    12358785..12360689
FT                   /estimated_length=1905
FT                   /gap_type="unknown"
FT   assembly_gap    12380261..12381680
FT                   /estimated_length=1420
FT                   /gap_type="unknown"
FT   assembly_gap    12392358..12392377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12477579..12477598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12484570..12484736
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    12527819..12528198
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    12553776..12554440
FT                   /estimated_length=665
FT                   /gap_type="unknown"
FT   assembly_gap    12571052..12571178
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    12585880..12588543
FT                   /estimated_length=2664
FT                   /gap_type="unknown"
FT   assembly_gap    12589182..12590472
FT                   /estimated_length=1291
FT                   /gap_type="unknown"
FT   assembly_gap    12591863..12592328
FT                   /estimated_length=466
FT                   /gap_type="unknown"
FT   assembly_gap    12609592..12609611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12629743..12630313
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    12634153..12634172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12650562..12650581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12668884..12668903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12685781..12685800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12705052..12705071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12775116..12779760
FT                   /estimated_length=4645
FT                   /gap_type="unknown"
FT   assembly_gap    12808081..12808100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12834317..12834390
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    12859560..12859579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12907334..12907596
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    12909722..12912802
FT                   /estimated_length=3081
FT                   /gap_type="unknown"
FT   assembly_gap    12927458..12927544
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    12933170..12937606
FT                   /estimated_length=4437
FT                   /gap_type="unknown"
FT   assembly_gap    13031193..13031642
FT                   /estimated_length=450
FT                   /gap_type="unknown"
FT   assembly_gap    13040928..13041264
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    13042708..13042727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13066155..13066174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13066176..13066658
FT                   /pseudo
FT                   /locus_tag="mCG_1041142"
FT                   /note="gene_id=mCG1041142.1"
FT   mRNA            13066176..13066658
FT                   /pseudo
FT                   /locus_tag="mCG_1041142"
FT                   /note="gene_id=mCG1041142.1 transcript_id=mCT158846.1
FT                   created on 05-JUN-2002"
FT   assembly_gap    13070251..13071279
FT                   /estimated_length=1029
FT                   /gap_type="unknown"
FT   gene            13087342..13249557
FT                   /gene="BC027127"
FT                   /locus_tag="mCG_7583"
FT                   /note="gene_id=mCG7583.3"
FT   mRNA            join(13087342..13087833,13089602..13089768,
FT                   13091180..13091230,13092656..13092992,13199078..13199237,
FT                   13231969..13232054,13248896..13249557)
FT                   /gene="BC027127"
FT                   /locus_tag="mCG_7583"
FT                   /product="cDNA sequence BC027127, transcript variant
FT                   mCT185629"
FT                   /note="gene_id=mCG7583.3 transcript_id=mCT185629.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(13087342..13087833,13089602..13089768,
FT                   13091180..13091230,13092656..13092992,13112088..13115571)
FT                   /gene="BC027127"
FT                   /locus_tag="mCG_7583"
FT                   /product="cDNA sequence BC027127, transcript variant
FT                   mCT6416"
FT                   /note="gene_id=mCG7583.3 transcript_id=mCT6416.3 created on
FT                   12-JUN-2003"
FT   CDS             join(13087755..13087833,13089602..13089768,
FT                   13091180..13091230,13092656..13092992,13199078..13199237,
FT                   13231969..13232023)
FT                   /codon_start=1
FT                   /gene="BC027127"
FT                   /locus_tag="mCG_7583"
FT                   /product="cDNA sequence BC027127, isoform CRA_a"
FT                   /note="gene_id=mCG7583.3 transcript_id=mCT185629.0
FT                   protein_id=mCP106887.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:2384826"
FT                   /db_xref="UniProtKB/TrEMBL:F6Y6A6"
FT                   /protein_id="EDL40658.1"
FT                   /translation="MMGIFLASVGFMFFSVLYVQQGLSSQAKFTELPRNVTATEGQNVE
FT                   MSCAFQSGSASVYLEIQWWFLRGPEDLEQGTEAAGSQVELLPDRDPDNDGTKISTVKVQ
FT                   GNDISHKLQISKVRKKDEGLYECRVTDANYGELQEHKAQAYLKVNANSHARRMQAFEAS
FT                   PMWLQDTKPRKNASSVVPSSVHNSANQRMHSTSSPQAVAKIPKQSPQSACIINFSGTME
FT                   ARVHERGFQVRSSLSHLRPISEVCGVFSNRSPLSPTGRKPRPNLSSSDELDFLSSDLLT
FT                   R"
FT   CDS             join(13087755..13087833,13089602..13089768,
FT                   13091180..13091230,13092656..13092992,13112088..13112212)
FT                   /codon_start=1
FT                   /gene="BC027127"
FT                   /locus_tag="mCG_7583"
FT                   /product="cDNA sequence BC027127, isoform CRA_b"
FT                   /note="gene_id=mCG7583.3 transcript_id=mCT6416.3
FT                   protein_id=mCP10264.2 isoform=CRA_b"
FT                   /protein_id="EDL40659.1"
FT                   /translation="MMGIFLASVGFMFFSVLYVQQGLSSQAKFTELPRNVTATEGQNVE
FT                   MSCAFQSGSASVYLEIQWWFLRGPEDLEQGTEAAGSQVELLPDRDPDNDGTKISTVKVQ
FT                   GNDISHKLQISKVRKKDEGLYECRVTDANYGELQEHKAQAYLKVNANSHARRMQAFEAS
FT                   PMWLQDTKPRKNASSVVPSSVHNSANQRMHSTSSPQAVAKIPKQSPQSAKSKSPVKSTE
FT                   RTAKLTLYSKHHSAPLYSSYLHKEHQLPEA"
FT   assembly_gap    13096883..13096902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13128263..13128315
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    13133453..13133689
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    13145044..13145164
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    13158486..13160042
FT                   /estimated_length=1557
FT                   /gap_type="unknown"
FT   assembly_gap    13161092..13163174
FT                   /estimated_length=2083
FT                   /gap_type="unknown"
FT   assembly_gap    13168875..13169403
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   assembly_gap    13183026..13183045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13185001..13185271
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    13214922..13214978
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    13217184..13217203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13261405..13262558
FT                   /pseudo
FT                   /locus_tag="mCG_1041143"
FT                   /note="gene_id=mCG1041143.0"
FT   mRNA            13261405..13262558
FT                   /pseudo
FT                   /locus_tag="mCG_1041143"
FT                   /note="gene_id=mCG1041143.0 transcript_id=mCT158847.1
FT                   created on 06-JUN-2002"
FT   assembly_gap    13264853..13271066
FT                   /estimated_length=6214
FT                   /gap_type="unknown"
FT   assembly_gap    13273036..13273055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13275092..13277019
FT                   /estimated_length=1928
FT                   /gap_type="unknown"
FT   assembly_gap    13278320..13278560
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    13289645..13290164
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    13315761..13315780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13318784..13325615)
FT                   /locus_tag="mCG_7641"
FT                   /note="gene_id=mCG7641.1"
FT   mRNA            complement(join(13318784..13318961,13321890..13321992,
FT                   13323527..13323626,13325258..13325615))
FT                   /locus_tag="mCG_7641"
FT                   /product="mCG7641, transcript variant mCT6719"
FT                   /note="gene_id=mCG7641.1 transcript_id=mCT6719.2 created on
FT                   27-FEB-2003"
FT   mRNA            complement(join(13318784..13318961,13321890..13321992,
FT                   13323527..13323626,13325134..13325223))
FT                   /locus_tag="mCG_7641"
FT                   /product="mCG7641, transcript variant mCT169912"
FT                   /note="gene_id=mCG7641.1 transcript_id=mCT169912.0 created
FT                   on 27-FEB-2003"
FT   mRNA            complement(join(13318818..13318961,13321890..13321992,
FT                   13323527..13323626,13325233..13325263))
FT                   /locus_tag="mCG_7641"
FT                   /product="mCG7641, transcript variant mCT180817"
FT                   /note="gene_id=mCG7641.1 transcript_id=mCT180817.0 created
FT                   on 27-FEB-2003"
FT   CDS             complement(join(13318952..13318961,13321890..13321992,
FT                   13323527..13323626,13325258..13325347))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7641"
FT                   /product="mCG7641, isoform CRA_b"
FT                   /note="gene_id=mCG7641.1 transcript_id=mCT6719.2
FT                   protein_id=mCP6434.2 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWH0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="MGI:MGI:1202066"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWH0"
FT                   /protein_id="EDL40662.1"
FT                   /translation="MGGLWVASFRFRWARFSPELRVSTLSIRHPTNMDQVMQFVEPSRQ
FT                   FVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG"
FT   CDS             complement(join(13318952..13318961,13321890..13321992,
FT                   13323527..13323620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7641"
FT                   /product="mCG7641, isoform CRA_a"
FT                   /note="gene_id=mCG7641.1 transcript_id=mCT169912.0
FT                   protein_id=mCP92574.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SWJ8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="MGI:MGI:1202066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SWJ8"
FT                   /protein_id="EDL40660.1"
FT                   /translation="MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFA
FT                   IMGFIGFFVKLIHIPINNIIVGG"
FT   CDS             complement(join(13318952..13318961,13321890..13321992,
FT                   13323527..13323620))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7641"
FT                   /product="mCG7641, isoform CRA_a"
FT                   /note="gene_id=mCG7641.1 transcript_id=mCT180817.0
FT                   protein_id=mCP103739.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5SWJ8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="MGI:MGI:1202066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SWJ8"
FT                   /protein_id="EDL40661.1"
FT                   /translation="MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFA
FT                   IMGFIGFFVKLIHIPINNIIVGG"
FT   gene            13331471..13333195
FT                   /pseudo
FT                   /locus_tag="mCG_7642"
FT                   /note="gene_id=mCG7642.1"
FT   mRNA            13331471..13333195
FT                   /pseudo
FT                   /locus_tag="mCG_7642"
FT                   /note="gene_id=mCG7642.1 transcript_id=mCT6720.1 created on
FT                   06-JUN-2002"
FT   assembly_gap    13334450..13335028
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   gene            <13377599..>13377955
FT                   /locus_tag="mCG_62823"
FT                   /note="gene_id=mCG62823.1"
FT   mRNA            <13377599..>13377955
FT                   /locus_tag="mCG_62823"
FT                   /product="mCG62823"
FT                   /note="gene_id=mCG62823.1 transcript_id=mCT63006.1 created
FT                   on 06-JUN-2002"
FT   CDS             13377599..13377955
FT                   /codon_start=1
FT                   /locus_tag="mCG_62823"
FT                   /product="mCG62823"
FT                   /note="gene_id=mCG62823.1 transcript_id=mCT63006.1
FT                   protein_id=mCP28963.1"
FT                   /protein_id="EDL40663.1"
FT                   /translation="MGHFHWRPTTAGNASNSTLQIEVRMAVTLAELLMAAWHSFQLLSF
FT                   SLWVTSPQRAQLFHLHVHVRTQGVGYKNRESYNSAARDCVAVFIQSKIVLNKGISIFSP
FT                   DAKPKATFPAKDIK"
FT   assembly_gap    13378478..13378582
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    13403754..13403773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13441778..13441797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13445535..>13449585)
FT                   /locus_tag="mCG_140519"
FT                   /note="gene_id=mCG140519.0"
FT   mRNA            complement(join(13445535..13445786,13446540..13446573,
FT                   13447322..13447449,13449284..>13449585))
FT                   /locus_tag="mCG_140519"
FT                   /product="mCG140519, transcript variant mCT169911"
FT                   /note="gene_id=mCG140519.0 transcript_id=mCT169911.0
FT                   created on 06-JUN-2002"
FT   mRNA            complement(join(13445535..13446573,13447322..13447449,
FT                   13449284..>13449585))
FT                   /locus_tag="mCG_140519"
FT                   /product="mCG140519, transcript variant mCT169910"
FT                   /note="gene_id=mCG140519.0 transcript_id=mCT169910.0
FT                   created on 06-JUN-2002"
FT   CDS             complement(join(13446546..13446573,13447322..13447449,
FT                   13449284..>13449583))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140519"
FT                   /product="mCG140519, isoform CRA_a"
FT                   /note="gene_id=mCG140519.0 transcript_id=mCT169910.0
FT                   protein_id=mCP92558.0 isoform=CRA_a"
FT                   /protein_id="EDL40664.1"
FT                   /translation="TNMKWIEAKMQELGVSTNANYKITFMLDSAAMITVHTPRRGLIDV
FT                   KPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELIRPF
FT                   MKAHLNRDKDKELVKLTQYLKEIAKLDDFLELNHKYWERYLSKKQGQ"
FT   CDS             complement(join(13446546..13446573,13447322..13447449,
FT                   13449284..>13449583))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140519"
FT                   /product="mCG140519, isoform CRA_a"
FT                   /note="gene_id=mCG140519.0 transcript_id=mCT169911.0
FT                   protein_id=mCP92546.0 isoform=CRA_a"
FT                   /protein_id="EDL40665.1"
FT                   /translation="TNMKWIEAKMQELGVSTNANYKITFMLDSAAMITVHTPRRGLIDV
FT                   KPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELIRPF
FT                   MKAHLNRDKDKELVKLTQYLKEIAKLDDFLELNHKYWERYLSKKQGQ"
FT   assembly_gap    13447763..13447782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13448784..13448803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13450525..13450547
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            complement(13457149..13458131)
FT                   /pseudo
FT                   /locus_tag="mCG_48629"
FT                   /note="gene_id=mCG48629.2"
FT   mRNA            complement(13457149..13458131)
FT                   /pseudo
FT                   /locus_tag="mCG_48629"
FT                   /note="gene_id=mCG48629.2 transcript_id=mCT48812.2 created
FT                   on 06-JUN-2002"
FT   assembly_gap    13477013..13477032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13503604..13503623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13504639..13504658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13505799..13505818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13509234..13509253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13510358..13510377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13533355..13533374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13533842..13533911
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    13540305..13542605
FT                   /estimated_length=2301
FT                   /gap_type="unknown"
FT   gene            13562861..13724273
FT                   /gene="Egfr"
FT                   /locus_tag="mCG_140518"
FT                   /note="gene_id=mCG140518.0"
FT   mRNA            join(13562861..13563221,13669635..13669786,
FT                   13670807..13670990,13673685..13673819,13677970..13678038,
FT                   13678847..13678965,13679956..13680097,13681713..13681829,
FT                   13682320..13682446,13682539..13682612,13683583..13683673,
FT                   13685697..13685896,13688864..13688996,13691777..13691867,
FT                   13693769..13693926,13697454..13698286)
FT                   /gene="Egfr"
FT                   /locus_tag="mCG_140518"
FT                   /product="epidermal growth factor receptor, transcript
FT                   variant mCT169894"
FT                   /note="gene_id=mCG140518.0 transcript_id=mCT169894.0
FT                   created on 06-JUN-2002"
FT   mRNA            join(13562919..13563221,13669635..13669786,
FT                   13670807..13670990,13673685..13673819,13677970..13678038,
FT                   13678847..13678965,13679956..13680097,13681713..13681829,
FT                   13682320..13682446,13682539..13682612,13683583..13683673,
FT                   13685697..13685896,13688864..13688996,13691777..13691867,
FT                   13693769..13693926,13697454..13697498,13700226..13700367,
FT                   13701491..13701613,13703321..13703419,13707207..13707392,
FT                   13714626..13714781,13715669..13715744,13717057..13717203,
FT                   13719195..13719292,13720103..13720270,13720579..13720626,
FT                   13721165..13721267,13721865..13724273)
FT                   /gene="Egfr"
FT                   /locus_tag="mCG_140518"
FT                   /product="epidermal growth factor receptor, transcript
FT                   variant mCT169895"
FT                   /note="gene_id=mCG140518.0 transcript_id=mCT169895.0
FT                   created on 06-JUN-2002"
FT   CDS             join(13563134..13563221,13669635..13669786,
FT                   13670807..13670990,13673685..13673819,13677970..13678038,
FT                   13678847..13678965,13679956..13680097,13681713..13681829,
FT                   13682320..13682446,13682539..13682612,13683583..13683673,
FT                   13685697..13685896,13688864..13688996,13691777..13691867,
FT                   13693769..13693926,13697454..13697498,13700226..13700367,
FT                   13701491..13701613,13703321..13703419,13707207..13707392,
FT                   13714626..13714781,13715669..13715744,13717057..13717203,
FT                   13719195..13719292,13720103..13720270,13720579..13720626,
FT                   13721165..13721267,13721865..13722226)
FT                   /codon_start=1
FT                   /gene="Egfr"
FT                   /locus_tag="mCG_140518"
FT                   /product="epidermal growth factor receptor, isoform CRA_b"
FT                   /note="gene_id=mCG140518.0 transcript_id=mCT169895.0
FT                   protein_id=mCP92569.0 isoform=CRA_b"
FT                   /protein_id="EDL40667.1"
FT                   /translation="MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFE
FT                   DHFLSLQRMYNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENL
FT                   QIIRGNALYENTYALAILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQ
FT                   WRDIVQNVFMSNMSMDLQSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHR
FT                   CRGRSPSDCCHNQCAAGCTGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNP
FT                   EGKYSFGATCVKKCPRNYVVTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGI
FT                   GIGEFKDTLSINATNIKHFKYCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVK
FT                   EITGFLLIQAWPDNWTDLHAFENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISD
FT                   GDVIISGNRNLCYANTINWKKLFGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWG
FT                   PEPRDCVSCQNVSRGRECVEKCNILEGEPREFVENSECIQCHPECLPQAMNITCTGRGP
FT                   DNCIQCAHYIDGPHCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCTYGCAGPGLQG
FT                   CEVWPSGPKIPSIATGIVGGLLFIVVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPL
FT                   TPSGEAPNQAHLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREAT
FT                   SPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPYGCLLDYVREHKDNIG
FT                   SQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEY
FT                   HAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASDISSILE
FT                   KGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELILEFSKMARDPQRYLVIQGDERM
FT                   HLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSATSNNST
FT                   VACINRNGSCRVKEDAFLQRYSSDPTGAVTEDNIDDAFLPVPEYVNQSVPKRPAGSVQN
FT                   PVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLNTAQPTCLSSGFNSPALWIQKGSHQMS
FT                   LDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRVAPPSSEFIGA"
FT   CDS             join(13563134..13563221,13669635..13669786,
FT                   13670807..13670990,13673685..13673819,13677970..13678038,
FT                   13678847..13678965,13679956..13680097,13681713..13681829,
FT                   13682320..13682446,13682539..13682612,13683583..13683673,
FT                   13685697..13685896,13688864..13688996,13691777..13691867,
FT                   13693769..13693926,13697454..13697541)
FT                   /codon_start=1
FT                   /gene="Egfr"
FT                   /locus_tag="mCG_140518"
FT                   /product="epidermal growth factor receptor, isoform CRA_a"
FT                   /note="gene_id=mCG140518.0 transcript_id=mCT169894.0
FT                   protein_id=mCP92556.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9WVF5"
FT                   /db_xref="InterPro:IPR000494"
FT                   /db_xref="InterPro:IPR006211"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR032778"
FT                   /db_xref="MGI:MGI:95294"
FT                   /db_xref="UniProtKB/TrEMBL:Q9WVF5"
FT                   /protein_id="EDL40666.1"
FT                   /translation="MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFE
FT                   DHFLSLQRMYNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENL
FT                   QIIRGNALYENTYALAILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQ
FT                   WRDIVQNVFMSNMSMDLQSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHR
FT                   CRGRSPSDCCHNQCAAGCTGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNP
FT                   EGKYSFGATCVKKCPRNYVVTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGI
FT                   GIGEFKDTLSINATNIKHFKYCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVK
FT                   EITGFLLIQAWPDNWTDLHAFENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISD
FT                   GDVIISGNRNLCYANTINWKKLFGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWG
FT                   PEPRDCVSCQNVSRGRECVEKCNILEGEPREFVENSECIQCHPECLPQAMNITCTGRGP
FT                   DNCIQCAHYIDGPHCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCTYGCAGPGLQG
FT                   CEVWPSGYVQWQWILKTFWI"
FT   gene            complement(13626077..13641358)
FT                   /locus_tag="mCG_148405"
FT                   /note="gene_id=mCG148405.0"
FT   mRNA            complement(join(13626077..13629880,13641098..13641358))
FT                   /locus_tag="mCG_148405"
FT                   /product="mCG148405"
FT                   /note="gene_id=mCG148405.0 transcript_id=mCT188668.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(13628933..13629196)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148405"
FT                   /product="mCG148405"
FT                   /note="gene_id=mCG148405.0 transcript_id=mCT188668.0
FT                   protein_id=mCP108584.0"
FT                   /protein_id="EDL40668.1"
FT                   /translation="MLSLSLSLSLSFSLSLCVCMCSYVCICVPMFTCDPLRWVLVLPLY
FT                   KLGNGGSLTQLSCARRYACNSFLLKDEPNCFRVRNPLQCGHM"
FT   assembly_gap    13642068..13642197
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    13719895..13719914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13745493..13761423)
FT                   /locus_tag="mCG_1041253"
FT                   /note="gene_id=mCG1041253.1"
FT   mRNA            complement(join(13745493..13746900,13761031..13761079,
FT                   13761169..13761262))
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, transcript variant mCT180800"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT180800.0
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(13745495..13746177,13746791..13746900,
FT                   13761031..13761079,13761169..13761423))
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, transcript variant mCT169893"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT169893.0
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(13745495..13746177,13746791..13746900,
FT                   13747709..13747820,13761031..13761079,13761169..13761423))
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, transcript variant mCT158957"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT158957.0
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(13745922..13746262,13746791..13746900,
FT                   13761031..13761079,13761152..13761247))
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, transcript variant mCT180802"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT180802.0
FT                   created on 27-FEB-2003"
FT   mRNA            complement(join(13746038..13746262,13746791..13746900,
FT                   13747709..13747820,13748913..13748953,13761031..13761079,
FT                   13761169..13761231))
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, transcript variant mCT180801"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT180801.0
FT                   created on 27-FEB-2003"
FT   CDS             complement(join(13746107..13746177,13746791..13746900,
FT                   13761031..13761035))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, isoform CRA_b"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT169893.0
FT                   protein_id=mCP92568.0 isoform=CRA_b"
FT                   /protein_id="EDL40670.1"
FT                   /translation="MRVVGMYHGGRVMAAGSWNRTLSKNTFNYKQKSRRTESDNWNLES
FT                   QGRLWRGCEQMAAEDS"
FT   CDS             complement(join(13746107..13746177,13746791..13746900,
FT                   13747709..13747806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, isoform CRA_a"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT158957.0
FT                   protein_id=mCP59266.1 isoform=CRA_a"
FT                   /protein_id="EDL40669.1"
FT                   /translation="MILRGAFSAMDMRPCLEEMIYCKFTMMDNLSFRVVGMYHGGRVMA
FT                   AGSWNRTLSKNTFNYKQKSRRTESDNWNLESQGRLWRGCEQMAAEDS"
FT   CDS             complement(join(13746234..13746262,13746791..13746900,
FT                   13761031..13761035))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, isoform CRA_e"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT180802.0
FT                   protein_id=mCP103723.0 isoform=CRA_e"
FT                   /protein_id="EDL40673.1"
FT                   /translation="MRVVGMYHGGRVMAAGSWNRTLSKNTFNYKQKSRRTESGSLKSAL
FT                   EN"
FT   CDS             complement(join(13746234..13746262,13746791..13746900,
FT                   13747709..13747820,13748913..13748931))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, isoform CRA_d"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT180801.0
FT                   protein_id=mCP103722.0 isoform=CRA_d"
FT                   /protein_id="EDL40672.1"
FT                   /translation="MVPPIVGQRDVMILRGAFSAMDMRPCLEEMIYCKFTMMDNLSFRV
FT                   VGMYHGGRVMAAGSWNRTLSKNTFNYKQKSRRTESGSLKSALEN"
FT   CDS             complement(join(13746552..13746900,13761031..13761035))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1041253"
FT                   /product="mCG1041253, isoform CRA_c"
FT                   /note="gene_id=mCG1041253.1 transcript_id=mCT180800.0
FT                   protein_id=mCP103724.0 isoform=CRA_c"
FT                   /protein_id="EDL40671.1"
FT                   /translation="MRVVGMYHGGRVMAAGSWNRTLSKNTFNYKQKSRRTESGESMMSE
FT                   DPLGIMSFLSKAIPPSQTVFKCPAKHHSGGGIRISRSSFLFLEKVQQYIPVSILEKCRD
FT                   SQVLGIVGTLFCP"
FT   assembly_gap    13758847..13758946
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            13763432..13764588
FT                   /gene="A630050E13Rik"
FT                   /locus_tag="mCG_7645"
FT                   /note="gene_id=mCG7645.2"
FT   mRNA            join(13763432..13763822,13764297..13764588)
FT                   /gene="A630050E13Rik"
FT                   /locus_tag="mCG_7645"
FT                   /product="RIKEN cDNA A630050E13"
FT                   /note="gene_id=mCG7645.2 transcript_id=mCT6711.2 created on
FT                   06-JUN-2002"
FT   CDS             join(13763517..13763822,13764297..13764476)
FT                   /codon_start=1
FT                   /gene="A630050E13Rik"
FT                   /locus_tag="mCG_7645"
FT                   /product="RIKEN cDNA A630050E13"
FT                   /note="gene_id=mCG7645.2 transcript_id=mCT6711.2
FT                   protein_id=mCP6432.2"
FT                   /protein_id="EDL40674.1"
FT                   /translation="MKKTSKKNNNFKIPGTELNSADAERGKEESQRNFVELLPLEVTYK
FT                   IFSQLDIQSLCRASRTCTGWNCAIRNNDSLWKPHCLTIRAVCQREIDDDIKSGYTWRVI
FT                   LLRNYQKSKVKYEWLSGRYSNIRSPVNLPEKAMCPMDADTWGEILDAELEREVEKLQ"
FT   gene            complement(13781003..13818379)
FT                   /gene="Plek"
FT                   /locus_tag="mCG_7638"
FT                   /note="gene_id=mCG7638.1"
FT   mRNA            complement(join(13781003..13783710,13791353..13791485,
FT                   13792748..13792817,13795083..13795166,13797010..13797114,
FT                   13799605..13799789,13802442..13802533,13804203..13804384,
FT                   13804754..13804909,13818234..13818379))
FT                   /gene="Plek"
FT                   /locus_tag="mCG_7638"
FT                   /product="pleckstrin"
FT                   /note="gene_id=mCG7638.1 transcript_id=mCT6721.0 created on
FT                   06-JUN-2002"
FT   CDS             complement(join(13783707..13783710,13791353..13791485,
FT                   13792748..13792817,13795083..13795166,13797010..13797114,
FT                   13799605..13799789,13802442..13802533,13804203..13804384,
FT                   13804754..13804909,13818234..13818275))
FT                   /codon_start=1
FT                   /gene="Plek"
FT                   /locus_tag="mCG_7638"
FT                   /product="pleckstrin"
FT                   /note="gene_id=mCG7638.1 transcript_id=mCT6721.0
FT                   protein_id=mCP6442.1"
FT                   /db_xref="GOA:Q5F271"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1860485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F271"
FT                   /protein_id="EDL40675.1"
FT                   /translation="MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPK
FT                   GMIPLKGSTLTSPCQDFGKRMFVLKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIE
FT                   GGQKFARKSTRRSIRLPETIDLGALYLSMKDPEKGIKELNLEKDKKVFNHCLTGSGVID
FT                   WLVSNKLVRNRQEGLMISASLLSEGYLQPAGDLSKNAADGIAENPFLDSPDAFYYFPDS
FT                   GFFCEENSSDDDVILREEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPA
FT                   GGEDPLGAVHLRGCVVTSVESSHDVKKSDEENLFEIITADEVHYYLQAATSKERTEWIK
FT                   AIQVASRTGK"
FT   assembly_gap    13805918..13806267
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    13808921..13808940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13825544..13825563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13828974..13829823
FT                   /pseudo
FT                   /locus_tag="mCG_113387"
FT                   /note="gene_id=mCG113387.1"
FT   mRNA            13828974..13829823
FT                   /pseudo
FT                   /locus_tag="mCG_113387"
FT                   /note="gene_id=mCG113387.1 transcript_id=mCT114470.1
FT                   created on 03-MAR-2003"
FT   assembly_gap    13840027..13840486
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    13841652..13841671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13852076..13852324
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   gene            13861126..13886388
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /note="gene_id=mCG7643.1"
FT   mRNA            join(13861126..13861368,13861656..13861892,
FT                   13864176..13864326,13885417..13886388)
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, transcript variant
FT                   mCT6712"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT6712.1 created on
FT                   06-JUN-2002"
FT   mRNA            join(13861127..13861368,13861656..13861892,
FT                   13864176..>13864551)
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, transcript variant
FT                   mCT169916"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT169916.0 created
FT                   on 06-JUN-2002"
FT   mRNA            join(13861403..13861892,13864176..13864326,
FT                   13885417..13886368)
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, transcript variant
FT                   mCT169915"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT169915.0 created
FT                   on 06-JUN-2002"
FT   mRNA            join(13861403..13861860,13864274..13864326,
FT                   13885417..13886368)
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, transcript variant
FT                   mCT169913"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT169913.0 created
FT                   on 06-JUN-2002"
FT   CDS             join(13861714..13861892,13864176..13864326,
FT                   13885417..13885581)
FT                   /codon_start=1
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, isoform CRA_c"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT6712.1
FT                   protein_id=mCP6437.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q5M8N0"
FT                   /db_xref="InterPro:IPR029204"
FT                   /db_xref="MGI:MGI:1917505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5M8N0"
FT                   /protein_id="EDL40679.1"
FT                   /translation="MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSS
FT                   YKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQP
FT                   IQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESF
FT                   L"
FT   CDS             join(13861714..13861892,13864176..13864326,
FT                   13885417..13885581)
FT                   /codon_start=1
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, isoform CRA_c"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT169915.0
FT                   protein_id=mCP92571.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q5M8N0"
FT                   /db_xref="InterPro:IPR029204"
FT                   /db_xref="MGI:MGI:1917505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5M8N0"
FT                   /protein_id="EDL40680.1"
FT                   /translation="MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSS
FT                   YKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQP
FT                   IQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESF
FT                   L"
FT   CDS             join(13861714..13861892,13864176..13864551)
FT                   /codon_start=1
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, isoform CRA_b"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT169916.0
FT                   protein_id=mCP92566.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR029204"
FT                   /db_xref="MGI:MGI:1917505"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CW19"
FT                   /protein_id="EDL40678.1"
FT                   /translation="MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSS
FT                   YKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQP
FT                   IQITMPVSPSCGCGDMASEQRNCRGRNHYFFTNKERCAGASFYGNRVQFPSWTCEKRER
FT                   VIFTDAFFFHERLTFKKIKIK"
FT   mRNA            join(13861797..13861887,13864176..13864326,
FT                   13885417..13886368)
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, transcript variant
FT                   mCT169914"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT169914.0 created
FT                   on 06-JUN-2002"
FT   CDS             join(13864321..13864326,13885417..13885581)
FT                   /codon_start=1
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, isoform CRA_a"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT169913.0
FT                   protein_id=mCP92572.0 isoform=CRA_a"
FT                   /protein_id="EDL40676.1"
FT                   /translation="MPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETR
FT                   SLMWVNKESFL"
FT   CDS             join(13864321..13864326,13885417..13885581)
FT                   /codon_start=1
FT                   /gene="1500041B16Rik"
FT                   /locus_tag="mCG_7643"
FT                   /product="RIKEN cDNA 1500041B16, isoform CRA_a"
FT                   /note="gene_id=mCG7643.1 transcript_id=mCT169914.0
FT                   protein_id=mCP92547.0 isoform=CRA_a"
FT                   /protein_id="EDL40677.1"
FT                   /translation="MPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETR
FT                   SLMWVNKESFL"
FT   assembly_gap    13867828..13867847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13873277..13873296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13876351..13876370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13901936..>13902318)
FT                   /locus_tag="mCG_7647"
FT                   /note="gene_id=mCG7647.2"
FT   mRNA            complement(13901936..>13902318)
FT                   /locus_tag="mCG_7647"
FT                   /product="mCG7647"
FT                   /note="gene_id=mCG7647.2 transcript_id=mCT6714.2 created on
FT                   06-JUN-2002"
FT   CDS             complement(13902070..>13902318)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7647"
FT                   /product="mCG7647"
FT                   /note="gene_id=mCG7647.2 transcript_id=mCT6714.2
FT                   protein_id=mCP6441.1"
FT                   /protein_id="EDL40681.1"
FT                   /translation="FLFSIPLPSCALFLIQLLAMSSHKTFRIKRFLAKKQKQKRPIPQW
FT                   IRMKTGNKIRTTLRENTGGERSWVCKDSHNGKTEDLY"
FT   assembly_gap    13905911..13910091
FT                   /estimated_length=4181
FT                   /gap_type="unknown"
FT   assembly_gap    13913177..13913196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13930359..13930378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13960436..13961180
FT                   /estimated_length=745
FT                   /gap_type="unknown"
FT   assembly_gap    13962240..13962259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13965551..13965570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13968780..14044579
FT                   /locus_tag="mCG_1050441"
FT                   /note="gene_id=mCG1050441.0"
FT   mRNA            join(13968780..13969020,13992212..13992251,
FT                   14003002..14003178,14004262..14004321,14004714..14004898,
FT                   14022333..14022363,14022851..14023053,14029790..14029890,
FT                   14032972..14033102,14035324..14035425,14037936..14038051,
FT                   14038916..14039050,14040544..14040641,14043490..14044579)
FT                   /locus_tag="mCG_1050441"
FT                   /product="mCG1050441"
FT                   /note="gene_id=mCG1050441.0 transcript_id=mCT169909.1
FT                   created on 18-JUN-2004"
FT   gene            13968780..14010426
FT                   /locus_tag="mCG_7646"
FT                   /note="gene_id=mCG7646.3"
FT   mRNA            join(13968780..13969020,13992212..13992251,
FT                   14003002..14003178,14004262..14004321,14004714..14004898,
FT                   14008303..14010426)
FT                   /locus_tag="mCG_7646"
FT                   /product="mCG7646, transcript variant mCT169917"
FT                   /note="gene_id=mCG7646.3 transcript_id=mCT169917.1 created
FT                   on 18-JUN-2004"
FT   mRNA            join(13968780..13969020,13992212..13992251,
FT                   14003002..14003178,14004262..14004321,14004714..14005134)
FT                   /locus_tag="mCG_7646"
FT                   /product="mCG7646, transcript variant mCT6713"
FT                   /note="gene_id=mCG7646.3 transcript_id=mCT6713.2 created on
FT                   18-JUN-2004"
FT   CDS             join(13969018..13969020,13992212..13992251,
FT                   14003002..14003178,14004262..14004321,14004714..14004898,
FT                   14022333..14022363,14022851..14023053,14029790..14029890,
FT                   14032972..14033102,14035324..14035425,14037936..14038051,
FT                   14038916..14039050,14040544..14040641,14043490..14043697)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050441"
FT                   /product="mCG1050441"
FT                   /note="gene_id=mCG1050441.0 transcript_id=mCT169909.1
FT                   protein_id=mCP92549.1"
FT                   /protein_id="EDL40682.1"
FT                   /translation="MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMS
FT                   LPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKD
FT                   GYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAPVVSSPGG
FT                   PLSFGCIYTMSTFEKPQIIVHIQKGLNYTVFDSKWVPCSAKFVTMGNFARGTGVIQVYE
FT                   IQRGDLKLLREIEKAKPIKCGTFGAASLQQRFLATGDFGGNLHIWNLEAPEMPVYSVKG
FT                   HKEIINTIDGVGGLGIGEGAPEIVTGSRDGTVKVWDPRQKEDPVANMEPAQGENKRDCW
FT                   TVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMSLRWETNIKNGVCSLEFDRKDISMNKL
FT                   VATSLEGKFHVFDMRTQHPTKGFASVTEKAHKSTVWQVRHLPQNREIFLTTGGAGSLHL
FT                   WKYEYPTQRSKKDSEGLEMGVAGSVSLLQNVTVSTQPISSLDWSPDKRGLCVCSSFDQM
FT                   VRVLIVTKLQTI"
FT   CDS             join(13969018..13969020,13992212..13992251,
FT                   14003002..14003178,14004262..14004321,14004714..14004898,
FT                   14008303..14008350)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7646"
FT                   /product="mCG7646, isoform CRA_a"
FT                   /note="gene_id=mCG7646.3 transcript_id=mCT169917.1
FT                   protein_id=mCP92553.1 isoform=CRA_a"
FT                   /protein_id="EDL40683.1"
FT                   /translation="MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMS
FT                   LPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKD
FT                   GYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIH
FT                   KKMVVDV"
FT   CDS             join(13969018..13969020,13992212..13992251,
FT                   14003002..14003178,14004262..14004321,14004714..14004910)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7646"
FT                   /product="mCG7646, isoform CRA_b"
FT                   /note="gene_id=mCG7646.3 transcript_id=mCT6713.2
FT                   protein_id=mCP6440.2 isoform=CRA_b"
FT                   /protein_id="EDL40684.1"
FT                   /translation="MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMS
FT                   LPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKD
FT                   GYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVSE"
FT   assembly_gap    13969223..13969382
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    13978231..13978250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13983461..13983480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13988290..13988309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13994545..13994564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14013246..14022476)
FT                   /gene="1810003N24Rik"
FT                   /locus_tag="mCG_5687"
FT                   /note="gene_id=mCG5687.2"
FT   mRNA            complement(join(14013246..14014045,14014545..14014615,
FT                   14019924..14020041,14020212..14020272,14020446..14020529,
FT                   14021900..14022049,14022220..14022476))
FT                   /gene="1810003N24Rik"
FT                   /locus_tag="mCG_5687"
FT                   /product="RIKEN cDNA 1810003N24, transcript variant
FT                   mCT5243"
FT                   /note="gene_id=mCG5687.2 transcript_id=mCT5243.2 created on
FT                   06-JUN-2002"
FT   CDS             complement(join(14013978..14014045,14014545..14014615,
FT                   14019924..14020041,14020212..14020272,14020446..14020529,
FT                   14021900..14022049,14022220..14022414))
FT                   /codon_start=1
FT                   /gene="1810003N24Rik"
FT                   /locus_tag="mCG_5687"
FT                   /product="RIKEN cDNA 1810003N24, isoform CRA_b"
FT                   /note="gene_id=mCG5687.2 transcript_id=mCT5243.2
FT                   protein_id=mCP6436.2 isoform=CRA_b"
FT                   /protein_id="EDL40686.1"
FT                   /translation="METQSTGTEDGFTPVTHRGGRRAKKRQAEQSSAAGQDGEAGRMDT
FT                   EEARPAKRPVFPPLSGDQLLTGKEETRKIPVPGNRYTPLKENWMKIFTPIVEHLGLQIR
FT                   FNLKSRNVEIRTCKDTKDVSALTKAADFVKAFVLGFQVEDALALIRLDDLFLESFEITD
FT                   VKPLKGDHLSRAIGRIAGKGGKTKFTIENVTRTRIVLADVHVHILGSFQNIKMARTAIC
FT                   NLILGNPPSKVYGNIRAVASRSADRF"
FT   mRNA            complement(join(14014573..14014615,14019924..14020041,
FT                   14020212..14020529,14021900..14022049,14022220..14022476))
FT                   /gene="1810003N24Rik"
FT                   /locus_tag="mCG_5687"
FT                   /product="RIKEN cDNA 1810003N24, transcript variant
FT                   mCT169908"
FT                   /note="gene_id=mCG5687.2 transcript_id=mCT169908.0 created
FT                   on 06-JUN-2002"
FT   assembly_gap    14018068..14019828
FT                   /estimated_length=1761
FT                   /gap_type="unknown"
FT   CDS             complement(join(14020248..14020529,14021900..14022049,
FT                   14022220..14022414))
FT                   /codon_start=1
FT                   /gene="1810003N24Rik"
FT                   /locus_tag="mCG_5687"
FT                   /product="RIKEN cDNA 1810003N24, isoform CRA_a"
FT                   /note="gene_id=mCG5687.2 transcript_id=mCT169908.0
FT                   protein_id=mCP92573.0 isoform=CRA_a"
FT                   /protein_id="EDL40685.1"
FT                   /translation="METQSTGTEDGFTPVTHRGGRRAKKRQAEQSSAAGQDGEAGRMDT
FT                   EEARPAKRPVFPPLSGDQLLTGKEETRKIPVPGNRYTPLKENWMKIFTPIVEHLGLQIR
FT                   FNLKSRNVEIRTCKDTKDVSALTKAADFVKAFVLGFQVEVSDLMRLPDTQCGHFNGWVI
FT                   FQTFRLFFVASEKFSFEMLSLFLPGVDLKRPSFLLSCRMHLPLSD"
FT   assembly_gap    14021157..14021180
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   gene            14022799..14044579
FT                   /locus_tag="mCG_5688"
FT                   /note="gene_id=mCG5688.3"
FT   mRNA            join(14022799..14023053,14029790..14029890,
FT                   14032972..14033102,14035324..14035425,14037936..14038051,
FT                   14038916..14039050,14040544..14040641,14043490..14044579)
FT                   /locus_tag="mCG_5688"
FT                   /product="mCG5688"
FT                   /note="gene_id=mCG5688.3 transcript_id=mCT5244.3 created on
FT                   18-JUN-2004"
FT   CDS             join(14022871..14023053,14029790..14029890,
FT                   14032972..14033102,14035324..14035425,14037936..14038051,
FT                   14038916..14039050,14040544..14040641,14043490..14043697)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5688"
FT                   /product="mCG5688"
FT                   /note="gene_id=mCG5688.3 transcript_id=mCT5244.3
FT                   protein_id=mCP6438.1"
FT                   /protein_id="EDL40687.1"
FT                   /translation="MSTFEKPQIIVHIQKGLNYTVFDSKWVPCSAKFVTMGNFARGTGV
FT                   IQVYEIQRGDLKLLREIEKAKPIKCGTFGAASLQQRFLATGDFGGNLHIWNLEAPEMPV
FT                   YSVKGHKEIINTIDGVGGLGIGEGAPEIVTGSRDGTVKVWDPRQKEDPVANMEPAQGEN
FT                   KRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMSLRWETNIKNGVCSLEFDRKDI
FT                   SMNKLVATSLEGKFHVFDMRTQHPTKGFASVTEKAHKSTVWQVRHLPQNREIFLTTGGA
FT                   GSLHLWKYEYPTQRSKKDSEGLEMGVAGSVSLLQNVTVSTQPISSLDWSPDKRGLCVCS
FT                   SFDQMVRVLIVTKLQTI"
FT   gene            14068350..14078974
FT                   /gene="C1d"
FT                   /locus_tag="mCG_5689"
FT                   /note="gene_id=mCG5689.2"
FT   mRNA            join(14068350..14068445,14073435..14073581,
FT                   14074396..14074462,14074738..14074793,14077318..14078974)
FT                   /gene="C1d"
FT                   /locus_tag="mCG_5689"
FT                   /product="nuclear DNA binding protein"
FT                   /note="gene_id=mCG5689.2 transcript_id=mCT5246.2 created on
FT                   06-JUN-2002"
FT   CDS             join(14073444..14073581,14074396..14074462,
FT                   14074738..14074793,14077318..14077482)
FT                   /codon_start=1
FT                   /gene="C1d"
FT                   /locus_tag="mCG_5689"
FT                   /product="nuclear DNA binding protein"
FT                   /note="gene_id=mCG5689.2 transcript_id=mCT5246.2
FT                   protein_id=mCP6430.1"
FT                   /protein_id="EDL40688.1"
FT                   /translation="MAGEEMNEDYPVEIHESLTALESSLGAVDDMLKTMMAVSRNELLQ
FT                   KLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKK
FT                   KAAKLDRGAASRFVKNALWEPKAKSTPKVANKGKSKH"
FT   assembly_gap    14081200..14081219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14108537..14109730)
FT                   /pseudo
FT                   /locus_tag="mCG_48733"
FT                   /note="gene_id=mCG48733.2"
FT   mRNA            complement(14108537..14109730)
FT                   /pseudo
FT                   /locus_tag="mCG_48733"
FT                   /note="gene_id=mCG48733.2 transcript_id=mCT48916.2 created
FT                   on 06-JUN-2002"
FT   assembly_gap    14162411..14162430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14277588..14277607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14311846..14311865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14322818..14326292
FT                   /estimated_length=3475
FT                   /gap_type="unknown"
FT   assembly_gap    14359554..14359623
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    14360911..14360930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14394107..14394401
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    14414791..14414810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14427420..14428695
FT                   /estimated_length=1276
FT                   /gap_type="unknown"
FT   assembly_gap    14430470..14430489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14431688..14431795
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    14439363..14439787
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   assembly_gap    14442908..14442993
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    14444458..14444934
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   gene            complement(14448312..14448946)
FT                   /pseudo
FT                   /locus_tag="mCG_62491"
FT                   /note="gene_id=mCG62491.1"
FT   mRNA            complement(14448312..14448946)
FT                   /pseudo
FT                   /locus_tag="mCG_62491"
FT                   /note="gene_id=mCG62491.1 transcript_id=mCT62674.2 created
FT                   on 06-JUN-2002"
FT   assembly_gap    14464628..14464775
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    14471933..14471952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14474732..14474751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14475974..14475993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14485527..14485546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14493891..14493910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14502250..14502269
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14503686..14503705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14528048..14528242
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    14537374..14537540
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    14566133..14570306
FT                   /estimated_length=4174
FT                   /gap_type="unknown"
XX
CO   join(AAHY01090207.1:1..15244,gap(967),complement(AAHY01090208.1:1..11403),
CO   gap(3073),AAHY01090209.1:1..946,gap(455),AAHY01090210.1:1..16502,gap(20),
CO   AAHY01090211.1:1..16209,gap(1873),AAHY01090212.1:1..1231,gap(693),
CO   AAHY01090213.1:1..3142,gap(20),complement(AAHY01090214.1:1..1587),
CO   gap(19476),AAHY01090215.1:1..2222,gap(20),AAHY01090216.1:1..2100,gap(20),
CO   AAHY01090217.1:1..2375,gap(871),AAHY01090218.1:1..3859,gap(2479),
CO   complement(AAHY01090219.1:1..2431),gap(1777),AAHY01090220.1:1..2016,
CO   gap(2228),AAHY01090221.1:1..2378,gap(9397),AAHY01090222.1:1..3125,gap(441),
CO   AAHY01090223.1:1..5276,gap(281),complement(AAHY01090224.1:1..8755),
CO   gap(193),AAHY01090225.1:1..33641,gap(207),
CO   complement(AAHY01090226.1:1..6495),gap(2038),
CO   complement(AAHY01090227.1:1..9832),gap(58),
CO   complement(AAHY01090228.1:1..5078),gap(746),
CO   complement(AAHY01090229.1:1..13792),gap(556),
CO   complement(AAHY01090230.1:1..109814),gap(20),AAHY01090231.1:1..29773,
CO   gap(20),complement(AAHY01090232.1:1..18773),gap(20),
CO   complement(AAHY01090233.1:1..22400),gap(265),
CO   complement(AAHY01090234.1:1..6900),gap(188),
CO   complement(AAHY01090235.1:1..4300),gap(20),
CO   complement(AAHY01090236.1:1..8852),gap(143),
CO   complement(AAHY01090237.1:1..14325),gap(20),AAHY01090238.1:1..43082,
CO   gap(431),AAHY01090239.1:1..1375,gap(533),AAHY01090240.1:1..8747,gap(680),
CO   complement(AAHY01090241.1:1..7626),gap(233),
CO   complement(AAHY01090242.1:1..6977),gap(20),AAHY01090243.1:1..18247,gap(20),
CO   AAHY01090244.1:1..4085,gap(97),AAHY01090245.1:1..11595,gap(20),
CO   AAHY01090246.1:1..39553,gap(20),complement(AAHY01090247.1:1..3842),
CO   gap(108),complement(AAHY01090248.1:1..8587),gap(256),
CO   AAHY01090249.1:1..42050,gap(168),AAHY01090250.1:1..4231,gap(386),
CO   complement(AAHY01090251.1:1..23983),gap(20),
CO   complement(AAHY01090252.1:1..8405),gap(20),AAHY01090253.1:1..21616,
CO   gap(104),complement(AAHY01090254.1:1..12151),gap(376),
CO   complement(AAHY01090255.1:1..41886),gap(105),
CO   complement(AAHY01090256.1:1..8254),gap(20),
CO   complement(AAHY01090257.1:1..1221),gap(20),AAHY01090258.1:1..1679,gap(242),
CO   AAHY01090259.1:1..12091,gap(264),AAHY01090260.1:1..13141,gap(20),
CO   AAHY01090261.1:1..40174,gap(106),AAHY01090262.1:1..3512,gap(1223),
CO   AAHY01090263.1:1..24010,gap(515),AAHY01090264.1:1..11292,gap(440),
CO   AAHY01090265.1:1..10720,gap(391),AAHY01090266.1:1..2844,gap(20),
CO   AAHY01090267.1:1..3388,gap(144),AAHY01090268.1:1..6613,gap(199),
CO   AAHY01090269.1:1..25023,gap(110),AAHY01090270.1:1..27071,gap(233),
CO   AAHY01090271.1:1..564,gap(233),AAHY01090272.1:1..4375,gap(20),
CO   complement(AAHY01090273.1:1..11397),gap(240),
CO   complement(AAHY01090274.1:1..1657),gap(20),
CO   complement(AAHY01090275.1:1..15150),gap(153),
CO   complement(AAHY01090276.1:1..15749),gap(20),
CO   complement(AAHY01090277.1:1..8572),gap(25),
CO   complement(AAHY01090278.1:1..38774),gap(20),AAHY01090279.1:1..58290,
CO   gap(20),AAHY01090280.1:1..63599,gap(20),AAHY01090281.1:1..1191,gap(20),
CO   complement(AAHY01090282.1:1..1120),gap(20),AAHY01090283.1:1..6765,gap(55),
CO   complement(AAHY01090284.1:1..15435),gap(1369),AAHY01090285.1:1..2525,
CO   gap(220),AAHY01090286.1:1..69163,gap(712),AAHY01090287.1:1..2023,gap(20),
CO   AAHY01090288.1:1..1913,gap(282),AAHY01090289.1:1..23086,gap(20),
CO   AAHY01090290.1:1..6939,gap(801),complement(AAHY01090291.1:1..15055),
CO   gap(20),complement(AAHY01090292.1:1..40277),gap(20),
CO   complement(AAHY01090293.1:1..29374),gap(68),AAHY01090294.1:1..7832,gap(20),
CO   AAHY01090295.1:1..3901,gap(25),AAHY01090296.1:1..13975,gap(126),
CO   complement(AAHY01090297.1:1..2501),gap(65),
CO   complement(AAHY01090298.1:1..24635),gap(675),
CO   complement(AAHY01090299.1:1..9692),gap(20),AAHY01090300.1:1..1285,gap(20),
CO   AAHY01090301.1:1..17626,gap(20),AAHY01090302.1:1..22998,gap(20),
CO   AAHY01090303.1:1..48507,gap(37),AAHY01090304.1:1..3738,gap(683),
CO   AAHY01090305.1:1..8038,gap(20),AAHY01090306.1:1..29590,gap(348),
CO   AAHY01090307.1:1..58072,gap(20),complement(AAHY01090308.1:1..2067),gap(20),
CO   AAHY01090309.1:1..550,gap(20),complement(AAHY01090310.1:1..15677),gap(458),
CO   AAHY01090311.1:1..25679,gap(20),complement(AAHY01090312.1:1..7700),
CO   gap(106),AAHY01090313.1:1..111546,gap(5847),
CO   complement(AAHY01090314.1:1..1368),gap(20),AAHY01090315.1:1..37526,gap(20),
CO   AAHY01090316.1:1..40874,gap(216),AAHY01090317.1:1..3552,gap(227),
CO   AAHY01090318.1:1..2265,gap(251),AAHY01090319.1:1..21839,gap(70),
CO   AAHY01090320.1:1..3952,gap(149),complement(AAHY01090321.1:1..2090),
CO   gap(268),AAHY01090322.1:1..38480,gap(58),AAHY01090323.1:1..91655,gap(373),
CO   complement(AAHY01090324.1:1..33784),gap(20),AAHY01090325.1:1..5286,gap(20),
CO   complement(AAHY01090326.1:1..16865),gap(1404),AAHY01090327.1:1..49742,
CO   gap(20),AAHY01090328.1:1..4861,gap(47),complement(AAHY01090329.1:1..38584),
CO   gap(346),complement(AAHY01090330.1:1..34790),gap(28),
CO   complement(AAHY01090331.1:1..2582),gap(522),AAHY01090332.1:1..7808,
CO   gap(2112),complement(AAHY01090333.1:1..14503),gap(41),
CO   AAHY01090334.1:1..1552,gap(20),AAHY01090335.1:1..1545,gap(386),
CO   complement(AAHY01090336.1:1..5831),gap(317),AAHY01090337.1:1..49398,
CO   gap(20),complement(AAHY01090338.1:1..1774),gap(20),AAHY01090339.1:1..1263,
CO   gap(20),AAHY01090340.1:1..8808,gap(233),AAHY01090341.1:1..4796,gap(245),
CO   AAHY01090342.1:1..30077,gap(20),AAHY01090343.1:1..8182,gap(834),
CO   AAHY01090344.1:1..2520,gap(656),complement(AAHY01090345.1:1..2168),
CO   gap(5523),complement(AAHY01090346.1:1..1199),gap(255),
CO   complement(AAHY01090347.1:1..8074),gap(20),
CO   complement(AAHY01090348.1:1..13962),gap(164),AAHY01090349.1:1..6474,
CO   gap(44),complement(AAHY01090350.1:1..13721),gap(224),
CO   AAHY01090351.1:1..1887,gap(179),AAHY01090352.1:1..3161,gap(20),
CO   complement(AAHY01090353.1:1..4188),gap(138),AAHY01090354.1:1..3679,
CO   gap(174),complement(AAHY01090355.1:1..67917),gap(20),
CO   complement(AAHY01090356.1:1..1016),gap(20),
CO   complement(AAHY01090357.1:1..1920),gap(20),
CO   complement(AAHY01090358.1:1..2288),gap(20),AAHY01090359.1:1..99206,
CO   gap(200),complement(AAHY01090360.1:1..9322),gap(20),
CO   complement(AAHY01090361.1:1..8672),gap(85),AAHY01090362.1:1..63726,gap(20),
CO   complement(AAHY01090363.1:1..40894),gap(20),AAHY01090364.1:1..2788,gap(20),
CO   AAHY01090365.1:1..1344,gap(20),complement(AAHY01090366.1:1..3292),gap(20),
CO   AAHY01090367.1:1..32224,gap(20),AAHY01090368.1:1..28689,gap(357),
CO   AAHY01090369.1:1..69425,gap(77),AAHY01090370.1:1..49397,gap(20),
CO   AAHY01090371.1:1..6567,gap(20),AAHY01090372.1:1..6616,gap(20),
CO   AAHY01090373.1:1..52598,gap(23),AAHY01090374.1:1..2825,gap(767),
CO   complement(AAHY01090375.1:1..1708),gap(249),
CO   complement(AAHY01090376.1:1..10229),gap(135),
CO   complement(AAHY01090377.1:1..17396),gap(20),
CO   complement(AAHY01090378.1:1..14674),gap(20),AAHY01090379.1:1..26234,
CO   gap(20),AAHY01090380.1:1..37050,gap(50),AAHY01090381.1:1..27818,gap(20),
CO   AAHY01090382.1:1..27542,gap(20),AAHY01090383.1:1..40497,gap(20),
CO   complement(AAHY01090384.1:1..1618),gap(490),AAHY01090385.1:1..19403,
CO   gap(20),AAHY01090386.1:1..1107,gap(20),complement(AAHY01090387.1:1..71515),
CO   gap(20),complement(AAHY01090388.1:1..20695),gap(20),
CO   complement(AAHY01090389.1:1..26614),gap(20),AAHY01090390.1:1..3854,gap(20),
CO   AAHY01090391.1:1..4497,gap(20),AAHY01090392.1:1..12830,gap(235),
CO   AAHY01090393.1:1..11414,gap(134),AAHY01090394.1:1..36426,gap(20),
CO   AAHY01090395.1:1..3548,gap(40),AAHY01090396.1:1..2525,gap(484),
CO   complement(AAHY01090397.1:1..1425),gap(20),
CO   complement(AAHY01090398.1:1..1008),gap(20),
CO   complement(AAHY01090399.1:1..1170),gap(20),AAHY01090400.1:1..35317,
CO   gap(204),AAHY01090401.1:1..2067,gap(846),AAHY01090402.1:1..10050,gap(207),
CO   AAHY01090403.1:1..17494,gap(63),AAHY01090404.1:1..3000,gap(160),
CO   AAHY01090405.1:1..4822,gap(106),AAHY01090406.1:1..1520,gap(362),
CO   AAHY01090407.1:1..1959,gap(817),AAHY01090408.1:1..18482,gap(31720),
CO   AAHY01090409.1:1..34319,gap(20),AAHY01090410.1:1..41055,gap(403),
CO   AAHY01090411.1:1..4195,gap(23340),AAHY01090412.1:1..6363,gap(247),
CO   AAHY01090413.1:1..23795,gap(94),complement(AAHY01090414.1:1..3378),
CO   gap(1099),complement(AAHY01090415.1:1..1076),gap(2987),
CO   AAHY01090416.1:1..33757,gap(1967),AAHY01090417.1:1..1755,gap(20),
CO   AAHY01090418.1:1..10321,gap(20),AAHY01090419.1:1..21460,gap(20),
CO   AAHY01090420.1:1..2491,gap(20),AAHY01090421.1:1..8054,gap(20),
CO   complement(AAHY01090422.1:1..5749),gap(20),AAHY01090423.1:1..1671,gap(20),
CO   complement(AAHY01090424.1:1..1118),gap(20),AAHY01090425.1:1..1810,gap(20),
CO   complement(AAHY01090426.1:1..1539),gap(20),AAHY01090427.1:1..3391,gap(20),
CO   complement(AAHY01090428.1:1..6619),gap(370),AAHY01090429.1:1..10697,
CO   gap(1031),complement(AAHY01090430.1:1..4855),gap(20),
CO   complement(AAHY01090431.1:1..1058),gap(540),
CO   complement(AAHY01090432.1:1..1074),gap(20),
CO   complement(AAHY01090433.1:1..1344),gap(20),
CO   complement(AAHY01090434.1:1..1546),gap(20),AAHY01090435.1:1..2750,gap(20),
CO   AAHY01090436.1:1..10517,gap(20),AAHY01090437.1:1..16820,gap(32),
CO   complement(AAHY01090438.1:1..12080),gap(20),AAHY01090439.1:1..12318,
CO   gap(99),AAHY01090440.1:1..8513,gap(20),AAHY01090441.1:1..2608,gap(20),
CO   complement(AAHY01090442.1:1..11667),gap(158),
CO   complement(AAHY01090443.1:1..22577),gap(343),AAHY01090444.1:1..10394,
CO   gap(20),AAHY01090445.1:1..1818,gap(20),complement(AAHY01090446.1:1..11667),
CO   gap(97),complement(AAHY01090447.1:1..4279),gap(92),
CO   complement(AAHY01090448.1:1..6731),gap(54),
CO   complement(AAHY01090449.1:1..21392),gap(305),AAHY01090450.1:1..12444,
CO   gap(546),AAHY01090451.1:1..34651,gap(315),AAHY01090452.1:1..7981,gap(49),
CO   AAHY01090453.1:1..6775,gap(20),complement(AAHY01090454.1:1..53371),
CO   gap(1113),complement(AAHY01090455.1:1..32902),gap(217),
CO   AAHY01090456.1:1..5770,gap(20),AAHY01090457.1:1..17931,gap(248),
CO   AAHY01090458.1:1..33451,gap(91),complement(AAHY01090459.1:1..1861),gap(20),
CO   AAHY01090460.1:1..32976,gap(29),AAHY01090461.1:1..46992,gap(222),
CO   AAHY01090462.1:1..2991,gap(224),AAHY01090463.1:1..4583,gap(742),
CO   AAHY01090464.1:1..9625,gap(20),AAHY01090465.1:1..1210,gap(20),
CO   AAHY01090466.1:1..24367,gap(20),AAHY01090467.1:1..2235,gap(728),
CO   complement(AAHY01090468.1:1..1871),gap(20),AAHY01090469.1:1..1133,gap(20),
CO   AAHY01090470.1:1..3413,gap(20),complement(AAHY01090471.1:1..11827),gap(20),
CO   complement(AAHY01090472.1:1..1265),gap(20),
CO   complement(AAHY01090473.1:1..1004),gap(20),AAHY01090474.1:1..26488,
CO   gap(5991),AAHY01090475.1:1..16767,gap(222),
CO   complement(AAHY01090476.1:1..21820),gap(173),AAHY01090477.1:1..7800,
CO   gap(923),AAHY01090478.1:1..2176,gap(962),AAHY01090479.1:1..21952,gap(1015),
CO   AAHY01090480.1:1..30383,gap(20),AAHY01090481.1:1..1269,gap(20),
CO   AAHY01090482.1:1..20439,gap(20),AAHY01090483.1:1..10053,gap(20),
CO   AAHY01090484.1:1..4300,gap(3261),AAHY01090485.1:1..2249,gap(3257),
CO   AAHY01090486.1:1..29950,gap(20),AAHY01090487.1:1..11322,gap(1116),
CO   AAHY01090488.1:1..14748,gap(20),complement(AAHY01090489.1:1..1144),gap(20),
CO   AAHY01090490.1:1..1595,gap(3473),AAHY01090491.1:1..24116,gap(20),
CO   AAHY01090492.1:1..11046,gap(20),AAHY01090493.1:1..18835,gap(4852),
CO   complement(AAHY01090494.1:1..13072),gap(20),
CO   complement(AAHY01090495.1:1..9078),gap(20),
CO   complement(AAHY01090496.1:1..8572),gap(4133),AAHY01090497.1:1..21594,
CO   gap(310),AAHY01090498.1:1..2796,gap(74),AAHY01090499.1:1..25251,gap(20),
CO   AAHY01090500.1:1..28652,gap(118),complement(AAHY01090501.1:1..26394),
CO   gap(910),AAHY01090502.1:1..13698,gap(173),
CO   complement(AAHY01090503.1:1..10091),gap(3930),
CO   complement(AAHY01090504.1:1..8512),gap(180),AAHY01090505.1:1..28903,
CO   gap(204),AAHY01090506.1:1..27712,gap(20),AAHY01090507.1:1..1082,gap(20),
CO   AAHY01090508.1:1..1947,gap(5999),AAHY01090509.1:1..24464,gap(51),
CO   AAHY01090510.1:1..24636,gap(61),AAHY01090511.1:1..9785,gap(45),
CO   AAHY01090512.1:1..26225,gap(20),AAHY01090513.1:1..3625,gap(350),
CO   AAHY01090514.1:1..19913,gap(35),AAHY01090515.1:1..50638,gap(20),
CO   AAHY01090516.1:1..16697,gap(508),AAHY01090517.1:1..27899,gap(46),
CO   AAHY01090518.1:1..20023,gap(20),AAHY01090519.1:1..7203,gap(292),
CO   complement(AAHY01090520.1:1..19680),gap(20),AAHY01090521.1:1..3100,
CO   gap(763),AAHY01090522.1:1..2616,gap(162),
CO   complement(AAHY01090523.1:1..8557),gap(1307),
CO   complement(AAHY01090524.1:1..20337),gap(20),AAHY01090525.1:1..14036,
CO   gap(194),AAHY01090526.1:1..82463,gap(20),AAHY01090527.1:1..46454,gap(297),
CO   complement(AAHY01090528.1:1..22959),gap(263),AAHY01090529.1:1..24904,
CO   gap(20),AAHY01090530.1:1..4189,gap(20),AAHY01090531.1:1..1003,gap(20),
CO   complement(AAHY01090532.1:1..1543),gap(20),AAHY01090533.1:1..6192,gap(20),
CO   complement(AAHY01090534.1:1..11450),gap(253),AAHY01090535.1:1..37622,
CO   gap(76),AAHY01090536.1:1..7584,gap(292),complement(AAHY01090537.1:1..1665),
CO   gap(1375),complement(AAHY01090538.1:1..1796),gap(20),
CO   AAHY01090539.1:1..4344,gap(20),AAHY01090540.1:1..54223,gap(140),
CO   AAHY01090541.1:1..15809,gap(99),AAHY01090542.1:1..13354,gap(366),
CO   complement(AAHY01090543.1:1..3466),gap(20),
CO   complement(AAHY01090544.1:1..1117),gap(20),
CO   complement(AAHY01090545.1:1..7806),gap(24),
CO   complement(AAHY01090546.1:1..26370),gap(20),
CO   complement(AAHY01090547.1:1..3571),gap(20),AAHY01090548.1:1..31422,gap(20),
CO   complement(AAHY01090549.1:1..11124),gap(20),AAHY01090550.1:1..32345,
CO   gap(375),AAHY01090551.1:1..56891,gap(4585),AAHY01090552.1:1..23293,gap(20),
CO   AAHY01090553.1:1..15374,gap(17456),AAHY01090554.1:1..3734,gap(790),
CO   complement(AAHY01090555.1:1..8318),gap(405),
CO   complement(AAHY01090556.1:1..6478),gap(582),
CO   complement(AAHY01090557.1:1..7839),gap(20),AAHY01090558.1:1..4832,
CO   gap(2615),AAHY01090559.1:1..8881,gap(20),
CO   complement(AAHY01090560.1:1..8449),gap(208),AAHY01090561.1:1..24073,
CO   gap(612),complement(AAHY01090562.1:1..20775),gap(20),
CO   complement(AAHY01090563.1:1..29311),gap(20),
CO   complement(AAHY01090564.1:1..1118),gap(20),
CO   complement(AAHY01090565.1:1..1943),gap(20),AAHY01090566.1:1..1827,gap(20),
CO   AAHY01090567.1:1..5196,gap(20),AAHY01090568.1:1..4488,gap(20),
CO   AAHY01090569.1:1..3347,gap(20),AAHY01090570.1:1..30053,gap(20),
CO   AAHY01090571.1:1..15719,gap(3203),AAHY01090572.1:1..32703,gap(89),
CO   AAHY01090573.1:1..88749,gap(150),AAHY01090574.1:1..1012,gap(236),
CO   AAHY01090575.1:1..3198,gap(244),complement(AAHY01090576.1:1..7976),gap(20),
CO   complement(AAHY01090577.1:1..1179),gap(20),
CO   complement(AAHY01090578.1:1..10053),gap(20),
CO   complement(AAHY01090579.1:1..4429),gap(20),AAHY01090580.1:1..14502,
CO   gap(2338),AAHY01090581.1:1..6012,gap(85),AAHY01090582.1:1..16422,gap(46),
CO   AAHY01090583.1:1..29738,gap(151),complement(AAHY01090584.1:1..4012),
CO   gap(20),AAHY01090585.1:1..2274,gap(218),AAHY01090586.1:1..18357,gap(20),
CO   AAHY01090587.1:1..8888,gap(20),AAHY01090588.1:1..26309,gap(4318),
CO   AAHY01090589.1:1..41381,gap(20),AAHY01090590.1:1..1313,gap(20),
CO   AAHY01090591.1:1..4602,gap(20),complement(AAHY01090592.1:1..1243),gap(20),
CO   AAHY01090593.1:1..1466,gap(20),AAHY01090594.1:1..6207,gap(20),
CO   AAHY01090595.1:1..4448,gap(86),AAHY01090596.1:1..21195,gap(20),
CO   AAHY01090597.1:1..2826,gap(212),AAHY01090598.1:1..14173,gap(110),
CO   complement(AAHY01090599.1:1..96386),gap(235),
CO   complement(AAHY01090600.1:1..7634),gap(100),AAHY01090601.1:1..7942,
CO   gap(104),AAHY01090602.1:1..10445,gap(120),AAHY01090603.1:1..8412,gap(20),
CO   complement(AAHY01090604.1:1..1955),gap(40),
CO   complement(AAHY01090605.1:1..39634),gap(63),
CO   complement(AAHY01090606.1:1..6465),gap(20),
CO   complement(AAHY01090607.1:1..8683),gap(20),AAHY01090608.1:1..26489,
CO   gap(201),AAHY01090609.1:1..27102,gap(20),AAHY01090610.1:1..7094,gap(20),
CO   complement(AAHY01090611.1:1..1561),gap(20),AAHY01090612.1:1..25410,
CO   gap(607),AAHY01090613.1:1..9268,gap(20),AAHY01090614.1:1..13703,gap(20),
CO   complement(AAHY01090615.1:1..1045),gap(20),AAHY01090616.1:1..7947,gap(20),
CO   complement(AAHY01090617.1:1..4983),gap(20),
CO   complement(AAHY01090618.1:1..12286),gap(20),AAHY01090619.1:1..18392,
CO   gap(1721),AAHY01090620.1:1..7216,gap(20),AAHY01090621.1:1..1256,gap(20),
CO   AAHY01090622.1:1..1391,gap(20),AAHY01090623.1:1..65129,gap(20),
CO   AAHY01090624.1:1..40367,gap(117),AAHY01090625.1:1..24822,gap(349),
CO   AAHY01090626.1:1..11865,gap(20),complement(AAHY01090627.1:1..1646),gap(20),
CO   complement(AAHY01090628.1:1..9158),gap(4012),AAHY01090629.1:1..49708,
CO   gap(179),complement(AAHY01090630.1:1..1910),gap(20),AAHY01090631.1:1..1427,
CO   gap(20),AAHY01090632.1:1..5633,gap(1436),AAHY01090633.1:1..1310,gap(195),
CO   complement(AAHY01090634.1:1..2223),gap(20),AAHY01090635.1:1..2108,gap(20),
CO   complement(AAHY01090636.1:1..1290),gap(4875),AAHY01090637.1:1..1489,
CO   gap(414),AAHY01090638.1:1..1554,gap(20),complement(AAHY01090639.1:1..1408),
CO   gap(20),AAHY01090640.1:1..4307,gap(20),AAHY01090641.1:1..2403,gap(20),
CO   AAHY01090642.1:1..1936,gap(20),AAHY01090643.1:1..52300,gap(20),
CO   complement(AAHY01090644.1:1..2072),gap(2579),AAHY01090645.1:1..4237,
CO   gap(20),AAHY01090646.1:1..1841,gap(20),AAHY01090647.1:1..3881,gap(20),
CO   complement(AAHY01090648.1:1..2040),gap(20),AAHY01090649.1:1..49248,gap(20),
CO   complement(AAHY01090650.1:1..1157),gap(20),AAHY01090651.1:1..45139,gap(20),
CO   complement(AAHY01090652.1:1..9234),gap(20),AAHY01090653.1:1..9328,gap(542),
CO   AAHY01090654.1:1..29618,gap(599),AAHY01090655.1:1..868,gap(431),
CO   AAHY01090656.1:1..922,gap(582),complement(AAHY01090657.1:1..74003),
CO   gap(122),AAHY01090658.1:1..68512,gap(20),AAHY01090659.1:1..33555,gap(20),
CO   AAHY01090660.1:1..4330,gap(3598),AAHY01090661.1:1..5399,gap(20),
CO   complement(AAHY01090662.1:1..2795),gap(2759),AAHY01090663.1:1..10085,
CO   gap(44),complement(AAHY01090664.1:1..4935),gap(23),AAHY01090665.1:1..1807,
CO   gap(20),complement(AAHY01090666.1:1..2285),gap(2216),
CO   AAHY01090667.1:1..1158,gap(328),AAHY01090668.1:1..9040,gap(116),
CO   AAHY01090669.1:1..38681,gap(22),complement(AAHY01090670.1:1..4917),gap(20),
CO   AAHY01090671.1:1..1010,gap(20),complement(AAHY01090672.1:1..5550),gap(20),
CO   AAHY01090673.1:1..14562,gap(2635),complement(AAHY01090674.1:1..4225),
CO   gap(20),AAHY01090675.1:1..2464,gap(1103),
CO   complement(AAHY01090676.1:1..66537),gap(46),AAHY01090677.1:1..35512,
CO   gap(128),AAHY01090678.1:1..29604,gap(47),AAHY01090679.1:1..62622,gap(2876),
CO   AAHY01090680.1:1..4944,gap(20),AAHY01090681.1:1..47170,gap(79),
CO   complement(AAHY01090682.1:1..10103),gap(491),AAHY01090683.1:1..24892,
CO   gap(595),AAHY01090684.1:1..16986,gap(114),AAHY01090685.1:1..18879,gap(104),
CO   AAHY01090686.1:1..22583,gap(268),AAHY01090687.1:1..10623,gap(481),
CO   AAHY01090688.1:1..5485,gap(20),complement(AAHY01090689.1:1..33412),gap(67),
CO   complement(AAHY01090690.1:1..45879),gap(20),
CO   complement(AAHY01090691.1:1..1059),gap(20),
CO   complement(AAHY01090692.1:1..1230),gap(20),AAHY01090693.1:1..20571,gap(20),
CO   AAHY01090694.1:1..1763,gap(20),AAHY01090695.1:1..5646,gap(20),
CO   AAHY01090696.1:1..6760,gap(132),AAHY01090697.1:1..3290,gap(2826),
CO   AAHY01090698.1:1..8606,gap(20),complement(AAHY01090699.1:1..23047),gap(20),
CO   AAHY01090700.1:1..5395,gap(20),complement(AAHY01090701.1:1..20125),
CO   gap(180),AAHY01090702.1:1..23560,gap(20),AAHY01090703.1:1..13599,gap(3327),
CO   AAHY01090704.1:1..78090,gap(20),AAHY01090705.1:1..41116,gap(20),
CO   AAHY01090706.1:1..4988,gap(155),AAHY01090707.1:1..21272,gap(3002),
CO   AAHY01090708.1:1..7343,gap(20),complement(AAHY01090709.1:1..41621),
CO   gap(1559),AAHY01090710.1:1..1229,gap(20),
CO   complement(AAHY01090711.1:1..1035),gap(5021),AAHY01090712.1:1..29557,
CO   gap(3195),AAHY01090713.1:1..10939,gap(817),AAHY01090714.1:1..6697,gap(20),
CO   AAHY01090715.1:1..36303,gap(46),AAHY01090716.1:1..21898,gap(20),
CO   AAHY01090717.1:1..52488,gap(116),complement(AAHY01090718.1:1..7870),
CO   gap(44),complement(AAHY01090719.1:1..9209),gap(665),
CO   complement(AAHY01090720.1:1..1124),gap(1595),
CO   complement(AAHY01090721.1:1..1395),gap(20),
CO   complement(AAHY01090722.1:1..8631),gap(20),
CO   complement(AAHY01090723.1:1..11050),gap(20),AAHY01090724.1:1..47436,
CO   gap(236),AAHY01090725.1:1..14838,gap(346),AAHY01090726.1:1..18671,gap(130),
CO   complement(AAHY01090727.1:1..51460),gap(604),
CO   complement(AAHY01090728.1:1..4864),gap(52),
CO   complement(AAHY01090729.1:1..7066),gap(110),AAHY01090730.1:1..1783,gap(20),
CO   AAHY01090731.1:1..38083,gap(97),AAHY01090732.1:1..23697,gap(470),
CO   AAHY01090733.1:1..2976,gap(232),complement(AAHY01090734.1:1..50626),
CO   gap(260),AAHY01090735.1:1..10610,gap(811),AAHY01090736.1:1..19383,gap(155),
CO   complement(AAHY01090737.1:1..7011),gap(164),
CO   complement(AAHY01090738.1:1..21226),gap(91),
CO   complement(AAHY01090739.1:1..10307),gap(101),AAHY01090740.1:1..9887,
CO   gap(2814),complement(AAHY01090741.1:1..4607),gap(20),
CO   complement(AAHY01090742.1:1..1701),gap(20),
CO   complement(AAHY01090743.1:1..5034),gap(317),AAHY01090744.1:1..2439,
CO   gap(321),complement(AAHY01090745.1:1..69342),gap(20),
CO   AAHY01090746.1:1..41184,gap(51),complement(AAHY01090747.1:1..11943),
CO   gap(739),complement(AAHY01090748.1:1..14634),gap(20),
CO   complement(AAHY01090749.1:1..42705),gap(3590),AAHY01090750.1:1..11128,
CO   gap(20),AAHY01090751.1:1..18607,gap(1608),AAHY01090752.1:1..1185,gap(20),
CO   AAHY01090753.1:1..19688,gap(552),AAHY01090754.1:1..9004,gap(20),
CO   AAHY01090755.1:1..2419,gap(20),AAHY01090756.1:1..22311,gap(20),
CO   AAHY01090757.1:1..2795,gap(102),AAHY01090758.1:1..5334,gap(788),
CO   complement(AAHY01090759.1:1..17761),gap(60),AAHY01090760.1:1..35280,
CO   gap(20),AAHY01090761.1:1..2515,gap(20),AAHY01090762.1:1..1045,gap(2071),
CO   AAHY01090763.1:1..63063,gap(155),AAHY01090764.1:1..100735,gap(20),
CO   complement(AAHY01090765.1:1..14936),gap(20),
CO   complement(AAHY01090766.1:1..4751),gap(124),AAHY01090767.1:1..13709,
CO   gap(99),AAHY01090768.1:1..64673,gap(20),AAHY01090769.1:1..13269,gap(20),
CO   AAHY01090770.1:1..6804,gap(20),AAHY01090771.1:1..8718,gap(3428),
CO   AAHY01090772.1:1..5191,gap(20),AAHY01090773.1:1..5081,gap(294),
CO   AAHY01090774.1:1..1365,gap(20),AAHY01090775.1:1..5755,gap(20),
CO   AAHY01090776.1:1..2209,gap(20),AAHY01090777.1:1..1176,gap(20),
CO   AAHY01090778.1:1..1654,gap(20),complement(AAHY01090779.1:1..2773),gap(20),
CO   AAHY01090780.1:1..40932,gap(20),AAHY01090781.1:1..8072,gap(20),
CO   complement(AAHY01090782.1:1..1322),gap(831),AAHY01090783.1:1..16047,
CO   gap(37666),AAHY01090784.1:1..25690,gap(20),AAHY01090785.1:1..22763,gap(20),
CO   AAHY01090786.1:1..2310,gap(1415),AAHY01090787.1:1..7801,gap(441),
CO   AAHY01090788.1:1..11143,gap(2082),AAHY01090789.1:1..6101,gap(5050),
CO   AAHY01090790.1:1..2743,gap(1779),AAHY01090791.1:1..15395,gap(3514),
CO   AAHY01090792.1:1..6788,gap(20473),AAHY01090793.1:1..15084,gap(20),
CO   AAHY01090794.1:1..1132,gap(185),AAHY01090795.1:1..22407,gap(20),
CO   AAHY01090796.1:1..22861,gap(20),complement(AAHY01090797.1:1..1243),gap(20),
CO   complement(AAHY01090798.1:1..1141),gap(228),AAHY01090799.1:1..4228,
CO   gap(1613),AAHY01090800.1:1..59802,gap(96),AAHY01090801.1:1..57211,gap(59),
CO   complement(AAHY01090802.1:1..8193),gap(22),AAHY01090803.1:1..22565,
CO   gap(4533),AAHY01090804.1:1..8130,gap(346),AAHY01090805.1:1..32639,gap(392),
CO   AAHY01090806.1:1..89525,gap(20),AAHY01090807.1:1..32740,gap(20),
CO   AAHY01090808.1:1..4009,gap(20),complement(AAHY01090809.1:1..2835),gap(20),
CO   AAHY01090810.1:1..1291,gap(20),complement(AAHY01090811.1:1..3410),gap(20),
CO   AAHY01090812.1:1..1049,gap(20),AAHY01090813.1:1..17629,gap(571),
CO   AAHY01090814.1:1..36615,gap(20),AAHY01090815.1:1..1912,gap(855),
CO   AAHY01090816.1:1..2300,gap(293),AAHY01090817.1:1..13109,gap(20),
CO   AAHY01090818.1:1..4311,gap(20),AAHY01090819.1:1..22657,gap(20),
CO   AAHY01090820.1:1..2274,gap(6121),AAHY01090821.1:1..2937,gap(20),
CO   AAHY01090822.1:1..27689,gap(537),AAHY01090823.1:1..28384,gap(20),
CO   complement(AAHY01090824.1:1..1424),gap(56),AAHY01090825.1:1..41976,gap(20),
CO   AAHY01090826.1:1..3458,gap(20),complement(AAHY01090827.1:1..1375),gap(20),
CO   AAHY01090828.1:1..23631,gap(20),complement(AAHY01090829.1:1..6306),gap(20),
CO   AAHY01090830.1:1..4990,gap(20),AAHY01090831.1:1..9436,gap(20),
CO   AAHY01090832.1:1..8283,gap(21),AAHY01090833.1:1..35429,gap(20),
CO   AAHY01090834.1:1..43080,gap(20),AAHY01090835.1:1..10094,gap(20),
CO   AAHY01090836.1:1..7930,gap(20),AAHY01090837.1:1..2368,gap(20),
CO   AAHY01090838.1:1..24726,gap(20),AAHY01090839.1:1..44846,gap(20),
CO   AAHY01090840.1:1..14840,gap(20),AAHY01090841.1:1..6601,gap(81),
CO   complement(AAHY01090842.1:1..3991),gap(292),AAHY01090843.1:1..39012,
CO   gap(234),AAHY01090844.1:1..51253,gap(20),AAHY01090845.1:1..2497,gap(1853),
CO   AAHY01090846.1:1..47910,gap(20),AAHY01090847.1:1..50186,gap(20),
CO   AAHY01090848.1:1..5233,gap(20),AAHY01090849.1:1..3321,gap(20),
CO   AAHY01090850.1:1..15633,gap(2182),AAHY01090851.1:1..55789,gap(20),
CO   AAHY01090852.1:1..13286,gap(145),AAHY01090853.1:1..6476,gap(20),
CO   AAHY01090854.1:1..11676,gap(372),AAHY01090855.1:1..1509,gap(2368),
CO   AAHY01090856.1:1..6847,gap(2364),AAHY01090857.1:1..30121,gap(20),
CO   AAHY01090858.1:1..1468,gap(20),complement(AAHY01090859.1:1..3714),gap(20),
CO   complement(AAHY01090860.1:1..3812),gap(20),AAHY01090861.1:1..1242,gap(20),
CO   AAHY01090862.1:1..7351,gap(20),complement(AAHY01090863.1:1..2328),gap(20),
CO   AAHY01090864.1:1..2318,gap(326),AAHY01090865.1:1..2148,gap(166),
CO   AAHY01090866.1:1..21528,gap(254),AAHY01090867.1:1..4966,gap(20),
CO   AAHY01090868.1:1..13340,gap(145),AAHY01090869.1:1..8210,gap(20),
CO   AAHY01090870.1:1..13305,gap(20),AAHY01090871.1:1..138059,gap(20),
CO   AAHY01090872.1:1..11383,gap(694),AAHY01090873.1:1..20100,gap(20),
CO   AAHY01090874.1:1..45418,gap(437),AAHY01090875.1:1..10163,gap(2806),
CO   AAHY01090876.1:1..1170,gap(20),AAHY01090877.1:1..3887,gap(20),
CO   AAHY01090878.1:1..48054,gap(20),AAHY01090879.1:1..18621,gap(294),
CO   AAHY01090880.1:1..13677,gap(743),complement(AAHY01090881.1:1..935),
CO   gap(821),AAHY01090882.1:1..945,gap(20),AAHY01090883.1:1..1926,gap(188),
CO   AAHY01090884.1:1..36281,gap(20),AAHY01090885.1:1..3539,gap(20),
CO   complement(AAHY01090886.1:1..10877),gap(20),AAHY01090887.1:1..2441,gap(20),
CO   complement(AAHY01090888.1:1..1926),gap(20),AAHY01090889.1:1..8500,gap(360),
CO   AAHY01090890.1:1..7490,gap(56),AAHY01090891.1:1..35450,gap(20),
CO   complement(AAHY01090892.1:1..52982),gap(20),
CO   complement(AAHY01090893.1:1..2127),gap(20),
CO   complement(AAHY01090894.1:1..2041),gap(20),AAHY01090895.1:1..9175,gap(20),
CO   AAHY01090896.1:1..4952,gap(20),AAHY01090897.1:1..68459,gap(20),
CO   AAHY01090898.1:1..59207,gap(20),AAHY01090899.1:1..17471,gap(20),
CO   AAHY01090900.1:1..7433,gap(20),complement(AAHY01090901.1:1..2031),gap(94),
CO   AAHY01090902.1:1..90070,gap(5991),AAHY01090903.1:1..53837,gap(20),
CO   complement(AAHY01090904.1:1..7683),gap(20),AAHY01090905.1:1..30449,gap(20),
CO   complement(AAHY01090906.1:1..31340),gap(20),AAHY01090907.1:1..26610,
CO   gap(20),AAHY01090908.1:1..143867,gap(1298),AAHY01090909.1:1..2174,gap(431),
CO   AAHY01090910.1:1..35994,gap(20),AAHY01090911.1:1..3486,gap(44),
CO   AAHY01090912.1:1..7007,gap(20),complement(AAHY01090913.1:1..5867),gap(20),
CO   complement(AAHY01090914.1:1..2318),gap(512),AAHY01090915.1:1..26058,
CO   gap(1969),AAHY01090916.1:1..722,gap(2224),AAHY01090917.1:1..4558,gap(1901),
CO   AAHY01090918.1:1..11615,gap(5041),AAHY01090919.1:1..66045,gap(20),
CO   AAHY01090920.1:1..35127,gap(45),complement(AAHY01090921.1:1..7510),gap(20),
CO   AAHY01090922.1:1..36833,gap(20),AAHY01090923.1:1..43271,gap(322),
CO   AAHY01090924.1:1..3518,gap(1905),AAHY01090925.1:1..19571,gap(1420),
CO   complement(AAHY01090926.1:1..10677),gap(20),AAHY01090927.1:1..85201,
CO   gap(20),complement(AAHY01090928.1:1..6971),gap(167),
CO   AAHY01090929.1:1..43082,gap(380),AAHY01090930.1:1..25577,gap(665),
CO   AAHY01090931.1:1..16611,gap(127),AAHY01090932.1:1..14701,gap(2664),
CO   complement(AAHY01090933.1:1..638),gap(1291),AAHY01090934.1:1..1390,
CO   gap(466),AAHY01090935.1:1..17263,gap(20),
CO   complement(AAHY01090936.1:1..20131),gap(571),AAHY01090937.1:1..3839,
CO   gap(20),complement(AAHY01090938.1:1..16389),gap(20),
CO   complement(AAHY01090939.1:1..18302),gap(20),AAHY01090940.1:1..16877,
CO   gap(20),AAHY01090941.1:1..19251,gap(20),AAHY01090942.1:1..70044,gap(4645),
CO   AAHY01090943.1:1..28320,gap(20),AAHY01090944.1:1..26216,gap(74),
CO   AAHY01090945.1:1..25169,gap(20),AAHY01090946.1:1..47754,gap(263),
CO   AAHY01090947.1:1..2125,gap(3081),AAHY01090948.1:1..14655,gap(87),
CO   AAHY01090949.1:1..5625,gap(4437),AAHY01090950.1:1..93586,gap(450),
CO   AAHY01090951.1:1..9285,gap(337),AAHY01090952.1:1..1443,gap(20),
CO   AAHY01090953.1:1..23427,gap(20),AAHY01090954.1:1..4076,gap(1029),
CO   complement(AAHY01090955.1:1..25603),gap(20),
CO   complement(AAHY01090956.1:1..31360),gap(53),AAHY01090957.1:1..5137,
CO   gap(237),AAHY01090958.1:1..11354,gap(121),
CO   complement(AAHY01090959.1:1..13321),gap(1557),
CO   complement(AAHY01090960.1:1..1049),gap(2083),AAHY01090961.1:1..5700,
CO   gap(529),complement(AAHY01090962.1:1..13622),gap(20),
CO   complement(AAHY01090963.1:1..1955),gap(271),AAHY01090964.1:1..29650,
CO   gap(57),AAHY01090965.1:1..2205,gap(20),AAHY01090966.1:1..47649,gap(6214),
CO   complement(AAHY01090967.1:1..1969),gap(20),
CO   complement(AAHY01090968.1:1..2036),gap(1928),AAHY01090969.1:1..1300,
CO   gap(241),complement(AAHY01090970.1:1..11084),gap(520),
CO   AAHY01090971.1:1..25596,gap(20),AAHY01090972.1:1..18669,gap(579),
CO   AAHY01090973.1:1..43449,gap(105),AAHY01090974.1:1..25171,gap(20),
CO   complement(AAHY01090975.1:1..38004),gap(20),AAHY01090976.1:1..5965,gap(20),
CO   complement(AAHY01090977.1:1..1001),gap(20),
CO   complement(AAHY01090978.1:1..1721),gap(23),
CO   complement(AAHY01090979.1:1..26465),gap(20),AAHY01090980.1:1..26571,
CO   gap(20),AAHY01090981.1:1..1015,gap(20),AAHY01090982.1:1..1140,gap(20),
CO   AAHY01090983.1:1..3415,gap(20),complement(AAHY01090984.1:1..1104),gap(20),
CO   AAHY01090985.1:1..22977,gap(20),AAHY01090986.1:1..467,gap(70),
CO   AAHY01090987.1:1..6393,gap(2301),AAHY01090988.1:1..99462,gap(130),
CO   AAHY01090989.1:1..77697,gap(20),AAHY01090990.1:1..38932,gap(100),
CO   AAHY01090991.1:1..46971,gap(350),AAHY01090992.1:1..2653,gap(20),
CO   AAHY01090993.1:1..16603,gap(20),AAHY01090994.1:1..14463,gap(460),
CO   complement(AAHY01090995.1:1..1165),gap(20),AAHY01090996.1:1..10404,
CO   gap(249),AAHY01090997.1:1..15503,gap(20),AAHY01090998.1:1..5429,gap(20),
CO   AAHY01090999.1:1..3054,gap(20),AAHY01091000.1:1..29540,gap(4181),
CO   AAHY01091001.1:1..3085,gap(20),AAHY01091002.1:1..17162,gap(20),
CO   AAHY01091003.1:1..30057,gap(745),AAHY01091004.1:1..1059,gap(20),
CO   AAHY01091005.1:1..3291,gap(20),AAHY01091006.1:1..3652,gap(160),
CO   complement(AAHY01091007.1:1..8848),gap(20),AAHY01091008.1:1..5210,gap(20),
CO   complement(AAHY01091009.1:1..4809),gap(20),AAHY01091010.1:1..6235,gap(20),
CO   complement(AAHY01091011.1:1..23503),gap(1761),AAHY01091012.1:1..1328,
CO   gap(24),AAHY01091013.1:1..60019,gap(20),AAHY01091014.1:1..81191,gap(20),
CO   AAHY01091015.1:1..115157,gap(20),AAHY01091016.1:1..34238,gap(20),
CO   AAHY01091017.1:1..10952,gap(3475),AAHY01091018.1:1..33261,gap(70),
CO   AAHY01091019.1:1..1287,gap(20),AAHY01091020.1:1..33176,gap(295),
CO   AAHY01091021.1:1..20389,gap(20),AAHY01091022.1:1..12609,gap(1276),
CO   AAHY01091023.1:1..1774,gap(20),AAHY01091024.1:1..1198,gap(108),
CO   AAHY01091025.1:1..7567,gap(425),AAHY01091026.1:1..3120,gap(86),
CO   AAHY01091027.1:1..1464,gap(477),AAHY01091028.1:1..19693,gap(148),
CO   AAHY01091029.1:1..7157,gap(20),AAHY01091030.1:1..2779,gap(20),
CO   complement(AAHY01091031.1:1..1222),gap(20),AAHY01091032.1:1..9533,gap(20),
CO   AAHY01091033.1:1..8344,gap(20),AAHY01091034.1:1..8339,gap(20),
CO   AAHY01091035.1:1..1416,gap(20),AAHY01091036.1:1..24342,gap(195),
CO   AAHY01091037.1:1..9131,gap(167),AAHY01091038.1:1..28592,gap(4174),
CO   complement(AAHY01091039.1:1..2844))
//